Loading...
HomeMy WebLinkAbout11-17-2020 City Council Agenda Packet Tuesday, November 17, 2020 Based on the threat of COVID-19 as reflected in the Proclamations of Emergency issued by both the Governor of the State of California, the San Luis Obispo County Emergency Services Director and the City Council of the City of San Luis Obispo as well as the Governor’s Executive Order N-29-20 issued on March 17, 2020, relating to the convening of public meetings in response to the COVID-19 pandemic, the City of San Luis Obispo will be holding all public meetings via teleconference. There will be no physical location for the Public to view the meeting. Below are instructions on how to view the meeting remotely and how to leave public comment. Additionally, members of the City Council are allowed to attend the meeting via teleconference and to participate in the meeting to the same extent as if they were present. Using the most rapid means of communication available at this time, members of the public are encouraged to participate in Council meetings in the following ways: 1. Remote Viewing -Members of the public who wish to watch the meeting can view: x View the Webinar (recommended for the best viewing quality): ¾Registration URL: https://attendee.gotowebinar.com/register/5064170648431299596 ¾Webinar ID: 475-422-795 ¾Telephone Attendee: +1 (914) 614-3221, Audio Access Code: 857-877-635 Note: The City uses Go to Webinar for City Council Meetings. Please test speakers and mic prior to joining webinar. Click here to watch a YouTube tutorial for GoToWebinar Attendees. x Televised live on Charter Cable Channel 20 x View a livestream of the meeting on the City’s YouTube channel: http://youtube.slo.city 2.Public Comment - The City Council will still be accepting public comment. Public comment can be submitted in the following ways: x Mail or Email Public Comment ¾Received by 3:00 PM on the day of meeting -Can be submitted via email to emailcouncil@slocity.org or U.S. Mail to City Clerk at 990 Palm St. San Luis Obispo, CA 93401. All emails will be archived/distributed to councilmembers, however, submissions after 3:00 p.m. on the day of the meeting may not be archived/distributed until the following day. Emails will not be read aloud during the meeting. x Verbal Public Comment ¾In Advance of the Meeting -Call (805) 781-7164; state and spell your name, the agenda item number you are calling about and leave your comment. The verbal comments must be limited to 3 minutes. All voicemails will be forwarded to the Council Members and saved as Agenda Correspondence. Voicemails will not be played during the meeting. ¾During the meeting –Join the webinar (instructions above). Once the meeting has started, please put your name and the item # you would like to speak on in the questions box. During the public comment section for the item, your name will be called, and your mic will be unmuted. If you have questions, contact the office of the City Clerk at cityclerk@slocity.org or (805) 781-7100. San Luis Obispo City Council Agenda November 17, 2020 Page 2 San Luis Obispo Page 2 6:00 PM REGULAR MEETING TELECONFERENCE Broadcasted via Webinar CALL TO ORDER:Mayor Heidi Harmon ROLL CALL:Council Members Carlyn Christianson, Andy Pease, Erica A. Stewart, Vice Mayor Aaron Gomez, and Mayor Heidi Harmon APPOINTMENTS 1. ADVISORY APPOINTMENTS FOR UNSCHEDULED VACANCIES (PURRINGTON / CHRISTIAN –5 MINUTES) Recommendation: Confirm appointments to the Human Relations Commission and Citizens’ Revenue Enhancement Oversight Commission, as recommended by the Council Liaison Subcommittees. PUBLIC COMMENT PERIOD FOR ITEMS NOT ON THE AGENDA (Not to exceed 15 minutes total) The Council welcomes your input. State law does not allow the Council to discuss or take action on issues not on the agenda, except that members of the Council or staff may briefly respond to statements made or questions posed by persons exercising their public testimony rights (Gov. Code sec. 54954.2). Staff may be asked to follow up on such items. CONSENT AGENDA Matters appearing on the Consent Calendar are expected to be non-controversial and will be acted upon at one time. A member of the public may request the Council to pull an item for discussion.Pulled items shall be heard at the close of the Consent Agenda unless a majority of the Council chooses another time. The public may comment on any and all items on the Consent Agenda within the three-minute time limit. 2. WAIVE READING IN FULL OF ALL RESOLUTIONS AND ORDINANCES (PURRINGTON) Recommendation: Waive reading of all resolutions and ordinances as appropriate. San Luis Obispo City Council Agenda November 17, 2020 Page 3 3. MINUTES REVIEW - OCTOBER 20, 2020 AND OCTOBER 30, 2020 CITY COUNCIL MINUTES (PURRINGTON) Recommendation: Approve the minutes of the City Council meeting held on October 20, 2020 and the Special City Council meeting on October 30, 2020. 4. REVIEW OF A MILLS ACT HISTORICAL PROPERTY CONTRACT FOR THE LOZELLE AND KATIE FLICKINGER GRAHAM HOUSE (A MASTER LIST RESOURCE)(CODRON / OETZELL) Recommendation: As recommended by the Cultural Heritage Committee, adopt a Resolution entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, approving a Historic Property Preservation Agreement between the City and the owners of the Lozelle and Katie Flickinger Graham House at 1789 Santa Barbara Street (Application No. HIST-0359-2020).” 5.CONSIDERATION OF THE HUMAN RELATIONS COMMISSION’S RECOMMENDED PRIORITIES FOR THE 2021-22 COMMUNITY DEVELOPMENT BLOCK GRANT AND GRANTS-IN-AID PROGRAMS (CODRON / VERESCHAGIN) Recommendation: Approve the Community Development Block Grant and Grants-in-Aid funding priorities for the 2020-21 funding year, as recommended by the Human Relations Commission. 6. APPROVAL OF THE SLO TRANSIT PUBLIC TRANSPORTATION AGENCY SAFETY PLAN (HORN / ANGUIANO) Recommendation: Adopt a Resolution entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, approving the City of San Luis Obispo Transit Public Transportation Agency Safety Plan”developed by Caltrans in compliance with Federal Transit Administration requirements (49 CFR Part 673). 7. AUTHORIZATION TO ENTER INTO A CONTRACT WITH PG&E TO PARTICIPATE IN THE ELECTRIC VEHICLE FLEET PROGRAM (HORN / ANGUIANO) Recommendation: Authorize the City Manager to execute an agreement, once provided by PG&E, to participate in the PG&E Electric Vehicle (EV) Fleet Program. San Luis Obispo City Council Agenda November 17, 2020 Page 4 8. MEMORANDUM OF UNDERSTANDING FOR UNDERGROUND UTILITY CONDUIT INFRASTRUCTURE WITH THE COUNTY OF SAN LUIS OBISPO (HERMANN / GUARDADO / WILWAND) Recommendation: Approve and authorize the Deputy City Manager or their designee to execute the Memorandum of Understanding (MOU) for Underground Utility Conduit Infrastructure with the County of San Luis Obispo. 9. REVISIONS TO THE SAN LUIS OBISPO REGIONAL TRANSIT AUTHORITY JOINT POWERS AGREEMENT (HORN / ANGUIANO) Recommendation: Adopt a Resolution entitled, “A Resolution of the City Council of San Luis Obispo, California, authorizing execution of the amended and restated Joint Powers Agreement for the San Luis Obispo Regional Transit Authority”allowing consolidation of South County Transit into the San Luis Obispo Regional Transit Authority. 10. PARTIAL ACCEPTANCE OF PUBLIC IMPROVEMENTS FOR TRACTS 3063-2, 3066-2, 3095, AND 3111, RESIDENTIAL SUBDIVISIONS IN THE ORCUTT AREA (CODRON / VAN BEVEREN) Recommendation: 1. Adopt a Resolution for Tract 3063-2 entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, accepting the completed Public Improvements of Tract 3063-2; certifying the completed Private Subdivision Improvements of Tract 3063-2; releasing the Securities for the completed portions of Tract 3063-2; And authorizing the Director of Public Works to accept the remaining improvements and to release the remaining Securities once all the improvements are deemed complete;” and 2. Adopt a Resolution for Tract 3066-2 entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, accepting the completed Public Improvements of Tract 3066-2; certifying the completed Private Subdivision Improvements of Tract 3066-2; releasing the Securities for the completed portions of Tract 3066-2; and authorizing the Director of Public Works to accept the remaining improvements and to release the remaining securities once all the improvements are deemed complete;” and 3. Adopt a Resolution for Tract 3095 entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, accepting the completed Public Improvements of Tract 3095; certifying the completed Private Subdivision Improvements of Tract 3095; releasing the Securities for the completed portions of Tract 3095; and authorizing the Director of Public Works to accept the remaining improvements and to release the remaining securities once all the improvements are deemed complete;” and 4.Adopt a Resolution for Tract 3111 entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, accepting the completed Public Improvements of Tract 3111; releasing the Securities for the completed portions of Tract 3111; and authorizing the Director of Public Works to accept the remaining improvements and to release the remaining securities once all the improvements are deemed complete.” San Luis Obispo City Council Agenda November 17, 2020 Page 5 11. AUTHORIZE A TEMPORARY EXTENSION OF THE OPEN SPACE EVENING HOURS OF USE PILOT PROGRAM (HERMANN / HILL) Recommendation: 1.Approve a Resolution entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, adopting an Addendum to the Mitigated Negative Declaration for the temporary extension of a Pilot Program for Winter Open Space hours of use;” and 2.Direct staff to return to City Council in April 2021, following the conclusion of the additional third season of the Pilot Program, to receive and file the final summary report and provide direction regarding any future open space evening hours of use that the City Council may wish to consider. 12. AUTHORIZATION TO SUBMIT AN APPLICATION FOR REGIONAL EARLY ACTION PLANNING GRANTS PROGRAM (CODRON / COHEN) Recommendation: Approve a Resolution entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, authorizing an application for and entering into agreements regarding Regional Early Action Planning (REAP) Grant Funds.” PUBLIC HEARING AND BUSINESS ITEMS 13. CONSIDERATION OF THE DIVERSITY, EQUITY AND INCLUSION TASK FORCE RECOMMENDATIONS OF GRANT FUNDING TO HIGH-IMPACT DE&I PROGRAMS (JOHNSON / MAGEE - 30 MINUTES) Recommendation: 1. As recommended by the Diversity, Equity and Inclusion Task Force approve the 2020- 21 Notice of Funding Availability for High-Impact DE&I programs grant funding allocations in the amount of $109,800; and 2. Authorize the City Manager to execute agreements with each grant recipient. 14. RECEIVE A STATUS UPDATE FOR THE 2019-21 GOAL SETTING AND FINANCIAL PLAN PROCESS (ELKE / HARNETT - 60 MINUTES) Recommendation: Receive and discuss the following background information in preparation for the 2021-23 Goal-Setting and Financial Plan process: 1.FY 2020-21 1st Quarter Report; and 2.Status of the 2020-21 adopted Meta Goal and original Major City Goal components; and 3.General Plan and Climate Action Plan Update; and 4. Setting the stage framework including core services and a scan of strategic indicators for all major funds. San Luis Obispo City Council Agenda November 17, 2020 Page 6 15. 2020 INTERIM YEAR SOLID WASTE RATE ADOPTION (FLOYD / LANE - 15 MINUTES) Recommendation: Adopt a Resolution entitled “A Resolution of the City Council of the City of San Luis Obispo, California, Establishing Integrated Solid Waste Rates.” 16. REVIEW OF THE 6TH CYCLE HOUSING ELEMENT UPDATE AND A NEGATIVE DECLARATION OF ENVIRONMENTAL IMPACT (CODRON / COHEN - 45 MINUTES) Recommendation: 1.As recommended by the Planning Commission, adopt a Resolution entitled “A Resolution of the City Council of the City of San Luis Obispo, California, approving and adopting a Negative Declaration of Environmental Impact and Amendments to the Housing Element of the General Plan as represented in the Council Agenda Report and attachments dated November 17, 2020 (GENP-0217-2020 & EID-0218-2020 )” 2.Adopt a Resolution, entitled “A Resolution of the City Council of the City of San Luis Obispo, California, to Resolve that the City of San Luis Obispo Commits to being a Safe, Inclusive and Welcoming Community for Everyone and to Facilitate Voluntary Citizen Action to Redact or Repudiate Racist and Discriminatory Verbiage from Their Property Deeds”. 17. SPECIFIC PLAN AMENDMENT AND VESTING TENTATIVE TRACT MAP (VTTM 3142) FOR AN 11.44-ACRE NC-ZONED LOCATED IN THE SAN LUIS RANCH SPECIFIC PLAN; 1035 MADONNA ROAD (SPEC-0172-2020; SBDV-0173- 2020)(CODRON / RICKENBACH - 45 MINUTES) Recommendation: As recommended by the Planning Commission, adopt a Resolution entitled “A Resolution of the City Council of the City of San Luis Obispo, California, Approving a Specific Plan Amendment for the San Luis Ranch Specific Plan, in order to allow up to 139,300 sf of Commercial, 97,000 sf of office, and 654 Residential Units within the plan area, and to update other aspects of the Specific Plan to accommodate this development; Approval of Vesting Tentative Tract Map 3142 within previously approved Vesting Tentative Tract Map 3096 To create 11 lots in the NC Zone of the San Luis Ranch Specific Plan, for the Commercial, Office, and Residential Units within these lots, as allowed under the Specific Plan Amendment; and a determination that the project is consistent with the Certified Final EIR and Final Supplemental EIR for San Luis Ranch Specific Plan when considered in conjunction with an addendum approved by the City Council on August 18, 2020; as represented in the agenda report and attachments dated November 17, 2020 (1035 Madonna Road, SPEC-0172-2020; SBDV-0173-2020)”amending the San Luis Ranch Specific Plan and approving a Vesting Tentative Tract Map (VTTM 3142.) San Luis Obispo City Council Agenda November 17, 2020 Page 7 18. CONSIDER ADOPTING A RESOLUTION ESTABLISHING CITY SUPPORT FOR H.R. 1384, THE MEDICARE FOR ALL ACT OF 2019 (JOHNSON - 15 MINUTES) Recommendation Adopt a Resolution entitled, “A Resolution of the City Council of the City of San Luis Obispo,California, in support of H.R. 1384, The Medicare For All Act of 2019” and urging its passage by Congress. LIAISON REPORTS AND COMMUNICATIONS (Not to exceed 15 minutes) Council Members report on conferences or other City activities. At this time, any Council Member or the City Manager may ask a question for clarification, make an announcement, or report briefly on his or her activities. In addition, subject to Council Policies and Procedures, they may provide a reference to staff or other resources for factual information, request staff to report back to the Council at a subsequent meeting concerning any matter, or take action to direct staff to place a matter of business on a future agenda. (Gov. Code Sec. 54954.2) ADJOURNMENT The next Regular City Council Meeting is scheduled for Tuesday, December 1, 2020 at 6:00 p.m., via teleconference. LISTENING ASSISTIVE DEVICES are available for the hearing impaired--please see City Clerk. The City of San Luis Obispo wishes to make all of its public meetings accessible to the public. Upon request, this agenda will be made available in appropriate alternative formats to persons with disabilities. Any person with a disability who requires a modification or accommodation in order to participate in a meeting should direct such request to the City Clerk’s Office at (805) 781-7100 at least 48 hours before the meeting, if possible. Telecommunications Device for the Deaf (805) 781-7410. City Council regular meetings are televised live on Charter Channel 20.Agenda related writings or documents provided to the City Council are available for public inspection in the City Clerk’s Office located at 990 Palm Street, San Luis Obispo, California during normal business hours, and on the City’s website www.slocity.org.Persons with questions concerning any agenda item may call the City Clerk’s Office at (805) 781-7100. `lJ / J—I -- ---- -- PROOF OF PUBLICATION (2015.5 C.C.P.) STATE OF CALIFORNIA, County of San Luis Obispo, t am a citizen of the United States and a resident of the county aforesaid; I am over the age of eighteen years, and not a party interested in the above entitled matter. I am the principal clerk of the printer of the New Tinges, a newspaper of general circulation, printed and published weekly in the City of San Luis Obispo, County of San Luis Obispo, and which has been adjudged a newspaper of general circulation by the Superior Court of the County of San Luis Obispo, State of California, under the date of February 5, 1993, Case number CV72789: that notice of which the annexed is a printed copy (set in type not smaller than nonpareil), has been published in each regular and entire issue of said newspaper and not in any supplement thereof on the following dates, to -wit: in the year 2020, I certify (or declare) under the the penalty of perjury that the foregoing is true and correct. Dated at San I.WS Dbjs)toI Califs tote, this duty—�Of , 2020. //0" �rot Patricia Horton, New Times Legals f lvk6.1Jiiiin � li•i�unaU•N rh1(7 nJnlinN I'h1(� 011ie ri I1li SINEtiSiI'ul,lic Nolice.J l'nx�r of I'ul, I SAN LUIS OBISPO CITY COUNCIL NOTICE OF PUBLIC HEARING The San Luis Obispo City Council invites all interested parsons to parilopute in a public meeting or, Tuesday, November 17, 2020, at GM p.m. White the Councif oncouragges public participation, growing concern about the COViO 18 ppandemic has raquired that public meetings he held via telecanlerenee. Meetings caa be viewed on Government Access Channel 20 or streamed live from the City's YouTube Channel at htip:/lyouiuhe.sla,city. Public comment, prior to the start of the meeting, may be submitted in writing via U.S. Mail delivered to Ilia City Clerk's etlice a1990 Palm Street. San Luis Obispo, CA 93401 or by email to amailcouncilQbsfocity.arg. Public Hearing Items: A public hearing will be held to consider adapting a Resolution approvin a Historic Property Preservation Agreement %Mween the City of San Luls Obispo and the owners of the Lozolle and Katio Flickinger Graham House at 1789 Santa Barbara Street IHIST--M59-2020I. For more iglfermaticri contact Waller Oatzell Assistant Planner, for the City'sCoMmuaitleDevelopment Department or f8U5i 781-7M ar 8y email, woateo119s/aciryorg. • A public hearing will he held to review the Wh Cycle Housing Element Update end a Negative Cinloration of Environmental Impect. The Housing Element is a state required element of the Gen araI Plan that must he updated according to a cycle established by the States Department of Housing and Community Devolopmem. Updating the Housing Element is a key step in the City's efforts 10 expand affordable housing opportunities and is required by California Government Code Section 65511111- 65589.8 (SENP- 0217-2020 & EID-0218-2020). For mare lnlefmation, contact Rachel Cohen. Associate Planner, for the Cify's CommunityDsvelopment0apartm#nt of fM1781.7574 or by email rcahonalocily.org. • A public hearing will he held to consider a adopting a Resolution, as recommended by the Planning Commission, amondina the San Luis fianoh Specific Plan and approving a Vesting Tentative Tract Map W M 31421 based on findings and subject to conditions of approval {SPEC-0172-2020 & SBDV- 0173.2020,1035 Madonna Road). For more information, contact John Rickenbach, Contract Project Manager, For the City's Community Development Department at (805) 610-1109 or by email, jfrlckenbachO aul.com. A public hearing will be held to consider adopting a Resolution ustabtishirlg Integrated Sol Id Waste Rates In Rate Sotting lnturimYear 2020. Far mare information, contact Jennifer 77rampsen 8067ess Manager, for Ill# City's Utilities Department at (805) 781-7206 or by email jrhampson&lacify.org. the City Council may also discuss other hearings ar businoss itemsbefore or after the items listed abov& if you "'ollenga Ilia proposed project in court, you may he limited to raising only those Issues you or someone else raised et the public haa0ng descrlbad in this notice, or in written co rresp undenc I- delivered to the City Ccano11 at, or prior to, the public hearing. Reports for this meeting will be available for review online at www.sloc".org no later than 72 hours prior to the meeting. Please call the City Clerk's Office at (805) 781- 7100 for more information. The City Council meating wlll be televised live on Charter Cable Channel 20 and live streaming on the Citys YouTube channel hitps:llyoutube. slo.city. Teresa Purrington City Clerk City of San Luis Obispo November 5, 2020 U19 NLU 'rTY CLERK Page intentionally left blank. Department Name: Administration Cost Center:1021 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Greg Hermann, Deputy City Manager Prepared By:Teresa Purrington, City Clerk Kevin Christian, Deputy City Clerk SUBJECT:ADVISORY BODY APPOINTMENTS FOR UNSCHEDULED VACANCIES RECOMMENDATION Confirm appointments to the Human Relations Commission (HRC) and Citizens’Revenue Enhancement Oversight Commission (REOC), as recommended by the Council Liaison Subcommittees detailed below. DISCUSSION Annual appointments to the various City Advisory Body Committees were made at the March 17, 2020 City Council meeting. The process for those appointments included recruitment by the City Clerk’s office, interviews and recommendations by the various Council sub-committees, and final confirmation of recommendations by the full Council. Applications of candidates not selected for appointment are held for one year per the Advisory Body Handbook for use in appointments for unscheduled vacancies. In August 2020, Commissioners Drew Littlejohns (HRC) and Chris Coates (REOC) tendered their resignations. Recruitment was opened for these positions as there were no further candidates available from the annual recruitment process for either commission. Human Relations Commission:Eight qualified candidates were interviewed via teleconference on October 22, 2020 by Council Liaison Subcommittee member Stewart and HRC Chair Renoda Campbell-Monza. Based on interview performance and candidate background, Antony Henry is being recommended for appointment to fill the open HRC seat for the remainder of the 4-year term, ending March 31, 2022. Revenue Enhancement Oversight Commission:Three qualified candidates were interviewed via teleconference on October 27, 2020 by Council Liaison Subcommittee member Stewart and REOC Vice Chair McClure. Based on interview performance and candidate background, Matt Quaglino is being recommended for appointment to fill the open REOC seat for the remainder of the 3-year term, ending June 30, 2022. Packet Page 1 Item 1 Recruitment is continuing for vacancies on the following Advisory Bodies as listed: x Construction Board of Appeals –One four-year position with a term expiring March 31, 2022. x Cultural Heritage Committee –One four-year position with a term expiring March 31, 2024. Policy Context The Advisory Body Handbook, last adopted by City Council in February 2018, outlines the recruitment procedures, membership requirements, and term limits. Also contained in the Advisory Body Handbook are the bylaws for all advisory bodies, some of which include additional membership requirements. Additionally, the City Council Policies and Procedures Manual, last adopted in August 2019, describes the “Appointment Procedure” and “Process” for Advisory Body appointments. Recruitment and appointment recommendations were performed in conformance with all recruitment procedures, processes, and bylaws found in these resources. Public Engagement Recruitment for both the HRC and REOC has been open since August 25, 2020, posted on the City website Advisory Body Vacancies page, Job Openings page, and has been listed and noticed as required by the “Maddy Act” (GC 54972, Local Appointments List). CONCURRENCE The Council Liaison Subcommittees concur with the recommendations. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended actions in this report, because the action does not constitute a “Project” under CEQA Guidelines sec. 15378. FISCAL IMPACT Budgeted: N/A Budget Year: 2020-21 Funding Identified: Packet Page 2 Item 1 Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund N/A State Federal Fees Other: Total There is no additional impact for appointment of Advisory Body members. ALTERNATIVES Council could recommend changes to the recommended appointments or direct staff to re- open recruitment for additional candidates. This is not recommended as there were sufficient qualified candidates for both positions, and the Council Liaison Subcommittee feel they have been quite thorough in their consideration of applicants and the Council’s needs in their selection process. AVAILABLE FOR REVIEW All applications are available for public review, by request, in the Office of the City Clerk, which can be reached at (805) 781-7100 or cityclerk@slocity.org during normal business hours. Packet Page 3 Item 1 Page intentionally left blank. Packet Page 4 Item 1 San Luis Obispo Page 1 Tuesday, October 2, 2020 Regular Meeting of the City Council CALL TO ORDER A Regular Meeting of the San Luis Obispo City Council was called to order on Tuesday, October 20, 2020 at time 6:05 p.m. by Mayor Harmon, with all Members present via teleconference. ROLL CALL Council Members Present:Council Members Carlyn Christianson, Andy Pease, Erica A. Stewart, Vice Mayor Aaron Gomez, and Mayor Heidi Harmon. Council Members Absent:None City Staff Present:Derek Johnson, City Manager; Christine Dietrick, City Attorney; and Teresa Purrington, City Clerk; were present at Roll Call. Other staff members presented reports or responded to questions as indicated in the minutes. PRESENTATIONS 1. NATIONAL HOSPICE AND PALLIATIVE CARE MONTH PROCLAMATION Mayor Harmon presented a Proclamation for National Hospice and Palliative Care Month to Shannon McOuat, Executive Director of Hospice SLO County. PUBLIC COMMENT ON ITEMS NOT ON THE AGENDA Michelle Walter William Walter Marshall James Michael Giuffre Chloe Fleischer Karrissa Hamblet Rey Smith Alejandro Bupara ---End of Public Comment--- Packet Page 5 Item 3 San Luis Obispo City Council Minutes of October 20, 2020 Page 2 CONSENT AGENDA ACTION:MOTION BY COUNCIL MEMBER CHRISTIANSON, SECOND BY COUNCIL MEMBER PEASE, CARRIED 5-0 to approve Consent Calendar Items 2 thru 9. 2. WAIVE READING IN FULL OF ALL RESOLUTIONS AND ORDINANCES CARRIED 5-0, to waive reading of all resolutions and ordinances as appropriate. 3. MINUTES REVIEW - OCTOBER 6, 2020 CITY COUNCIL MINUTES CARRIED 5-0, to approve the minutes of the City Council meeting held on October 6, 2020. 4. CONSIDERATION OF A REGIONAL SURFACE TRANSPORTATION EXCHANGE / SURFACE TRANSPORTATION BLOCK GRANT COOPERATIVE AGREEMENT WITH THE SAN LUIS OBISPO COUNCIL OF GOVERNMENTS CARRIED 5-0, to: 1. Adopt Resolution No. 11172 (2020 Series)entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, authorizing the City Manager to execute the San Luis Obispo Council of Governments Regional Surface Transportation Exchange/Surface Transportation Block Grant Cooperative Agreement No. SLO-FAST- 01;” and 2. Approve the priority of projects proposed for use of discretionary Urban State Highway Account, funding allocations (Table 1); and 3. Authorize the Assistant City Manager or their designee to submit future grant applications for projects eligible for competitive grants administered by SLOCOG; and 4. Authorize the Assistant City Manager or their designee to execute SLOCOG grant reimbursement requests and other related grant documents on behalf of the City; and 5. Authorize the Finance Director to augment the budget and appropriate grant funds and approve budget amendments on a project-by-project basis to appropriate Regional State Highway Account, Urban State Highway Account, and Safe Route to Schools grant funds administered by SLOCOG. 5. AUTHORIZATION TO APPLY FOR THE STATEWIDE PARK DEVELOPMENT AND COMMUNITY REVITALIZATION GRANT PROGRAM CARRIED 5-0, to: 1. Approve Resolution No. 11173 (2020 Series)entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, approving the application for statewide Park Development and Community Revitalization Program Grant Funds”authorizing staff to submit a grant application, for a total amount not to exceed $8,500,000; and 2. Authorize the Assistant City Manager to execute the necessary grant documents and appropriate the grant amount into the Parks and Recreation Department’s budget upon grant award. Packet Page 6 Item 3 San Luis Obispo City Council Minutes of October 20, 2020 Page 3 6. FINAL ACCEPTANCE OF A PORTION OF PUBLIC IMPROVEMENTS FOR TRACT 3083 (1299 ORCUTT ROAD) CARRIED 5-0 to adopt Resolution No. 11174 (2020 Series) entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, accepting a portion of the Public Improvements; releasing the securities for the accepted portions of Tract 3083; and authorizing the Director of Public Works to accept the remaining Public Improvements, then release the remaining securities once the Improvements are deemed complete.” 7. FY 2020 SAN LUIS OBISPO COUNTY INTEGRATED WASTE MANAGEMENT AUTHORITY TECHNICAL ASSISTANCE GRANT CARRIED 5-0, to: 1. Authorize the Utilities Department to submit an application for the 2020 Integrated Waste Management Authority Technical Assistance Grant in the amount of $10,000; and 2. If the grant is awarded, authorize the City Manager to execute necessary grant documents and direct the appropriation of monies to the accounts required to administer the grant. 8. MINIMUM WAGE ADJUSTMENTS FOR 2021 PER THE CALIFORNIA FAIR WAGE ACT OF 2016 CARRIED 5-0, to adopt Resolution 11175 (2020 Series) entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, establishing and adopting a Supplemental Employee Salary Schedule and superseding previous resolutions in conflict” to comply with the California Fair Wage Act of 2016 requiring a minimum wage of $14.00 per hour effective December 24, 2020. 9. AUTHORIZATION TO ADOPT THE FUNDING, CONSTRUCTION, AND ACQUISITION AGREEMENT FOR THE CITY OF SAN LUIS OBISPO COMMUNITY FACILITIES DISTRICT NO. 2019-1 (SAN LUIS RANCH) CARRIED 5-0, to adopt Resolution No. 11176 (2020 Series)entitled, “A Resolution of the Council of the City of San Luis Obispo, California, approving the Funding, Construction and Acquisition Agreement for the San Luis Obispo Community Facilities District No. 2019-1 (San Luis Ranch).” PUBLIC HEARING ITEMS AND BUSINESS ITEMS 10. ANNUAL PUBLIC HEARING FOR THE TOURISM BUSINESS IMPROVEMENT DISTRICT Deputy City Manager Greg Hermann, Tourism Manager Molly Cano and TBID Chair John Conner provided an in-depth staff report and responded to Council questions. Public Comments: None ---End of Public Comment---Packet Page 7 Item 3 San Luis Obispo City Council Minutes of October 20, 2020 Page 4 ACTION:MOTION BY COUNCIL MEMBER STEWART, SECOND BY COUNCIL MEMBER PEASE, CARRIED 4-1 (VICE MAYOR GOMEZ VOTING NO) to: 1. Conduct a public hearing to receive testimony regarding the City Council’s intention to continue the San Luis Obispo Tourism Business Improvement District and determine whether a legally sufficient protest is made; and 2. Adopt Resolution No. 11177 (2020 Series) entitled, “A Resolution of the City Council of the City Of San Luis Obispo, California, declaring the basis for and the levy of the assessment for the San Luis Obispo Tourism Business Improvement District and affirming the establishment of the district” setting forth the basis for the assessment, and levying the assessment upon hotels in the district for fiscal year 2020-21. RECESS Council recessed at 7:50 p.m. and reconvened at 8:00 p.m., with all Council Members present. 11. 4TH QUARTER BUDGET REVIEW City Manager Derek Johnson, Finance Director Brigitte Elke and Principal Budget Analyst Natalie Harnett provided an in-depth staff report and responded to Council questions. Public Comments: Ty Safreno Molly Kern ---End of Public Comment--- ACTION:MOTION BY COUNCIL MEMBER PEASE, SECOND BY COUNCIL MEMBER CHRISTIANSON, CARRIED 5-0 to: 1. Review FY 2019-20 unaudited year end actuals and FY 2020-21 fiscal outlook; and 2. Adopt Resolution No. 11178 (2020 Series)entitled, “A Resolution of the Council of the City of San Luis Obispo, California, approving revisions to the adopted 2020-21 Water and Sewer Fund Budget Appropriations” and 3. Approve the goal setting process and timetable for development of the 2021-23 Financial Plan; and 4. Adopt Resolution 11179 (2020 Series) entitled, “A Resolution of the City Council of the City of San Luis Obispo, California, approving the application for Per Capita Grant Funds” authorizing staff to pursue the Proposition 68 Per Capita Grant Program,with the California Department of Parks and Recreation Office of Grants and Local Services; and 5. Authorize the Assistant City Manager to execute the necessary grant documents and appropriate the grant amount into the Parks and Recreation Department’s budget upon grant award. With the following added recommendation: 6. Approve the appropriation of $20,000 from unassigned FY 18-19 fund balance to fund the necessary work to accomplish the needed specific plan amendments to the Airport Area and Margarita Area Specific Plans. Packet Page 8 Item 3 San Luis Obispo City Council Minutes of October 20, 2020 Page 5 COUNCIL COMMUNICATIONS AND LIAISON REPORTS Council Member Pease indicated she went to League of California Cities Annual Conference. Council Member Christianson indicated she went to the League of California Cities Annual Conference. Council Member Stewart indicated she went to the League of California Cities Annual Conference. ADJOURNMENT The meeting was adjourned at 9:22 p.m. The City Council will hold a Closed Session meeting on Tuesday, November 10, 2020 at 5:00 p.m., via teleconference. The next Regular City Council Meeting is scheduled for Tuesday, November 17, 2020 at 6:00 p.m., via teleconference. __________________________ Teresa Purrington City Clerk APPROVED BY COUNCIL: XX/XX/2020 Packet Page 9 Item 3 San Luis Obispo Page 1 Friday, October 30, 2020 Special Meeting of the City Council CALL TO ORDER A Special Meeting of the San Luis Obispo City Council was called to order on Friday, October 30, 2020 at 5:00 p.m. by City Manager Derek Johnson. ROLL CALL Council Members Present:Council Members Carlyn Christianson, Andy Pease, and Erica A. Stewart Council Members Absent:Vice Mayor Aaron Gomez, and Mayor Heidi Harmon City Staff Present:Derek Johnson, City Manager was present at Roll Call. PUBLIC COMMENT None. ---End of Public Comment--- BUSINESS ITEMS 1. DISCUSSION AND REVIEW OF CONFERENCE SESSIONS ATTENDED DURING THE ANNUAL LEAGUE OF CALIFORNIA CITIES VIRTUAL CONFERENCE City Manager Johnson, along with Council Member Christianson, Pease and Stewart, discussed the sessions they attended during the virtual League of California Cities Annual conference. ADJOURNMENT The meeting was adjourned at 8:05 p.m. The next Regular City Council Meeting is scheduled for Tuesday, November 17, 2020 at 6:00 p.m., in the Council Chamber, via teleconference. __________________________ Teresa Purrington, City Clerk APPROVED BY COUNCIL: XX/XX/2020 Packet Page 10 Item 3 Department Name: Community Development Cost Center:4003 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Michael Codron, Community Development Director Prepared By:Walter Oetzell, Assistant Planner SUBJECT:REVIEW OF A MILLS ACT HISTORICAL PROPERTY CONTRACT FOR THE LOZELLE AND KATIE FLICKINGER GRAHAM HOUSE (A MASTER LIST RESOURCE) RECOMMENDATION As recommended by the Cultural Heritage Committee, adopt a Resolution (Attachment A) approving a Historic Property Preservation Agreement between the City and the owners of the Lozelle and Katie Flickinger Graham House at 1789 Santa Barbara Street, under the terms described in the draft agreement (Attachment B). DISCUSSION The owners of the Lozelle and Katie Flickinger Graham House at 1789 Santa Barbara Street submitted an application to enter into a Mills Act historical property contract with the City. The property was designated as a Master List Resource on July 7, 2020 (Resolution 11139), as a rare example within the City of the Italianate Style, under the eligibility criteria for architecture and integrity set out in the City’s Historic Preservation Ordinance (HPO). The Mills Act Program The Mills Act Program enables California cities to enter contracts with owners of historical property to provide them with tax relief in exchange for an agreement to actively participate in the restoration and maintenance of historical resources. A Mills Act contract is effective for an initial 10-year period, and then is automatically extended annually for an additional year. After the initial term, either the City or the owner may, by written notice, decide not to renew the contract. During the effective term of the contract, the property owner must improve or rehabilitate the property, maintain the property consistent with the Secretary of the Interior’s Standards, and provide visibility of the historical resource from the public right-of-way. Figure 1: Lozelle and Katie Flickinger Graham House Packet Page 11 Item 4 The Conservation and Open Space Element (COSE) of the General Plan describes the City’s goals and policies for the protection of cultural resources. It is the City’s policy that significant historic resources be rehabilitated and preserved (COSE § 3.3). Participation in the Mills Act Program is one of the means by which the City encourages the maintenance and restoration of historic properties (COSE § 3.6.2). A property must be on the City’s Master List of Historic Resources in order to be enrolled in the program. Currently there are 61 properties participating in the program, with the last request approved by the Council in June 2020. Previous Advisory Body and Council Action On July 7th, 2020, the City Council reviewed and approved a request from the property owner to designate the property as a Master List Historic Resource, based on its significance as a rare example within the City of the Italianate Style. The Cultural Heritage Committee reviewed this application for participation in the Mills Act Historic Preservation Program, and the terms of the draft preservation contract, at a public hearing on September 28, 2020 and, by a vote of 6-0-1 (one vacancy), recommended that the Council approve the contract. Policy Context The recommended action on this item is supported by historical preservation policies set out section 3.0 of the Conservation and Open Space Element of the City’s General Plan, particularly Program 3.6.2, regarding participation in financial incentive programs to encourage maintenance and restoration of historic properties, and also with the purpose of encouraging private stewardship of historic buildings through incentives, as provided by § 14.01.010 (B)(3) of the City’s Historic Preservation Ordinance. Public Engagement Public notice of this hearing has been provided to owners and occupants of property near the subject site, and published in The New Times and posted on the City’s website. The agendas for this meeting have been posted at City Hall and online, consistent with adopted notification procedures for development projects. ENVIRONMENTAL REVIEW Entering into a “Mills Act Contract” with the owners of historical property is not subject to the provisions of the California Environmental Quality Act (CEQA) because it is not a project as defined in CEQA Guidelines § 15378 (Definitions –Project). Implementation of the Mills Act is a government fiscal activity which does not involve commitment to any specific project resulting in a potentially significant physical impact on the environment (Guidelines § 15378 (b) (4)). FISCAL IMPACT FISCAL IMPACT Budgeted: N/A Budget Year: Funding Identified: Packet Page 12 Item 4 Fiscal Analysis: Funding Sources Total Budget Available Current Funding Request Remaining Balance Annual Ongoing Cost General Fund N/A N/A N/A N/A State N/A N/A N/A N/A Federal N/A N/A N/A N/A Fees N/A N/A N/A N/A Other:N/A N/A N/A N/A Total N/A N/A N/A N/A After the Mills Act contract is recorded, the County Assessor values the property by an income capitalization method, following guidelines provided by the State Board of Equalization. Because of the timing and the method of valuing the restricted property, it is difficult to accurately estimate the tax savings and resulting fiscal impacts to the City under a particular historical property contract. However, the Office of Historic Preservation (California Department of Parks and Recreation) estimates that property owners participating in the program may realize property tax savings of between 40% and 60% each year for newly improved or purchased older properties. ALTERNATIVES 1.Continue consideration of the request to a future date for additional analysis or research 2.Do not enter into a Mills Act Historical Property Contract with the property owner.This alternative is not recommended. The contract provides a tax relief incentive that is a tool for achieving the City’s goals for historical preservation. Attachments: a - Draft Resolution b - Historic Property Preservation Agreement (Draft) Packet Page 13 Item 4 R _____ RESOLUTION NO. ____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, APPROVING A HISTORIC PROPERTY PRESERVATION AGREEMENT BETWEEN THE CITY AND THE OWNERS OF THE LOZELLE AND KATIE FLICKINGER GRAHAM HOUSE AT 1789 SANTA BARBARA STREET (APPLICATION NO. HIST-0359-2020) WHEREAS, the City Council of the City of San Luis Obispo is authorized by California Government Code § 50280 et seq. (known as “the Mills Act”) to enter into contracts with the owners of qualified historical properties to provide for appropriate use, maintenance, and rehabilitation such that these historic properties retain their historic characteristics; and WHEREAS, the City Council has adopted Resolution No. 9136 (2000 Series), establishing the Mills Act Historic Property Tax Incentive Program as an on-going historic preservation program to promote the preservation, maintenance and rehabilitation of historic resources through financial incentives; and WHEREAS, the City Council of the City of San Luis Obispo has designated this property as a historic resource of the City of San Luis Obispo pursuant to the policies in the City’s Historic Preservation Program Guidelines; and WHEREAS, Michael and Paden Hughes are the owners of that certain qualified real property (“Owners”), together with associated structures and improvement thereon, located on Assessor’s Parcel Number 003-552-011, located at 1789 Santa Barbara Street, in the City of San Luis Obispo, California, also described as the Lozelle and Katie Flickinger Graham House; and WHEREAS, the City and Owners, for their mutual benefit, now desire to enter into an agreement to limit the use of the property to prevent inappropriate alterations and to ensure that character-defining features are preserved and maintained in an exemplary manner, and repairs and improvements are completed as necessary to carry out the purposes of California Government Code, Chapter 1, Part 5 of Division 1 of Title 5, Article 12, Sec. 50280 et seq., and to qualify for an assessment of valuation pursuant to Article 1.9, Sec. 439 et. seq. of the Revenue and Taxation Code. WHEREAS, the Cultural Heritage Committee of the City of San Luis Obispo conducted a public hearing via teleconference from the City of San Luis Obispo, California, on September 28, 2020 for the purpose of reviewing the proposed historic property preservation agreement, and recommended that the City enter into the agreement; and WHEREAS, the City Council conducted a public hearing via teleconference from the City of San Luis Obispo, California, on November 17, 2020 for the purpose of considering approval of the historic property preservation agreement, and has duly considered all evidence, including the record of the Cultural Heritage Committee hearing and recommendation, testimony of the applicant and interested parties, and the evaluation and recommendation by staff, present at said hearing; and Packet Page 14 Item 4 Resolution No. ____ (2020 Series) R _____ WHEREAS, notices of said public hearings were made at the time and in the manner required by law. NOW, THEREFORE, BE IT RESOLVED, by the Council of the City of San Luis Obispo as follows: SECTION 1.Findings. Based upon all the evidence, the City Council makes the following findings: 1. Conservation and Open Space Element Program 3.6.2 states that the City will participate in financial assistance programs such as property tax reduction programs that encourage maintenance and restoration of historic properties. 2. The Lozelle and Katie Flickinger Graham House, located at 1789 Santa Barbara Street, has been recognized as a historic asset in the community by its designation as a Master List Historic Property by the City Council on July 7, 2020(Resolution 11139). As such, maintaining the structure will meet the City’s goals for historic preservation listed in policies 3.3.1 through 3.3.5 of the Conservation and Open Space Element. SECTION 2.Environmental Determination. The City Council has determined that the above actions do not constitute a project, as defined in California Environmental Quality Act Guidelines § 15378 and are not subject to environmental review. SECTION 3.Historic Property Preservation Agreement Approved. The City Council hereby approves the “Historic Property Preservation Agreement between the City of San Luis Obispo and the Owner of the Historic Property Located at 1789 Santa Barbara Street,” to be entered into by the City and the property owners, Michael and Paden Hughes. SECTION 4.Community Development Director Authorized to Sign Agreement for City. The City Council hereby authorizes the Community Development Director to execute said agreement on behalf of the Council of the City of San Luis Obispo. Packet Page 15 Item 4 Resolution No. ____ (2020 Series) R _____ SECTION 5.Recordation of the Agreement. No later than twenty (20) days after the parties enter into said agreement, the City Clerk shall cause the agreement to be recorded in the Office of the County Recorder of the County of San Luis Obispo. Upon motion of Council Member __________, seconded by City Council Member _______________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was passed and adopted this ____ day of ____________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on ___________________________. ____________________________________ Teresa Purrington City Clerk Packet Page 16 Item 4 HISTORIC PROPERTY PRESERVATION AGREEMENT BETWEEN THE CITY OF SAN LUIS OBISPO AND THE OWNERS OF THE HISTORIC PROPERTY LOCATED AT 1789 SANTA BARBARA STREET, IN THE CITY OF SAN LUIS OBISPO, SAN LUIS OBISPO COUNTY, STATE OF CALIFORNIA. THIS AGREEMENT is made and entered into this________day of ________ , 2020, by and between the City of San Luis Obispo, a municipal corporation (hereinafter referred to as the “City”), and Michael and Paden Hughes (hereinafter referred to as “Owners”), and collectively referred to as the “parties.” WHEREAS, Owners are the owners of that certain real property commonly known as 1789 Santa Barbara Street (APN 003-552-011), and legally described as shown in the attached “Exhibit B” (“Owners’ Property”); and WHEREAS, Owners have agreed to enter into an Historical Property Contract with the City for the preservation, maintenance, restoration, or rehabilitation of Owners’Property, an historic resource within the City; NOW, THEREFORE, in consideration of the above recitals and in further consideration of the mutual benefits, promises, and agreements set out herein, the parties agree as follows: Section 1. Description of Preservation Measures. The Owners, their heirs, or assigns hereby agree to undertake and complete, at his expense, the preservation, maintenance, and improvements measures described in “Exhibit A”attached hereto. Section 2. Effective Date and Term of Agreement.This agreement shall be effective and commence upon recordation and shall remain in effect for an initial term of ten (10) years thereafter. Each year upon the anniversary of the agreement’s effective date, such initial term will automatically be extended as provided in California Government Code Section 50280 through 50290 and in Section 3, below. Section 3. Agreement Renewal and Non-renewal. a. Each year on the anniversary of the effective date of this agreement (hereinafter referred to as “annual renewal date”), a year shall automatically be added to the initial term of this agreement unless written notice of non-renewal is served as provided herein. b. If the Owners or the City desire in any year not to renew the agreement, the Owners or the City shall serve written notice of non-renewal of the agreement on the other party. Unless such notice is served by the Owners to the City at least ninety (90) days prior to the annual renewal date, or served by the City to the Owners at least sixty (60) days prior to the annual renewal date, one (1) year shall automatically be added to the term of the agreement as provided herein. Packet Page 17 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 2 c. The Owners may make a written protest of the notice. The City may, at any time prior to the annual renewal date, withdraw its notice to the Owners of non-renewal. d. If either the City or the Owners serve notice to the other party of non-renewal in any year, the agreement shall remain in effect for the balance of the term then remaining. Section 4. Standards and Conditions. During the term of this agreement, the historic property shall be subject to the following conditions: a. Owners agree to preserve, maintain, and, where necessary, restore or rehabilitate the building and its character-defining features, including: the building’s general architectural form, style, materials, design, scale, proportions, organization of windows, doors, and other openings; interior architectural elements that are integral to the building’s historic character or significance; exterior materials, coatings, textures, details, mass, roof line, porch, and other aspects of the appearance of the building’s exterior, as described in Exhibit A, to the satisfaction of the Community Development Director or his designee. b. All building changes shall comply with applicable City specific plans, City regulations and guidelines, and conform to the rules and regulations of the Office of Historic Preservation of the California Department of Parks and Recreation, namely the U.S. Secretary of the Interior’s Standards for Rehabilitation and Standards and Guidelines for Historic Preservation Projects. Interior remodeling shall retain original, character-defining architectural features such as oak and mahogany details, pillars and arches, special tile work, or architectural ornamentation to the greatest extent possible. c. The Community Development Director shall be notified by the Owners of changes to character-defining exterior features prior to their execution, such as major landscaping projects and tree removals, exterior door or window replacement, repainting, remodeling, or other exterior alterations requiring a building permit. The Owners agree to secure all necessary City approvals and/or permits prior to changing the building’s use or commencing construction work. d. Owners agree that property tax savings resulting from this agreement shall be used for property maintenance and improvements as described in Exhibit A. e. The following are prohibited: demolition or partial demolition of the historic building; exterior alterations or additions not in keeping with the standards listed above; dilapidated, deteriorating, or unrepaired structures such as fences, roofs, doors, walls, windows; outdoor storage of junk, trash, debris, appliances, or furniture visible from a public way; or any device, decoration, structure, or vegetation which is unsightly due to lack of maintenance or because such feature adversely affects, or is visually incompatible with, the property’s recognized Packet Page 18 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 3 historic character, significance, and design as determined by the Community Development Director. f. Owners shall allow reasonable periodic examination, by prior appointment, of the interior and exterior of the historic property by representatives of the County Assessor, the State Department of Parks and Recreation, the State Board of Equalization, and the City as may be necessary to determine the owners’ compliance with the terms and provisions of this agreement. Section 5. Furnishing of Information.The Owners hereby agree to furnish any and all information requested by the City which may be necessary or advisable to determine compliance with the terms and provisions of this agreement. Section 6. Cancellation. a. The City, following a duly-noticed public hearing by the City Council as set forth in Government Code Section 50285, may cancel this agreement if it determines that the Owners have breached any of the conditions of this agreement or has allowed the property to deteriorate to the point that it no longer meets the standards for a qualified historic property; or if the City determines that the Owners have failed to preserve, maintain, or rehabilitate the property in the manner specified in Section 4 of this agreement. If a contract is cancelled because of failure of the Owners to preserve, maintain, and rehabilitate the historic property as specified above, the Owners shall pay a cancellation fee to the State Controller as set forth in Government Code Section 50286, which states that the fee shall be 12 ½% of the full value of the property at the time of cancellation without regard to any restriction imposed with this agreement. b. If the historic building is acquired by eminent domain and the City Council determines that the acquisition frustrates the purpose of the agreement, the agreement shall be cancelled and no fee imposed, as specified in Government Code Section 50288. Section 7. Enforcement of Agreement. a. In lieu of and/or in addition to any provisions to cancel the agreement as referenced herein, the City may specifically enforce, or enjoin the breach of, the terms of the agreement. In the event of a default, under the provisions to cancel the agreement by the Owners, the City shall give written notice of violation to the Owners by registered or certified mail addressed to the address stated in this agreement. If such a violation is not corrected to the reasonable satisfaction of the Community Development Director or designee within thirty (30) days thereafter; or if not corrected within such a reasonable time as may be required to cure the breach or default of said breach; or if the default cannot be cured within thirty (30) days (provided that acts to cure the breach or default may be commenced within thirty (30) days and shall thereafter be diligently pursued to completion by the Owners); Packet Page 19 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 4 then the City may, without further notice, declare a default under the terms of this agreement and may bring any action necessary to specifically enforce the obligations of the Owners growing out of the terms of this agreement, apply to any court, state or federal, for injunctive relief against any violation by the Owners or apply for such relief as may be appropriate. b. The City does not waive any claim of default by the Owners if the City does not enforce or cancel this agreement. All other remedies at law or in equity which are not otherwise provided for in this agreement or in the City’s regulations governing historic properties are available to the City to pursue in the event that there is a breach or default under this agreement. No waiver by the City of any breach or default under this agreement shall be deemed to be a waiver of any other subsequent breach thereof or default herein under. c. By mutual agreement, City and Owners may enter into mediation or binding arbitration to resolve disputes or grievances growing out of this contract. Section 8. Binding Effect of Agreement. The Owners hereby subject the historic building located at 1789 Santa Barbara Street, San Luis Obispo, California, Assessor’s Parcel Number 003-552-011, to the covenants, reservations, and restrictions as set forth in this agreement. The City and Owners hereby declare their specific intent that the covenants, reservations, and restrictions as set forth herein shall be deemed covenants running with the land and shall pass to and be binding upon the Owners’successors and assigns in title or interest to the historic property. Every contract, deed, or other instrument hereinafter executed, covering or conveying the historic property or any portion thereof, shall conclusively be held to have been executed, delivered, and accepted subject to the covenants, reservations, and restrictions expressed in this agreement regardless of whether such covenants, restrictions, and reservations are set forth in such contract, deed, or other instrument. Section 9. Notice.Any notice required by the terms of this agreement shall be sent to the address of the respective parties as specified below or at other addresses that may be later specified by the parties hereto. To City: Community Development Director City of San Luis Obispo 919 Palm Street San Luis Obispo, CA 93401 To Owners: Michael and Paden Hughes 1789 Santa Barbara Street San Luis Obispo CA 93401 Section 10. General Provisions. a. None of the terms, provisions, or conditions of this agreement shall be deemed to create a partnership between the parties hereto and any of thei r heirs, successors, or Packet Page 20 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 5 assigns, nor shall such terms, provisions, or conditions cause them to be considered joint ventures or members of any joint enterprise. b. The Owners agree to hold the City and its elected and appointed officials, officers, agents, and employees harmless from liability for damage or from claims for damage for personal injuries, including death, and claims for property damage which may arise from the direct or indirect use or activities of the Owners, or from those of his contractor, subcontractor, agent, employee, or other person acting on the Owners’behalf which relates to the use, operation, maintenance, or improvement of the historic property. The Owners hereby agree to and shall defend the City and its elected and appointed officials, officers, agents, and employees with respect to any and all claims or actions for damages caused by, or alleged to have been caused by, reason of the Owners’activities in connection with the historic property, excepting however any such claims or actions which are the result of the sole negligence or willful misconduct of City, its officers, agents, or employees. c. This hold harmless provision applies to all damages and claims for damages suffered, or alleged to have been suffered, and costs of defense incurred, by reason of the operations referred to in this agreement regardless of whether or not the City prepared, supplied, or approved the plans, specifications, or other documents for the historic property. d. All of the agreements, rights, covenants, reservations, and restrictions contained in this agreement shall be binding upon and shall inure to the benefit of the parties herein, their heirs, successors, legal representatives, assigns, and all persons acquiring any part or portion of the historic property, whether by operation of law or in any manner whatsoever. e. In the event legal proceedings are brought by any party or parties to enforce or restrain a violation of any of the covenants, reservations, or restrictions contained herein, or to determine the rights and duties of any party hereunder, the prevailing party in such proceeding may recover all reasonable attorney’s fees to be fixed by the court, in addition to court costs and other relief ordered by the court. f. In the event that any of the provisions of this agreement are held to be unenforceable or invalid by any court of competent jurisdiction, or by subsequent preemptive legislation, the validity and enforceability of the remaining provisions, or portions thereof, shall not be affected thereby. g. This agreement shall be construed and governed in accordance with the laws of the State of California. Section 11. Amendments. This agreement may be amended, in whole or in part, only by a written recorded instrument executed by the parties hereto. Packet Page 21 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 6 Section 12. Recordation and Fees. No later than twenty (20) days after the parties enter into this agreement, the City shall cause this agreement to be recorded in the office of the County Recorder of the County of San Luis Obispo. Participation in the program shall be at no cost to the Owners; however, the City may charge reasonable and necessary fees to recover direct costs of executing, recording, and administering the historical property contracts. IN WITNESS WHEREOF, the City and Owners have executed this agreement on the day and year written above. OWNERS ____________________________________ ______________________________ Michael Hughes Date ____________________________________ ______________________________ Paden Hughes Date CITY OF SAN LUIS OBISPO ____________________________________ ______________________________ Mayor Heidi Harmon Date Pursuant to authority conferred by Resolution No. __________(2020 Series) ATTEST: ______________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: ______________________________ J. Christine Dietrick City Attorney ALL SIGNATURES MUST BE NOTARIZED Packet Page 22 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 7 EXHIBIT “A” MAINTENANCE AND IMPROVEMENT MEASURES FOR THE LOZELLE AND KATIE FLICKINGER GRAHAM HOUSE LOCATED AT 1789 SANTA BARBARA STREET, SAN LUIS OBISPO, CALIFORNIA Owners shall preserve, maintain, and repair the historic building, including its character-defining architectural features in good condition, to the satisfaction of the Community Development Director or designee, pursuant to a Mills Act Preservation Contract with the City of San Luis Obispo for property located at 1789 Santa Barbara Street. Character-defining features shall include, but are not limited to: roof, eaves, dormers, trim, porches, walls and siding, architectural detailing, doors and windows, window screens and shutters, balustrades and railings, foundations, and surface treatments. Owners agree to make the following improvements or repairs during the term of this contract but in no case later than ten (10) years from the contract date. All changes or repairs shall be consistent with the City’s Historic Preservation Ordinance and the Secretary of the Interior’s Standards for the Treatment of Historic Properties: ƒPreservation and repair of windows, including a unique bathroom window ƒReplacement of roofing materials, and restoration of roof cresting ƒRestoration of period-appropriate landscaping and fence line ƒPlumbing repairs and repairs to address site drainage problems causing water markings around the building foundation ƒExterior paint and trim maintenance Packet Page 23 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 8 EXHIBIT “B” Legal Description For APN/Parcel ID(s): 003-552-011 THE LAND REFERRED TO HEREIN BELOW IS SITUATED IN THE CITY OF SAN LUIS OBISPO, COUNTY OF SAN LUIS OBISPO, STATE OF CALIFORNIA AND IS DESCRIBED AS FOLLOWS: ALL THAT PORTION OF LOT 8 IN BLOCK 176 OF THE RESUBDIVISION OF FRACTIONAL BLOCKS 176 AND 181 OF LOOMIS AND OSGOOD'S ADDITION TO THE CITY OF SAN LUIS OBISPO, IN THE CITY OF SAN LUIS OBISPO, COUNTY OF SAN LUIS OBISPO, STATE OF CALIFORNIA ACCORDING TO MAP RECORDED NOVEMBER 14, 1894 IN BOOK A, PAGE 125 OF MAPS, DESCRIBED AS FOLLOWS: BEGINNING AT A POINT ON THE SOUTHEASTERLY LINE OF SAID LOT 8 WHICH NORTH 53° 07' EAST 59, FEET FROM THE MOST SOUTHERLY CORNER OF SAID LOT 8, SAID POINT BEING THE MOST EASTERLY CORNER OF THE PROPERTY CONVEYED TO FRANK A. SMITH BY DEED RECORDED DECEMBER 5, 1904 IN BOOK 64 OF DEEDS, PAGE 323, RECORDS OF SAID COUNTY; THENCE NORTH 36° 53' WEST ALONG THE NORTHEASTERLY LINE OF THE PROPERTY SO CONVEYED, 85.84 FEET; THENCE NORTH 77° 55’ EAST, 91.39 FEET, MORE OR LESS, TO THE EASTERLY LINE OF SAID LOT 8; THENCE SOUTHEASTERLY ALONG SAID EASTERLY LINE OF LOT 8, 52.70 FEET, MORE OR LESS, TO THE SOUTHEASTERLY LINE OF SAID LOT 8; THENCE SOUTH 53° 07' WEST 60.15 FEET TO THE POINT OF BEGINNING. APN: 003-552-011 Packet Page 24 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 9 State of California } County of San Luis Obispo } On________________, before me __________________________________________, Date Name and Title of the Officer personally appeared, _____________________________________________________, Name of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature __________________________________ Signature of Notary Public Place Notary Seal Above State of California } County of San Luis Obispo } On________________, before me __________________________________________, Date Name and Title of the Officer personally appeared, _____________________________________________________, Name of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature __________________________________ Signature of Notary Public Place Notary Seal Above A Notary Public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached and not the truthfulness, accuracy, or validity of that document. A Notary Public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached and not the truthfulness, accuracy, or validity of that document. Packet Page 25 Item 4 Historic Property Preservation Agreement 1789 Santa Barbara Street Page 10 State of California } County of San Luis Obispo } On________________, before me __________________________________________, Date Name and Title of the Officer personally appeared, _____________________________________________________, Name of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature __________________________________ Signature of Notary Public Place Notary Seal Above State of California } County of San Luis Obispo } On________________, before me __________________________________________, Date Name and Title of the Officer personally appeared, _____________________________________________________, Name of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature __________________________________ Signature of Notary Public Place Notary Seal Above A Notary Public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached and not the truthfulness, accuracy, or validity of that document. A Notary Public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached and not the truthfulness, accuracy, or validity of that document. Packet Page 26 Item 4 Department Name:Community Development Cost Center:4007 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Michael Codron, Community Development Director Prepared By:Cara Vereschagin, Housing Coordinator SUBJECT:CONSIDERATION OF THE HUMAN RELATIONS COMMISSION’S RECOMMENDED PRIORITIES FOR THE 2021-22 COMMUNITY DEVELOPMENT BLOCK GRANT AND GRANTS-IN-AID PROGRAMS RECOMMENDATION Approve the Community Development Block Grant and Grants-in-Aid funding priorities for the 2021-22 funding year, as recommended by the Human Relations Commission. DISCUSSION The City’s annual Community Development Block Grant (CDBG) and Grants-in-Aid (GIA) review method provides the City Council and the public with opportunities to provide early input in the grant award process. Establishing funding priorities is the second step in the four-step procedure, which helps to ensure an open, inclusive, and fair grant application process. The Human Relations Commission (HRC) is the advisory body to the City Council on funding priorities and recommendations for both grant programs. CDBG and GIA Program Overview The CDBG program is a federal program administered by the U.S. Department of Housing and Urban Development (HUD). The County of San Luis Obispo manages this grant and the final funding decisions must be approved by the Board of Supervisors in the County’s annual Action Plan. The funding is non-competitive, however, projects that are recommended for funding must directly or indirectly benefit low-income persons. The City’s GIA program serves to provide financial support to non-profit organizations that promote the economic and social well-being of the citizens of San Luis Obispo. Programs requesting GIA funding must be tied explicitly to at least one funding priority and must be compliant with the HRC’s Statement of Purpose and Bylaws. CDBG and GIA Project Decision Process The four steps in the review process for both grant programs are as follows: 1.HRC “Community Needs Workshop”: The HRC hosted a public hearing on October 7, 2020 to inform the public about the upcoming CDBG and GIA funding cycles, how to apply for grants, to hear community views on grant funding needs, and to develop funding priorities. In addition, an Open City Hall online forum was available to those not able to attend the workshop. Responses were incorporated into the development of funding priorities for both grant programs. Minutes from this meeting can be found in Attachment A. Packet Page 27 Item 5 2. Council Priority Setting: Council sets CDBG and GIA funding priorities which is scheduled for the November 17, 2020 meeting. 3. HRC Funding Recommendations Hearings: HRC will hold two separate public hearings to finalize funding recommendations for both CDBG and GIA programs. The hearing for the CDBG program is scheduled for December 2, 2020. The hearing for the GIA program is scheduled for May 5, 2021. 4. City Council Approval of Final Recommendations: City Council will review and approve final funding recommendations for both CDBG and GIA programs. The Council will hold a public hearing for CDBG funding decisions, which is tentatively scheduled for the March 2, 2021 City Council meeting. Final funding allocations for the GIA program is tentatively scheduled for City Council review in July/August 2021. HRC Recommended CDBG and GIA Funding Priorities for Program Year 2021-22 After hearing and reviewing public testimony, the HRC reviewed the previously adopted 2020 CDBG and GIA funding priorities and decided to make a few adjustments for this grant cycle. Specifically, the HRC recommended swapping the hierarchy of what were previously Priorities 3 and 4 for CDBG, and adding a priority around diversity, equity, and inclusion for GIA. All changes are as displayed in the table below. Note that the HRC’s recommended funding priorities for CDBG are ranked whereas the recommendation for GIA include one main area of importance with other remaining, non-ranked objectives: Community Development Block Grant (ranked) Previous Priorities HRC Recommended Changes 1.Provide emergency and transitional shelter, homelessness prevention and services. 2. Develop and enhance affordable housing for low and very-low income persons. 3. Promote accessibility and/or removal of architectural barriers for the disabled and elderly. 4.Enhance economic development (to include seismic retrofit, economic stability, low- and moderate-income jobs). 1. Provide emergency and transitional shelter, homelessness prevention and services. 2. Develop and enhance affordable housing for low and very-low income persons. 3. Enhance economic development (to include seismic retrofit, economic stability, low- and moderate-income jobs). 4. Promote accessibility and/or removal of architectural barriers for the disabled and elderly. Packet Page 28 Item 5 Grants-in-Aid (not-ranked) Previous Priorities HRC Recommended Changes Main Priority:Homeless prevention, including affordable and alternative housing, supportive services and transitional housing Other Priorities: x Hunger and malnutrition prevention x Supportive physical and mental health services for those in need x Services for seniors and/or people with disabilities in need x Supportive and developmental services for children and youth in need Main Priority:Homeless prevention, including affordable and alternative housing, supportive services and transitional housing Other Priorities: x Hunger and malnutrition prevention x Supportive physical and mental health services for those in need x Services for seniors and/or people with disabilities in need x Supportive and developmental services for children and youth in need x Services encouraging diversity, equity, and inclusivity in marginalized communities Expanded 2021-22 GIA Application Criteria Additionally, during the Community Needs Workshop, the HRC received several concerns from non-profit service providers regarding the acceptable list of eligible expenses for the upcoming GIA program year. Due to the current COVID-19 pandemic and related-economic constrains, service providers communicated financial deficits from funding sources that previously supported general staffing costs, and urged the HRC to expand the use of GIA grant dollars to provide funding for general operational expenses. In turn, the HRC incorporated this feedback into the Funding Criteria during their review of the 2021-22 GIA Application, in order to sustain existing long-term services within the community. Next Steps The next step in the CDBG and GIA program cycles is for the Council to consider the HRC’s recommendations and to affirm or revise the City’s funding priori ties. This step is important because these priorities will guide the HRC’s actions during grant application review. These priorities will also guide Council’s final funding decisions, when they consider CDBG funding recommendations in March 2021 and GIA funding recommendations in July 2021. Policy Context Task 15 in the Ongoing Housing Production Programs section in the 2019-21 Housing Major City Goal states that CDBG and GIA grant funding should be prioritized for housing production available for lower income households. The City’s Housing Element also indicates several programs throughout the document to help facilitate affordable housing through various grant programs. Packet Page 29 Item 5 ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: Yes Budget Year: 2021-22 Funding Identified: No Fiscal Analysis: Funding Sources Total Budget Available Current Funding Request Remaining Balance Annual Ongoing Cost General Fund State Federal N/A Fees Other: Total Decisions made regarding priorities will affect how CDBG and GIA applications are evaluated and chosen for support. The City receives CDBG funds through the County allotment and, while this does not directly impact the General Fund, to the extent that projects can be funded through CDBG, they are not otherwise requiring money from the City’s General Fund.CDBG grant funds are only a fraction of the historic allocation as the Federal Government has significantly reduced funding over the last 15 years. The City has historically designated a portion of General Fund monies for the GIA program and the priorities expressed by the Council will influence how those grants will be awarded. Because of the timing with 2021-23 Financial Plan, no funding has yet been allocated to the GIA program. The City allocated $150,000 annually to the GIA program within the 2019-21 Financial Plan. Establishing priorities has no immediate fiscal impact but is helpful in allocating the CDBG and GIA funding regardless of the amount. ALTERNATIVES 1.The Council may modify the proposed funding priorities. 2.The Council may continue consideration of the funding priorities.Direction should be given to staff regarding additional information needed to make a decision on priorities. This alternative is not recommended because the timelines for Advisory Body review and application submittal are fairly structured and the addition of time could delay funding approval for projects. Attachments: a - HRC Meeting Draft Minutes of 10/04/2020 Packet Page 30 Item 5 Draft Minutes Human Relations Commission Wednesday, October 7, 2020 Regular Meeting of the Human Relations Commission CALL TO ORDER A Regular Meeting of the San Luis Obispo Human Relations Commission was called to order on Wednesday, October 7, 2020at 5:00 a.m. viateleconference, San Luis Obispo, California, by Chair Campbell. ROLL CALL Present: Commissioners Renoda Campbell, Angie Kasprzak, Abe Lincoln, Emily Rosten, Megan Souza Absent: Commissioner Jeannette Richardson Staff & Guests: Cara Vereschagin, Housing Coordinator; Dale Magee, Catalyst Consulting PUBLIC COMMENT FOR ITEMS NOT ON THE AGENDA None --End of Public Comment-- APPROVAL OF MINUTES 1. Consideration of Minutes of the Human Relations Commission Regular Meeting of September 2, 2020. ACTION:MOTION BY COMMISSIONER ROSTEN, SECOND BY COMMISSIONER SOUZA, 5-0-1 (Commissioner Richardson absent) to approve the minutes of the Regular Meeting of the Human Relations Commission of September 2, 2020. PUBLIC HEARINGS 2. 2020 Community Needs Workshop Housing Coordinator Vereschagin presented an overview of the Community Development Block Grant and Grants-in-Aid processes and timelines, which highlighted key dates for the applicants. She also explained that the Workshop is intended to gather information from the public, regarding health and human service needs in order to develop funding priorities for the 2021-22 grant cycle. Packet Page 31 Item 5 City of San Luis Obispo, Title, Subti tle Minutes Human Relations Commission Meeting of October 7, 2020 Page 2 Chair Campbell opened the public hearing. Public Comments x Cassandra Wagner –had concerns about allowable expenses for GIA; requested the HRC allow general operating support, rather than programmatic expenses x Jenny Luciano (Big Brothers Big Sisters)–requested funding priorities to be broad to align with new funding coming out of the COVID-19 emergency relief; requested the HRC to keep the youth services priority x Sandra Gresham (Stand Strong) –thanked the HRC for continual support; communicated almost half of their clients have been children x Monique Tiller (RISE SLO County) –concerned about staffing costs; requested the HRC allow general operating support, rather than programmatic expenses x Teresa Tardiff (CASA) –thanked the City for many years of support; --End of Public Comment— Chair Campbell closed the public hearing. No action was taken. 3. 2021-22 Funding Priorities Housing Coordinator Vereschagin presented the previously adopted funding priorities for the CDBG and GIA programs. Chair Campbell opened the public hearing. Public Comments None. --End of Public Comment— After hearing the public testimony, the Commission agreed that they should expand the GIA program to support general staffing and operational expenses, in response to the COVID-19 pandemic. Housing Coordinator Vereschagin communicated that the expansion would be better folded into the “criteria” section of the application. Commissioners also communicated their desire to create a priority around diversity, equity, and inclusion. Overall, the public testimony also solidified that their work has been heading in a positive direction. ACTION: MOTION BY COMMISSIONER KASPRZAK, SECOND BY VICE CHAIR LINCOLN, 5-0-1 (Commissioner Richardson absent) to uphold the funding priorities identified for the Grants-in-Aid program for the previous, 2020-21 year, with the addition of adding a priority to include “services encouraging diversity, equity, and inclusivity in marginalized communities” as written below: Packet Page 32 Item 5 City of San Luis Obispo, Title, Subti tle Minutes Human Relations Commission Meeting of October 7, 2020 Page 3 Grants in Aid (GIA) 2021-22 Funding Priorities Main Priority: · Homeless prevention including affordable and alternative housing, supportive services, and transitional housing Other Priorities: · Hunger and malnutrition support · Supportive physical and mental health services for those in need · Services for seniors and/ or people with disabilities in need · Supportive and developmental services for children and youth in need · Services encouraging diversity, equity, and inclusivity in marginalized communities ACTION: MOTION BY COMMISSIONER SOUZA, SECOND BY COMMISSIONER ROSTEN, 5-0-1 (Commissioner Richardson absent) to uphold the funding priorities identified for the Community Development Block Grant program for the previous, 2020-21 year, with the only edit to switch the ranked order previously identified Priorities #3 and #4, as listed below: Community Development Block Grant (CDBG) 2021-22 Funding Priorities 1. Provide emergency and transitional shelter, homelessness prevention and services. 2. Develop and enhance affordable housing for low and very-low income persons. 3. Enhance economic development (including seismic retrofit, economic stability, low and moderate-income jobs) 4. Promote accessibility and/or removal of architectural barriers for the disabled and elderly. BUSINESS ITEMS 4. Potential Strategic Thinking Session(s) for Future Diversity, Equity, & Inclusion (DEI) Grant Program Implementation Chair Campbell opened up the discussion of holding a strategic planning/thinking session with the HRC regarding the future implementation of City diversity, equity, and inclusion initiatives. Dale Magee, the City’s DEI Task Force facilitator, also spoke about the public’s expectation of ongoing accountability for DEI coming down the pipeline. Ms. Magee also presented apreliminary scope for the planning sessions. Public Comments None --End of Public Comment— ACTION: MOTION BY VICE CHAIR LINCOLN, SECOND BY CHAIR ROSTEN, 5-0-1 (Commissioner Richardson absent) to hold strategic thinking/planning session(s) regarding the future implementation of City diversity, equity, and inclusion initiatives. Packet Page 33 Item 5 City of San Luis Obispo, Title, Subti tle Minutes Human Relations Commission Meeting of October 7, 2020 Page 4 STAFF & COMMISSION COMMUNICATIONS 5. Staff Updates Housing Coordinator Vereschagin notified the Commission about an at-risk affordablehousing unit HASLO is working to preserve with 2019 CDBG funds. 6. Commissioner Updates None. ADJOURNMENT Chair Campbell adjourned the meeting at 6:26 p.m. The next Regular Meeting of the Human Relations Commission is scheduled for Wednesday, November 4, 2020 at 5:00 p.m., via teleconference. APPROVED BY THE HUMAN RELATIONS COMMISSION: XX/XX/2020 Packet Page 34 Item 5 Department Name: Public Works Cost Center:5201 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM:Matt Horn, Director of Public Works Prepared By:Gamaliel Anguiano, Transit Manager SUBJECT:SLO TRANSIT PUBLIC TRANSPORTATION AGENCY SAFETY PLAN RECOMMENDATION Adopt a Resolution (Attachment A) approving the City of San Luis Obispo Transit (SLO Transit) Public Transportation Agency Safety Plan (PTASP) developed by Caltrans in compliance with Federal Transit Administration (FTA) requirements (49 CFR Part 673). DISCUSSION The Federal Transit Administration (FTA) published the Public Transportation Agency Safety Plan (PTASP) Final Rule on July 19, 2018 and the PTASP rule became effective on July 19, 2019. The PTASP rule requires operators of public transportation systems that receive federal funds under FTA’s Urbanized Area Formula Grants (49 U.S.C. § 5307)to develop safety plans that include the processes and procedures to implement Safety Management Systems (SMS), as well as a strategic approach to carry out the Transit Asset Management (TAM) Program. In coordination with Caltrans, SLO Transit developed the contents of the PTASP (Attachment A) to meet requirements specified in 49 CFR Part 673. The plan’s acceptance by Caltrans and FTA requires some very specific language and requirements. Therefore, in advance of Council action, staff has solicited and secured Caltrans’review and approval of the attached Plan (Attachment B) to ensure all specified requirements for the plan are being met. The plan being presented, meets both Caltrans and FTA requirements. The PTASP is based on the four (4) principles or pillars of SMS: 1. Safety Management Policy 2. Safety Risk Management 3. Safety Assurance 4. Safety Promotion Packet Page 35 Item 6 This plan includes Safety Performance Targets, which are specific numerical targets based on the Safety Performance Measures established by FTA in the National Public Transportation Safety Plan including: 1. Fatalities 2. Injuries 3. Safety Events 4. System Reliability FTA published a Notice of Enforcement Discretion on April 22, 2020 effectively extending the PTASP compliance deadline from July 20, 2020 to December 31, 2020. Transit operators must certify they have a safety plan in place meeting the requirements of the PTASP rule by December 31, 2020. The plan must be updated, board approved, and certified by the transit agency annually. Next update is scheduled for July 2021. COVID Impacts Note that the FTA requirement for the development of PTASP predates the known existence of COVID. The PTASP plan is very specific in its requirements and criteria and thus solely focused on safety improvements tied to typical transit operations. Thus, the included PTASP is very specific to addressing those requirements without diverging from them. The Transit division, however, has developed its own internal pandemic related safety plan, based on CDC guidance and industry best practice, for the benefit of transit staff and our transit operations contractor, First Transit. The inclusion of the pandemic safety plan as Attachment C does not require any City action and is only included as reference only. Policy Context Per FTA, this plan and subsequent annual plans will need to be adopted by City Council Public Engagement This is an administrative item, so no outside public engagement was completed. Public comment can be provided to the City Council through written correspondence prior to the meeting and through public testimony at the meeting. CONCURRENCE The plan has been submitted to Caltrans in advance of this meetings to solicit comments and feedback. Caltrans has provided general acceptance of the attached plan as sufficient to meet FTA requirements. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. Packet Page 36 Item 6 FISCAL IMPACT Budgeted: N/A Budget Year: FY 2020-21 Funding Identified: N/A Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost Transit Fund N/A State –LCTOP* State –SGR** Federal - 5307 Other: Total There are no fiscal impacts to the City by establishing and certifying a PTASP. However, if the City chooses not to establish and certify a PTASP future Urbanized Area Formula Funding (5307) provided by the FTA may be jeopardized resulting in adverse fiscal impacts to the Transit Enterprise Fund. The City typically receives approximately $1.3 Million of 5307 funds annually. ALTERNATIVES 1.Deny submittal of the PTASP established and certified by Caltrans in compliance with FTA requirements.However, there are potential adverse fiscal impacts to the Transit Enterprise Fund. 2.Direct Staff to revise and resubmit the PTASP. Attachments: a - Draft Resolution b - Draft Public Transportation Agency Safety Plan c - SLO Transit COVID-19 Emergency Response and Enhanced Cleaning Protocol Packet Page 37 Item 6 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, APPROVING THE CITY OF SAN LUIS OBISPO TRANSIT (SLO TRANSIT) PUBLIC TRANSPORTATION AGENCY SAFETY PLAN (PTASP) WHEREAS,Federal Transit Administration (FTA) published the Public Transportation Agency Safety Plan (PTASP) Final Rule on July 19, 2018 and the rule became effective on July 19, 2019; and WHEREAS,SLO Transit is required to meet the PTASP rule as a public transportation system that receives federal funds under FTA’s Urbanized Area Formula Grants (49 U.S.C. § 5307); and WHEREAS,Caltrans developed the contents of the SLO Transit PTASP to meet the FTA requirement that a State must draft and certify a safety plan on behalf of any small transportation provider that is located in that State as specified in Part 673.11(d); and WHEREAS,the PTASP and subsequent updates must be approved by SLO Transit’s City Council as specified in Part 673.11(a)(1); and WHEREAS,FTA published a Notice of Enforcement Discretion on April 22, 2020 effectively extending the PTASP compliance deadline from July 20, 2020 to December 31, 2020. Packet Page 38 Item 6 Resolution No. _____ (2020 Series) Page 2 R ______ NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo that the City of San Luis Obispo Transit (SLO Transit) Public Transportation Agency Safety Plan (PTASP) is hereby approved. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of _____________________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on ______________________. ____________________________________ Teresa Purrington City Clerk Packet Page 39 Item 6              &LW\RI6DQ/XLV2ELVSR7UDQVLW 6/27UDQVLW 3DOP6WUHHW 6DQ/XLV2ELVSR&$ 3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ 37$63  $GRSWHG1RYHPEHU    BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBB 6LJQDWXUHRI$FFRXQWDEOH([HFXWLYH 'DWH   *DPDOLHO$QJXLDQR&LW\7UDQVLW0DQDJHU  Packet Page 40 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  &RQWHQWV 'HILQLWLRQV 6HFWLRQ7UDQVLW$JHQF\,QIRUPDWLRQ 6XEVHFWLRQ$FFRXQWDEOH([HFXWLYH 6XEVHFWLRQ&KLHI6DIHW\2IILFHU 6HFWLRQ3ODQ'HYHORSPHQW$SSURYDODQG8SGDWHV 6XEVHFWLRQ'UDIWLQJWKH3ODQ 6XEVHFWLRQ6LJQDWXUHE\WKH$FFRXQWDEOH([HFXWLYHDQG$SSURYDOE\WKH%RDUG 6XEVHFWLRQ&HUWLILFDWLRQRI&RPSOLDQFH 6XEVHFWLRQ3ODQ5HYLHZDQG8SGDWHV 6HFWLRQ6DIHW\3HUIRUPDQFH7DUJHWV 637V  6XEVHFWLRQ7DUJHW'HYHORSPHQW 6HFWLRQ2YHUYLHZRIWKH$JHQF\¶V6DIHW\0DQDJHPHQW6\VWHPV 606  6HFWLRQ6DIHW\0DQDJHPHQW3ROLF\ 6XEVHFWLRQ6DIHW\0DQDJHPHQW3ROLF\6WDWHPHQW 6XEVHFWLRQ6DIHW\0DQDJHPHQW3ROLF\&RPPXQLFDWLRQ 6XEVHFWLRQ(PSOR\HH6DIHW\5HSRUWLQJ3URJUDP 6XEVHFWLRQ606$XWKRULWLHV$FFRXQWDELOLWLHVDQG5HVSRQVLELOLWLHV 6XEVHFWLRQ$FFRXQWDEOH([HFXWLYH 6XEVHFWLRQ&KLHI6DIHW\2IILFHU 6XEVHFWLRQ$JHQF\/HDGHUVKLSDQG([HFXWLYH0DQDJHPHQW 6XEVHFWLRQ.H\6WDII 6HFWLRQ6DIHW\5LVN0DQDJHPHQW 650  6XEVHFWLRQ6DIHW\+D]DUG,GHQWLILFDWLRQ 6XEVHFWLRQ6DIHW\5LVN$VVHVVPHQW 6XEVHFWLRQ6DIHW\5LVN0LWLJDWLRQ 6HFWLRQ6DIHW\$VVXUDQFH 6XEVHFWLRQ6DIHW\3HUIRUPDQFH0RQLWRULQJDQG0HDVXUHPHQW 6HFWLRQ6DIHW\3URPRWLRQ 6XEVHFWLRQ6DIHW\&RPPXQLFDWLRQ 6HFWLRQ'RFXPHQWDWLRQ Packet Page 41 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Definitions $FFLGHQWPHDQVDQ(YHQWWKDWLQYROYHVDQ\RIWKHIROORZLQJDORVVRIOLIHDUHSRUWRIDVHULRXVLQMXU\WRD SHUVRQDFROOLVLRQRISXEOLFWUDQVSRUWDWLRQYHKLFOHVDQHYDFXDWLRQIRUOLIHVDIHW\UHDVRQV $FFRXQWDEOH([HFXWLYHPHDQVWKHVLQJOHLGHQWLILDEOHSHUVRQZKRKDVXOWLPDWHUHVSRQVLELOLW\IRUFDUU\LQJ RXWWKH3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQRIWKH$JHQF\UHVSRQVLELOLW\IRUFDUU\LQJRXWWKH $JHQF\¶V7UDQVLW$VVHW0DQDJHPHQW3ODQDQGFRQWURORUGLUHFWLRQRYHUWKHKXPDQDQGFDSLWDOUHVRXUFHV QHHGHGWRGHYHORSDQGPDLQWDLQERWKWKH$JHQF\¶V3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQLQ DFFRUGDQFHZLWK86&† G DQGWKH$JHQF\¶V7UDQVLW$VVHW0DQDJHPHQW3ODQLQDFFRUGDQFH ZLWK86&† $JHQF\RU7UDQVLW$JHQF\PHDQVWKH&LW\RI6DQ/XLV2ELVSR7UDQVLW 6/27UDQVLW  6DQ/XLV2ELVSR&LW\&RXQFLOPHDQVJRYHUQLQJERG\RI6/27UDQVLW &DOWUDQVPHDQVWKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ &KLHI6DIHW\2IILFHUPHDQVWKHDGHTXDWHO\WUDLQHGLQGLYLGXDOZKRKDVUHVSRQVLELOLW\IRUVDIHW\DQGUHSRUWV GLUHFWO\WRWKH7UDQVLW$JHQF\¶VFKLHIH[HFXWLYHRIILFHU &)5PHDQV&RGHRI)HGHUDO5HJXODWLRQV (YHQWPHDQVDQ\$FFLGHQW,QFLGHQWRU2FFXUUHQFH )7$PHDQVWKH)HGHUDO7UDQVLW$GPLQLVWUDWLRQDQRSHUDWLQJDGPLQLVWUDWLRQZLWKLQWKH8QLWHG6WDWHV 'HSDUWPHQWRI7UDQVSRUWDWLRQ +D]DUGPHDQVDQ\UHDORUSRWHQWLDOFRQGLWLRQWKDWFDQFDXVHLQMXU\LOOQHVVRUGHDWKGDPDJHWRRUORVVRI WKHIDFLOLWLHVHTXLSPHQWUROOLQJVWRFNRULQIUDVWUXFWXUHRIWKHV\VWHPRUGDPDJHWRWKHHQYLURQPHQW ,QFLGHQWPHDQVDQ(YHQWWKDWLQYROYHVDQ\RIWKHIROORZLQJDSHUVRQDOLQMXU\WKDWLVQRWDVHULRXVLQMXU\ RQHRUPRUHLQMXULHVUHTXLULQJPHGLFDOWUDQVSRUWRUGDPDJHWRIDFLOLWLHVHTXLSPHQWUROOLQJVWRFNRU LQIUDVWUXFWXUHWKDWGLVUXSWVWKHRSHUDWLRQVRIWKH7UDQVLW$JHQF\ ,QYHVWLJDWLRQPHDQVWKHSURFHVVRIGHWHUPLQLQJWKHFDXVDODQGFRQWULEXWLQJIDFWRUVRIDQDFFLGHQW LQFLGHQWRUKD]DUGIRUWKHSXUSRVHRISUHYHQWLQJUHFXUUHQFHDQGPLWLJDWLQJULVN 1DWLRQDO3XEOLF7UDQVSRUWDWLRQ6DIHW\3ODQPHDQVWKHSODQWRLPSURYHWKHVDIHW\RIDOOSXEOLF WUDQVSRUWDWLRQV\VWHPVWKDWUHFHLYHIHGHUDOILQDQFLDODVVLVWDQFHXQGHU86&&KDSWHU 2FFXUUHQFHPHDQVDQ(YHQWZLWKRXWDQ\SHUVRQDOLQMXU\LQZKLFKDQ\GDPDJHWRIDFLOLWLHVHTXLSPHQW UROOLQJVWRFNRULQIUDVWUXFWXUHGRHVQRWGLVUXSWWKHRSHUDWLRQVRIWKH7UDQVLW$JHQF\ 3DUWPHDQV&)5 &RGHRI)HGHUDO5HJXODWLRQV 3DUW 3HUIRUPDQFH0HDVXUHPHDQVDQH[SUHVVLRQEDVHGRQDTXDQWLILDEOHLQGLFDWRURISHUIRUPDQFHRUFRQGLWLRQ WKDWLVXVHGWRHVWDEOLVKWDUJHWVDQGWRDVVHVVSURJUHVVWRZDUGPHHWLQJWKHHVWDEOLVKHGWDUJHWV Packet Page 42 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  3HUIRUPDQFHWDUJHWPHDQVDTXDQWLILDEOHOHYHORISHUIRUPDQFHRUFRQGLWLRQH[SUHVVHGDVDYDOXHIRUWKH PHDVXUHWREHDFKLHYHGZLWKLQDWLPHSHULRGUHTXLUHGE\WKH)HGHUDO7UDQVLW$GPLQLVWUDWLRQ )7$  5LVNPHDQVWKHFRPSRVLWHRISUHGLFWHGVHYHULW\DQGOLNHOLKRRGRIWKHSRWHQWLDOHIIHFWRIDKD]DUG 5LVNPLWLJDWLRQPHDQVDPHWKRGRUPHWKRGVWRHOLPLQDWHRUUHGXFHWKHHIIHFWVRIKD]DUGV 6DIHW\$VVXUDQFHPHDQVSURFHVVHVZLWKLQWKH7UDQVLW$JHQF\¶V6DIHW\0DQDJHPHQW6\VWHPVWKDWIXQFWLRQ WRHQVXUHWKHLPSOHPHQWDWLRQDQGHIIHFWLYHQHVVRIVDIHW\ULVNPLWLJDWLRQDQGWRHQVXUHWKDWWKH7UDQVLW $JHQF\PHHWVRUH[FHHGVLWVVDIHW\REMHFWLYHVWKURXJKWKHFROOHFWLRQDQDO\VLVDQGDVVHVVPHQWRI LQIRUPDWLRQ 6DIHW\0DQDJHPHQW3ROLF\PHDQVWKH7UDQVLW$JHQF\¶VGRFXPHQWHGFRPPLWPHQWWRVDIHW\ZKLFKGHILQHV WKH7UDQVLW$JHQF\¶VVDIHW\REMHFWLYHVDQGWKHDFFRXQWDELOLWLHVDQGUHVSRQVLELOLWLHVRILWVHPSOR\HHVLQ UHJDUGWRVDIHW\ 6DIHW\0DQDJHPHQW6\VWHPV 606 PHDQVWKHIRUPDOWRSGRZQRUJDQL]DWLRQZLGHDSSURDFKWR PDQDJLQJVDIHW\ULVNDQGDVVXULQJWKHHIIHFWLYHQHVVRID7UDQVLW$JHQF\¶VVDIHW\ULVNPLWLJDWLRQ606 LQFOXGHVV\VWHPDWLFSURFHGXUHVSUDFWLFHVDQGSROLFLHVIRUPDQDJLQJULVNVDQGKD]DUGV 6DIHW\3HUIRUPDQFH7DUJHW 637 PHDQVD3HUIRUPDQFH7DUJHWUHODWHGWRVDIHW\PDQDJHPHQWDFWLYLWLHV 6DIHW\3URPRWLRQPHDQVDFRPELQDWLRQRIWUDLQLQJDQGFRPPXQLFDWLRQRIVDIHW\LQIRUPDWLRQWRVXSSRUW 606DVDSSOLHGWRWKH7UDQVLW$JHQF\¶VSXEOLFWUDQVSRUWDWLRQV\VWHP 6DIHW\5LVN$VVHVVPHQW 65$ PHDQVWKHIRUPDODFWLYLW\ZKHUHE\WKH7UDQVLW$JHQF\GHWHUPLQHV6DIHW\ 5LVN0DQDJHPHQWSULRULWLHVE\HVWDEOLVKLQJWKHVLJQLILFDQFHRUYDOXHRILWVVDIHW\ULVNV 6DIHW\5LVN0DQDJHPHQW 650 PHDQVDSURFHVVZLWKLQWKH7UDQVLW$JHQF\¶V3XEOLF7UDQVSRUWDWLRQ $JHQF\6DIHW\3ODQIRULGHQWLI\LQJKD]DUGVDQGDQDO\]LQJDVVHVVLQJDQGPLWLJDWLQJVDIHW\ULVN 6HULRXVLQMXU\PHDQVDQ\LQMXU\ZKLFK  UHTXLUHVKRVSLWDOL]DWLRQIRUPRUHWKDQKRXUVFRPPHQFLQJ ZLWKLQVHYHQGD\VIURPWKHGDWHWKHLQMXU\ZDVUHFHLYHG  UHVXOWVLQDIUDFWXUHRIDQ\ERQH H[FHSW VLPSOHIUDFWXUHVRIILQJHUVWRHVRUQRVHV   FDXVHVVHYHUHKHPRUUKDJHVQHUYHPXVFOHRUWHQGRQ GDPDJH  LQYROYHVDQ\LQWHUQDORUJDQRU  LQYROYHVVHFRQGRUWKLUGGHJUHHEXUQVRUDQ\EXUQV DIIHFWLQJPRUHWKDQILYHSHUFHQWRIWKHERG\VXUIDFH 6WDWHRI*RRG5HSDLU 6*5 PHDQVWKHFRQGLWLRQLQZKLFKDFDSLWDODVVHWLVDEOHWRRSHUDWHDWDIXOOOHYHO RISHUIRUPDQFH 7UDQVLW$VVHW0DQDJHPHQW3ODQPHDQVWKHVWUDWHJLFDQGV\VWHPDWLFSUDFWLFHRISURFXULQJRSHUDWLQJ LQVSHFWLQJPDLQWDLQLQJUHKDELOLWDWLQJDQGUHSODFLQJWUDQVLWFDSLWDODVVHWVWRPDQDJHWKHLUSHUIRUPDQFH ULVNVDQGFRVWVRYHUWKHLUOLIHF\FOHVIRUWKHSXUSRVHRISURYLGLQJVDIHFRVWHIIHFWLYHDQGUHOLDEOHSXEOLF WUDQVSRUWDWLRQDVUHTXLUHGE\86&DQG&)5SDUW 86&PHDQV8QLWHG6WDWHV&RGH Packet Page 43 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Section 1 Transit Agency Information 7KH&LW\RI6DQ/XLV2ELVSR7UDQVLW 6/27UDQVLW DSURJUDPRIWKH&LW\¶V3XEOLF:RUNV 'HSDUWPHQWLVWKHORFDOIL[HGURXWHSXEOLFWUDQVLWRSHUDWLRQZLWKLQWKHFLW\OLPLWVRI6DQ/XLV 2ELVSRDQG&DOLIRUQLD3RO\WHFKQLF6WDWH8QLYHUVLW\ &DO3RO\ 6HUYLFHRSHUDWLRQVDQGYHKLFOH PDLQWHQDQFHDUHSURYLGHGE\DWKLUGSDUW\FRQWUDFWRU )LUVW7UDQVLW,QF 6/27UDQVLWLVD UHFLSLHQWRI)HGHUDO7UDQVLW$GPLQLVWUDWLRQ )7$ 6HFWLRQIXQGVDQGGRHVQRWSURYLGH WUDQVSRUWDWLRQVHUYLFHVRQEHKDOIRIDQRWKHUHQWLW\ Subsection 1.1 Accountable Executive 6/27UDQVLW¶V$FFRXQWDEOH([HFXWLYHLVWKH&LW\7UDQVLW0DQDJHU7KH&LW\7UDQVLW0DQDJHULV WKHVLQJOHLGHQWLILDEOHSHUVRQZKRKDVXOWLPDWHUHVSRQVLELOLW\IRUFDUU\LQJRXWWKLV$JHQF\6DIHW\ 3ODQDQGWKH7UDQVLW$VVHW0DQDJHPHQW 7$0 3ODQDQGFRQWURORUGLUHFWLRQRYHUWKHKXPDQ DQGFDSLWDOUHVRXUFHVQHHGHGWRGHYHORSDQGPDLQWDLQERWKWKLV3ODQDQGWKH7$03ODQ 7KH&LW\7UDQVLW0DQDJHULVDFFRXQWDEOHIRUHQVXULQJWKDWWKH$JHQF\¶V6DIHW\0DQDJHPHQW 6\VWHPV 606 LVHIIHFWLYHO\LPSOHPHQWHGWKURXJKRXWWKH$JHQF\¶VSXEOLFWUDQVSRUWDWLRQ V\VWHP7KH&LW\7UDQVLW0DQDJHULVDFFRXQWDEOHIRUHQVXULQJDFWLRQLVWDNHQDVQHFHVVDU\WR DGGUHVVVXEVWDQGDUGSHUIRUPDQFHLQWKH$JHQF\¶V6067KH&LW\7UDQVLW0DQDJHUPD\GHOHJDWH VSHFLILFUHVSRQVLELOLWLHVEXWWKHXOWLPDWHDFFRXQWDELOLW\IRUWKH7UDQVLW$JHQF\¶VVDIHW\ SHUIRUPDQFHFDQQRWEHGHOHJDWHGDQGDOZD\VUHVWVZLWKWKH&LW\7UDQVLW0DQDJHU Subsection 1.2 Chief Safety Officer $VDVPDOOSXEOLFWUDQVSRUWDWLRQSURYLGHU6/27UDQVLW¶VGHVLJQDWHG&KLHI6DIHW\2IILFHULVWKH FRQWUDFWLQJ*HQHUDO0DQDJHUZKRKDVWKHDXWKRULW\DQGUHVSRQVLELOLW\IRUGD\WRGD\ LPSOHPHQWDWLRQDQGRSHUDWLRQRIWKH$JHQF\¶V6067KH&KLHI6DIHW\2IILFHUKDVDVWURQJ ZRUNLQJUHODWLRQVKLSZLWKWKHRSHUDWLRQVDQGDVVHWPDQDJHPHQWIXQFWLRQVDW6/27UDQVLW Section 2 Plan Development, Approval, and Updates &DOWUDQVGHYHORSHGWKHFRQWHQWVRIWKLV6/27UDQVLWSODQWRPHHWUHTXLUHPHQWVVSHFLILHGLQ&)5 3DUWDQGFRPSO\ZLWK3DUW G UHJDUGLQJ&DOWUDQV¶UHVSRQVLELOLW\WRGHYHORSDQ$63IRU DQ\VPDOOSXEOLFWUDQVSRUWDWLRQSURYLGHUWKDWLVORFDWHGLQ&DOLIRUQLD7KLV3ODQLVEDVHGRQWKHIRXU  SULQFLSOHVRUSLOODUVRIWKH6DIHW\0DQDJHPHQW6\VWHPV 606 606LVGHILQHGDVWKHIRUPDO WRSGRZQRUJDQL]DWLRQZLGHGDWDGULYHQDSSURDFKWRPDQDJLQJVDIHW\ULVNDQGDVVXULQJWKH HIIHFWLYHQHVVRIVDIHW\PLWLJDWLRQV,WLQFOXGHVV\VWHPDWLFSROLFLHVSURFHGXUHVDQGSUDFWLFHVIRUWKH PDQDJHPHQWRIVDIHW\ULVN7KHIRXUSULQFLSOHVRUSLOODUVRI606DUH  6DIHW\0DQDJHPHQW3ROLF\  6DIHW\5LVN0DQDJHPHQW  6DIHW\$VVXUDQFHDQG  6DIHW\3URPRWLRQ Packet Page 44 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Subsection 2.1 Drafting the Plan &DOWUDQVGUDIWHGWKLV3ODQWKXVPHHWLQJWKHUHTXLUHPHQWVRI&)53DUW G )7$ZLOO RYHUVHHFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRI3DUWWKURXJKWKHH[LVWLQJ7ULHQQLDO5HYLHZ SURFHVVHV 6KRXOG6/27UDQVLWQRORQJHUPHHWWKHGHILQLWLRQRIDVPDOOSXEOLFWUDQVSRUWDWLRQSURYLGHURU FKRRVHWRRSWRXWRIWKH&DOWUDQV$JHQF\6DIHW\3ODQZLWKLQRQH\HDUIURPWKHGDWHRIQRWLI\LQJ WKH6WDWHRIHLWKHUGHYHORSPHQW6/27UDQVLWZLOOGUDIWDQGFHUWLI\LWVRZQ$JHQF\6DIHW\3ODQ,I 6/27UDQVLWRSHUDWHVPRUHWKDQYHKLFOHV6/27UDQVLWPXVWIXOILOOUHTXLUHPHQWVRIV\VWHPV RSHUDWLQJPRUHWKDQYHKLFOHV Subsection 2.2 Signature by the Accountable Executive and Approval by the Board 3XUVXDQWWR&)53DUW D  WKLV$JHQF\6DIHW\3ODQDQGVXEVHTXHQWXSGDWHVPXVWEH VLJQHGE\WKH$FFRXQWDEOH([HFXWLYHDQGDSSURYHGE\6/27UDQVLW¶V%RDUG'RFXPHQWDWLRQRI %RDUGDSSURYDOLVIRXQGLQ$SSHQGL[$ Subsection 2.3 Certification of Compliance 3XUVXDQWWR&)53DUWV D DQG E &DOWUDQVFHUWLILHVWKDWLWKDVHVWDEOLVKHGWKLV $JHQF\6DIHW\3ODQPHHWLQJWKHUHTXLUHPHQWVRI&)53DUWE\-XO\DQGZLOO FHUWLI\LWVFRPSOLDQFHZLWK&)53DUW )7$SXEOLVKHGD1RWLFHRI(QIRUFHPHQW'LVFUHWLRQRQ$SULOHIIHFWLYHO\H[WHQGLQJWKH 37$63FRPSOLDQFHGHDGOLQHIURP-XO\WR'HFHPEHU7UDQVLWRSHUDWRUVPXVW FHUWLI\WKH\KDYHDVDIHW\SODQLQSODFHPHHWLQJWKHUHTXLUHPHQWVRIWKHUXOHE\'HFHPEHU 7KHSODQPXVWEHXSGDWHGDQGFHUWLILHGE\WKHWUDQVLWDJHQF\DQQXDOO\ $IWHU&DOWUDQVLQLWLDOFHUWLILFDWLRQDQGRQDQDQQXDOEDVLV6/27UDQVLWPXVWXSGDWHWKLV$JHQF\ 6DIHW\3ODQE\-XO\LQSHUSHWXLW\$OO$JHQF\6DIHW\3ODQXSGDWHVVKDOOEHVLJQHGE\WKH $FFRXQWDEOH([HFXWLYHDQGDSSURYHGE\6/27UDQVLW¶V%RDUG )7$GRHVQRWUHTXLUHWKLVSODQWREHVXEPLWWHGWR)7$,QVWHDG&DOWUDQVZLOOFHUWLI\WKDWLWKDV HVWDEOLVKHGWKLV6DIHW\3ODQZKLFKIXOILOOVWKHUHTXLUHPHQWVXQGHU3DUW)7$DQQXDOO\ DPHQGVDQGLVVXHVWKHOLVWRI&HUWLILFDWLRQVDQG$VVXUDQFHV&DOWUDQVZLOOUHYLHZVXFKJXLGDQFH IRULQFRUSRUDWLRQLQWRWKHVDIHW\SURJUDPDVQHFHVVDU\ Subsection 2.4 Plan Review and Updates 6/27UDQVLWXSGDWHVWKLV6DIHW\3ODQZKHQLQIRUPDWLRQSURFHVVHVRUDFWLYLWLHVFKDQJHZLWKLQWKH $JHQF\DQGRUZKHQ3DUWXQGHUJRHVVLJQLILFDQWFKDQJHVRUDQQXDOO\ZKLFKHYHUFRPHV VRRQHU$V6/27UDQVLWFROOHFWVGDWDWKURXJKLWV6DIHW\5LVN0DQDJHPHQWDQG6DIHW\$VVXUDQFH SURFHVVHVVKDUHGZLWK&DOWUDQVDQGWKHORFDO0HWURSROLWDQ3ODQQLQJ2UJDQL]DWLRQ 032 DV Packet Page 45 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  GHVFULEHGLQVXEVHFWLRQEHORZWKH032DQG&DOWUDQVZLOOHYDOXDWH6/27UDQVLW¶VVDIHW\ SHUIRUPDQFHWDUJHWV 637V WRGHWHUPLQHZKHWKHUWKH\QHHGWREHFKDQJHGDVZHOO 7KLV3ODQZLOOEHMRLQWO\UHYLHZHGDQGXSGDWHGE\WKH&LW\7UDQVLW&RRUGLQDWRUZLWKWKH DVVLVWDQFHRIVXEMHFWPDWWHUH[SHUWVHDFK$SULO7KH$FFRXQWDEOH([HFXWLYHZLOODSSURYHDQ\ FKDQJHVWKHQIRUZDUGRQWRWKH%RDUGIRUDSSURYDO 7KLV3ODQPD\QHHGWREHUHYLHZHGDQGXSGDWHGPRUHIUHTXHQWO\EDVHGRQWKHIROORZLQJ x:HGHWHUPLQHRXUDSSURDFKWRPLWLJDWLQJVDIHW\GHILFLHQFLHVLVLQHIIHFWLYH x:HPDNHVLJQLILFDQWFKDQJHVWRVHUYLFHGHOLYHU\ x:HLQWURGXFHQHZSURFHVVHVRUSURFHGXUHVWKDWPD\LPSDFWVDIHW\ x:HFKDQJHRUUHSULRULWL]HUHVRXUFHVDYDLODEOHWRVXSSRUW606 x:HVLJQLILFDQWO\FKDQJHRXURUJDQL]DWLRQDOVWUXFWXUH  9HUVLRQ1XPEHUDQG8SGDWHV Record the complete history of successive versions of this plan. 9HUVLRQ 1XPEHU6HFWLRQ3DJHV$IIHFWHG 5HDVRQIRU&KDQJH 'DWH,VVXHG  $OO 2ULJLQDO3ODQ            Section 3 Safety Performance Targets (SPTs) Subsection 3.1 Target Development 6/27UDQVLWLQFOXGHV637VLQWKLV6DIHW\3ODQ7KHVHWDUJHWVDUHVSHFLILFQXPHULFDOWDUJHWVVHWE\ 6/27UDQVLWDQGEDVHGRQWKHVDIHW\3HUIRUPDQFH0HDVXUHVHVWDEOLVKHGE\)7$LQWKH1DWLRQDO 3XEOLF7UDQVSRUWDWLRQ6DIHW\3ODQ,QWKHPRVWUHFHQWYHUVLRQWKH163)7$DGRSWHGIRXU LQLWLDOVDIHW\3HUIRUPDQFH0HDVXUHV  )DWDOLWLHV  ,QMXULHV  6DIHW\(YHQWVDQG  6\VWHP 5HOLDELOLW\ 6/27UDQVLW GHYHORSHGVDIHW\SHUIRUPDQFHWDUJHWVWKDWLWZLOOUHYLHZDQGXSGDWHDQQXDOO\7KH VSHFLILFVDIHW\SHUIRUPDQFHWDUJHWVDUHEDVHGRQWKHVDIHW\SHUIRUPDQFHPHDVXUHVHVWDEOLVKHG XQGHUWKH1DWLRQDO3XEOLF7UDQVSRUWDWLRQ6DIHW\3ODQDQGWKHVDIHW\SHUIRUPDQFHJRDOVVHWE\ &DOWUDQVEDVHGRQWKHSDVWWKUHH  ILVFDO\HDUVRIGDWD7KH6DIHW\3HUIRUPDQFH7DUJHWVIRU6/2 Packet Page 46 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  7UDQVLWIRUWKH)LVFDO<HDULVH[SHFWHGWRVWD\ZLWKLQRISUHYLRXVWKUHH\HDUVGDWD SHUWDLQLQJWRIDWDOLWLHVLQMXULHVVDIHW\HYHQWVDQGV\VWHPUHOLDELOLW\ Note: Baseline data for each target will need to be provided by each agency for Caltrans to develop goals. )7$UHTXLUHV&DOWUDQVWRFRRUGLQDWHZLWK6/27UDQVLWDQGWKH0HWURSROLWDQ3ODQQLQJ 2UJDQL]DWLRQ 032 6DQ/XLV2ELVSR&RXQFLORI*RYHUQPHQWV 6/2&2* WRWKHPD[LPXP H[WHQWSUDFWLFDEOH3XUVXDQWWR&)53DUW D 6/27UDQVLWZLOOPDNHVDIHW\ SHUIRUPDQFHWDUJHWVDYDLODEOHWR6/2&2*WRDLGLQWKHSODQQLQJSURFHVVXSRQFHUWLILFDWLRQRI WKLVSODQ$GGLWLRQDOO\6/27UDQVLWZLOOWUDQVPLWSHUIRUPDQFHGDWDDJDLQVWWKHVDIHW\ SHUIRUPDQFHWDUJHWVWR&DOWUDQVDQG6/2&2*RQDQDQQXDOEDVLV &DOWUDQVZLOOFRQGXFWFRRUGLQDWLRQPHHWLQJVZLWK6/2&2*IRUWKHVHOHFWLRQRI6WDWHDQG032 VDIHW\SHUIRUPDQFHWDUJHWVDQGJRDOV 6/27UDQVLWHVWDEOLVKHGVDIHW\SHUIRUPDQFHWDUJHWVIRUWKHSHULRGRI-XO\WKURXJK-XQH EDVHGRQVDIHW\SHUIRUPDQFHPHDVXUHVHVWDEOLVKHGXQGHUWKH1DWLRQDO3XEOLF7UDQVSRUWDWLRQ 6DIHW\3ODQ 6DIHW\3HUIRUPDQFH7DUJHWV %DVHGRQWKHVDIHW\SHUIRUPDQFHPHDVXUHVHVWDEOLVKHGXQGHUWKH1DWLRQDO3XEOLF7UDQVSRUWDWLRQ6DIHW\3ODQ  0RGHRI7UDQVLW6HUYLFH)DWDOLWLHV WRWDO  ,QMXULHV WRWDO  6DIHW\ (YHQWV WRWDO  6\VWHP 5HOLDELOLW\ 950IDLOXUHV  )L[HG5RXWH,QWHJHU7DUJHW     )L[HG5RXWH7DUJHWSHU9HKLFOH5HYHQXH0LOH      6DIHW\3HUIRUPDQFH7DUJHW&RRUGLQDWLRQ 7DUJHWV 7UDQVPLWWHGWR WKH6WDWH 6WDWH(QWLW\1DPH 'DWH7DUJHWV7UDQVPLWWHG &DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ &DOWUDQV   7DUJHWV 7UDQVPLWWHGWR WKH0HWURSROLWDQ 3ODQQLQJ 2UJDQL]DWLRQ  0HWURSROLWDQ3ODQQLQJ2UJDQL]DWLRQ1DPH 'DWH7DUJHWV7UDQVPLWWHG 6DQ/XLV2ELVSR&RXQFLORI*RYHUQPHQWV 6/2&2*    Packet Page 47 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Section 4 Overview of the Agency’s Safety Management Systems (SMS) 606LVDFRPSUHKHQVLYHFROODERUDWLYHDSSURDFKWKDWEULQJVPDQDJHPHQWDQGODERUWRJHWKHUWR EXLOGRQWKHWUDQVLWLQGXVWU\¶VH[LVWLQJVDIHW\IRXQGDWLRQWRFRQWUROULVNEHWWHUGHWHFWDQGFRUUHFW VDIHW\SUREOHPVHDUOLHUVKDUHDQGDQDO\]HVDIHW\GDWDPRUHHIIHFWLYHO\DQGPHDVXUHVDIHW\ SHUIRUPDQFHPRUHFDUHIXOO\6/27UDQVLW¶V606IRFXVHVRQDSSO\LQJUHVRXUFHVWRULVNDQGLV EDVHGRQHQVXULQJWKDW6/27UDQVLWKDVWKHRUJDQL]DWLRQDOLQIUDVWUXFWXUHWRVXSSRUWGHFLVLRQ PDNLQJDWDOOOHYHOVUHJDUGLQJWKHDVVLJQPHQWRIUHVRXUFHV6RPHNH\SDUWVRI6/27UDQVLW¶V 606LQFOXGH x'HILQHGUROHVDQGUHVSRQVLELOLWLHV x6WURQJH[HFXWLYHVDIHW\OHDGHUVKLS x)RUPDOVDIHW\DFFRXQWDELOLWLHVDQGFRPPXQLFDWLRQ x(IIHFWLYHSROLFLHVDQGSURFHGXUHVDQG x$FWLYHHPSOR\HHLQYROYHPHQW )XUWKHUPRUH6/27UDQVLW¶V606KDYHIRXUGLVWLQFWFRPSRQHQWVZKLFKDUHGLVFXVVHGLQ VXEVHTXHQWVHFWLRQVWRWKLV6DIHW\3ODQ x6DIHW\3ROLF\ x6DIHW\5LVN0DQDJHPHQW x6DIHW\$VVXUDQFH x6DIHW\3URPRWLRQ Section 5 Safety Management Policy 7KHILUVWFRPSRQHQWRI6/27UDQVLW¶V606LVWKH6DIHW\0DQDJHPHQW3ROLF\ZKLFKLVWKH IRXQGDWLRQRI6/27UDQVLW¶VVDIHW\PDQDJHPHQWV\VWHP,WFOHDUO\VWDWHVWKHRUJDQL]DWLRQ¶V VDIHW\REMHFWLYHVDQGVHWVIRUWKWKHSROLFLHVSURFHGXUHVDQGRUJDQL]DWLRQDOVWUXFWXUHVQHFHVVDU\ WRDFFRPSOLVKWKHVDIHW\REMHFWLYHV7KH6DIHW\0DQDJHPHQW3ROLF\FOHDUO\GHILQHVPDQDJHPHQW DQGHPSOR\HHUHVSRQVLELOLWLHVIRUVDIHW\WKURXJKRXWWKHRUJDQL]DWLRQ,WDOVRHQVXUHVWKDW PDQDJHPHQWLVDFWLYHO\HQJDJHGLQWKHRYHUVLJKWRIWKHV\VWHP¶VVDIHW\SHUIRUPDQFHE\UHTXLULQJ UHJXODUUHYLHZRIWKH6DIHW\0DQDJHPHQW3ROLF\EXGJHWDQGSURJUDPE\WKHGHVLJQDWHG $FFRXQWDEOH([HFXWLYH Subsection 5.1 Safety Management Policy Statement 6DIHW\LVDFRUHYDOXHDW6/27UDQVLWDQGPDQDJLQJVDIHW\LVDFRUHEXVLQHVVIXQFWLRQ6/2 7UDQVLWZLOOGHYHORSLPSOHPHQWPDLQWDLQDQGFRQWLQXRXVO\LPSURYHSURFHVVHVWRHQVXUHWKH VDIHW\RIRXUFXVWRPHUVHPSOR\HHVDQGWKHSXEOLF6/27UDQVLW¶VRYHUDOOVDIHW\REMHFWLYHLVWR SURDFWLYHO\PDQDJHVDIHW\KD]DUGVDQGWKHLUDVVRFLDWHGVDIHW\ULVNZLWKWKHLQWHQWWRHOLPLQDWH XQDFFHSWDEOHVDIHW\ULVNLQRXUWUDQVLWRSHUDWLRQV  Packet Page 48 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  6/27UDQVLWZLOO x&OHDUO\DQGFRQWLQXRXVO\H[SODLQWRDOOVWDIIWKDWHYHU\RQHZRUNLQJZLWKLQ6/27UDQVLW PXVWWDNHSDUWDQGEHUHVSRQVLEOHDQGDFFRXQWDEOHIRUWKHGHYHORSPHQWDQGRSHUDWLRQRI WKH6DIHW\0DQDJHPHQW6\VWHP 606  x:RUNFRQWLQXRXVO\WRPLQLPL]HVDIHW\ULVNV:RUNWRFRPSO\ZLWKDQGZKHUHYHU SRVVLEOHH[FHHGOHJLVODWLYHDQGUHJXODWRU\UHTXLUHPHQWVDQGVWDQGDUGVIRUSDVVHQJHUVDQG HPSOR\HHV x:RUNWRHQVXUHWKDWDOOHPSOR\HHVDUHSURYLGHGDSSURSULDWHVDIHW\LQIRUPDWLRQDQG WUDLQLQJDUHFRPSHWHQWLQVDIHW\PDWWHUVDQGDVVLJQHGWDVNVFRPPHQVXUDWHZLWKGXWLHV DQGVNLOOV x5HDIILUPWKDWUHVSRQVLELOLW\IRUPDNLQJRXURSHUDWLRQVVDIHUIRUHYHU\RQHOLHVZLWKDOO HPSOR\HHV±IURPH[HFXWLYHPDQDJHPHQWWRIURQWOLQHHPSOR\HHV(DFKPDQDJHULV UHVSRQVLEOHIRULPSOHPHQWLQJWKH606LQWKHLUDUHDRIUHVSRQVLELOLW\DQGZLOOEHKHOG DFFRXQWDEOHWRHQVXUHWKDWDOOUHDVRQDEOHVWHSVDUHWDNHQWRSHUIRUPDFWLYLWLHVHVWDEOLVKHG WKURXJKWKH606 &DOWUDQVHVWDEOLVKHGVDIHW\SHUIRUPDQFHWDUJHWVWRKHOSPHDVXUHWKHRYHUDOOHIIHFWLYHQHVVRIRXU SURFHVVHVDQGHQVXUHZHPHHWRXUVDIHW\REMHFWLYHV6/27UDQVLWZLOONHHSHPSOR\HHVLQIRUPHG DERXWVDIHW\SHUIRUPDQFHJRDOVDQGREMHFWLYHVWRHQVXUHFRQWLQXRXVVDIHW\LPSURYHPHQW Subsection 5.2 Safety Management Policy Communication 7KH6DIHW\0DQDJHPHQW3ROLF\LVFRPPXQLFDWHGWKURXJKRXWWKH$JHQF\WRDOOHPSOR\HHV PDQDJHUVDQGH[HFXWLYHVDVZHOODVFRQWUDFWRUVDQGWRWKH%RDUG 7KLVLVDFFRPSOLVKHGWKURXJKYDULRXVSURFHVVHVVXFKDV  x:RUNVKRSVWUDLQLQJVHVVLRQV&RQGXFWHGIRU6HQLRU0DQDJHPHQW'LUHFWRUV0DQDJHUV 6XSHUYLVRUV2QFHWKLV3ODQRUDQ\XSGDWHWRWKLV3ODQKDVEHHQVLJQHGE\WKH $FFRXQWDEOH([HFXWLYHDSSURYHGE\WKH%RDUGDQGFHUWLILHGE\&DOWUDQVLWZLOOEHFRPH VWDQGDUGSUDFWLFHLQSHUSHWXLW\VRWKDW606EHFRPHVVWDQGDUGEXVLQHVVSUDFWLFH$OO 8QLRQUHSUHVHQWDWLYHVZLOOEHNHSWLQIRUPHG  x1HZ+LUH6DIHW\2ULHQWDWLRQ±$OOQHZHPSOR\HHVUHJDUGOHVVRIWKHLUFODVVLILFDWLRQVZLOO EHWUDLQHGDERXWWKHLUUROHVDQGUHVSRQVLELOLWLHVSHUWDLQLQJWR37$63DQGWKHSULQFLSOHVRI 606  x6DIHW\EXOOHWLQVHPDLOVDIHW\QHZVOHWWHUEODVWVWRVWDIIDQGPRQWKO\VDIHW\PHHWLQJV  Packet Page 49 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Subsection 5.3 Employee Safety Reporting Program 6/27UDQVLWLPSOHPHQWHGDSURFHVVWKDWDOORZVHPSOR\HHVDQGFRQWUDFWHGHPSOR\HHVWRUHSRUW VDIHW\FRQGLWLRQVWRVHQLRUPDQDJHPHQWSURWHFWLRQVIRUHPSOR\HHVZKRUHSRUWVDIHW\FRQGLWLRQV WRVHQLRUPDQDJHPHQW7KHSXUSRVHGHVFULSWLRQDQGSURWHFWLRQVIRUHPSOR\HHVWRUHSRUWXQVDIH FRQGLWLRQVDQGKD]DUGVDUHGHVFULEHGLQWKH(PSOR\HH6DIHW\5HSRUWLQJ3URJUDPDVEHORZ 3XUSRVH D 7RHVWDEOLVKDV\VWHPIRU6/27UDQVLWHPSOR\HHVWRLGHQWLI\XQVDIHFRQGLWLRQVRUKD]DUGVDW ZRUNDQGUHSRUWWKHPWRWKHLUGHSDUWPHQWPDQDJHPHQWZLWKRXWIHDURIUHSULVDO+RZHYHU GLVFLSOLQDU\DFWLRQFRXOGUHVXOWLIWKHFRQGLWLRQUHSRUWHGUHYHDOVWKHHPSOR\HHZLOOIXOO\ SDUWLFLSDWHGLQRUFRQGXFWHGDQLOOHJDODFWJURVVQHJOLJHQFHRUGHOLEHUDWHRUZLOOIXOGLVUHJDUGRI UHJXODWLRQVRUSURFHGXUHVLQFOXGLQJUHSRUWLQJWRZRUNXQGHUWKHLQIOXHQFHRIFRQWUROOHG VXEVWDQFHVSK\VLFDODVVDXOWRIDFRZRUNHURUSDVVHQJHUWKHIWRIDJHQF\SURSHUW\XQUHSRUWHG VDIHW\HYHQWVXQUHSRUWHGFROOLVLRQVDQGXQUHSRUWHGSDVVHQJHULQMXULHVRUIDWDOLWLHV  E 7RSURYLGHJXLGHOLQHVIRUIDFLOLWDWLQJWKHWLPHO\FRUUHFWLRQRIXQVDIHFRQGLWLRQVRUKD]DUGVE\ 6/27UDQVLWPDQDJHPHQW  'HVFULSWLRQ D 7KLVSURJUDPSURYLGHVDPHWKRGIRU6/27UDQVLWPDQDJHPHQWWRLGHQWLI\HYDOXDWHDQG FRUUHFWRUDYRLGXQVDIHFRQGLWLRQVRUKD]DUGVSURFHGXUDOGHILFLHQFLHVGHVLJQLQDGHTXDFLHV HTXLSPHQWIDLOXUHVRUQHDUPLVVHVWKDWDGYHUVHO\DIIHFWWKHVDIHW\RIHPSOR\HHV  ([DPSOHVRIYROXQWDU\VDIHW\UHSRUWVLQFOXGH x6DIHW\KD]DUGVLQWKHRSHUDWLQJHQYLURQPHQW IRUH[DPSOHFRXQW\RUFLW\URDG FRQGLWLRQV  x3ROLFLHVDQGSURFHGXUHVWKDWDUHQRWZRUNLQJDVLQWHQGHG IRUH[DPSOHLQVXIILFLHQWWLPH WRFRPSOHWHSUHWULSLQVSHFWLRQ  x(YHQWVWKDWVHQLRUPDQDJHUVPLJKWQRWRWKHUZLVHNQRZDERXW IRUH[DPSOHQHDUPLVVHV  DQG x,QIRUPDWLRQDERXWZK\DVDIHW\HYHQWRFFXUUHG IRUH[DPSOHUDGLRFRPPXQLFDWLRQ FKDOOHQJHV   E 7KHSURJUDPDOVRLQYROYHVUHFRPPHQGLQJFRUUHFWLYHDFWLRQVDQGUHVROXWLRQVRILGHQWLILHG XQVDIHFRQGLWLRQVRUKD]DUGVDQGRUQHDUPLVV  F $OOHPSOR\HHVKDYHWKHREOLJDWLRQWRUHSRUWLPPHGLDWHO\DQ\XQVDIHFRQGLWLRQVRUKD]DUGVDQG QHDUPLVVWRWKHLULPPHGLDWHVXSHUYLVRUGHSDUWPHQWPDQDJHUDQGPD\GRVRZLWKRXWIHDURI UHSULVDO  Packet Page 50 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  G 8QVDIHFRQGLWLRQVRUKD]DUGVPD\DOVREHLGHQWLILHGDVDUHVXOWRIRFFXSDWLRQDOLQMXU\RU LOOQHVVLQYHVWLJDWLRQVDQGRUE\DFFLGHQWLQYHVWLJDWLRQ  H 2WKHUPHDQVE\ZKLFKKD]DUGVPD\EHLGHQWLILHGDUHLQVSHFWLRQVDXGLWVRUREVHUYDWLRQVPDGH E\WKHVXSHUYLVRUVPDQDJHPHQWVWDIIDVUHIHUHQFHGLQDJHQF\¶V6DIHW\,QVSHFWLRQ3URJUDP  I )LQGLQJVZLOOEHSXEOLVKHGLPPHGLDWHO\IROORZLQJPLWLJDWLRQDFWLRQV,IHPSOR\HH LGHQWLILFDWLRQLVDYDLODEOHGLUHFWIHHGEDFNUHJDUGLQJPLWLJDWLRQZLOOEHSURYLGHG  Subsection 5.4 SMS Authorities, Accountabilities, and Responsibilities 7KLV3ODQKDVDVVLJQHGVSHFLILF606DXWKRULWLHVDFFRXQWDELOLWLHVDQGUHVSRQVLELOLWLHVWRWKH GHVLJQDWHG$FFRXQWDEOH([HFXWLYH&KLHI6DIHW\2IILFHU$JHQF\¶V/HDGHUVKLS([HFXWLYH 0DQDJHPHQWDQG.H\6WDII(PSOR\HHVDVGHVFULEHGEHORZDQGGLVSOD\HGLQ$SSHQGL[% Subsection 5.4.1 Accountable Executive 6/27UDQVLW¶V$FFRXQWDEOH([HFXWLYHLVWKH&LW\7UDQVLW0DQDJHU7KH&LW\7UDQVLW0DQDJHULV DFFRXQWDEOHIRUHQVXULQJWKDWWKH$JHQF\¶V606LVHIIHFWLYHO\LPSOHPHQWHGWKURXJKRXWWKH $JHQF\¶VSXEOLFWUDQVSRUWDWLRQV\VWHP7KH&LW\7UDQVLW0DQDJHULVDFFRXQWDEOHIRUHQVXULQJ DFWLRQLVWDNHQDVQHFHVVDU\WRDGGUHVVVXEVWDQGDUGSHUIRUPDQFHLQWKH$JHQF\¶V6067KH&LW\ 7UDQVLW0DQDJHUPD\GHOHJDWHVSHFLILFUHVSRQVLELOLWLHVEXWWKHXOWLPDWHDFFRXQWDELOLW\IRU6/2 7UDQVLW¶VVDIHW\SHUIRUPDQFHFDQQRWEHGHOHJDWHGDQGDOZD\VUHVWVZLWKWKH&LW\7UDQVLW 0DQDJHU7KH&LW\7UDQVLW0DQDJHULVDFFRXQWDEOHIRUHQVXULQJWKDWWKH$JHQF\¶V606LV HIIHFWLYHO\LPSOHPHQWHGDQGWKDWDFWLRQLVWDNHQDVQHFHVVDU\WRDGGUHVVVXEVWDQGDUG SHUIRUPDQFHLQWKH$JHQF\¶V6067KH$FFRXQWDEOH([HFXWLYHPD\GHOHJDWHVSHFLILF UHVSRQVLELOLWLHVEXWQRWDFFRXQWDELOLW\IRU6/27UDQVLW¶VVDIHW\SHUIRUPDQFH 7KH&LW\7UDQVLW0DQDJHU¶VUROHVLQFOXGHEXWDUHQRWOLPLWHGWR x'HFLVLRQPDNLQJDERXWUHVRXUFHV HJSHRSOHDQGIXQGV WRVXSSRUWDVVHWPDQDJHPHQW 606DFWLYLWLHVDQGFDSLWDOLQYHVWPHQWV x6LJQLQJ606LPSOHPHQWDWLRQSODQQLQJGRFXPHQWV x(QGRUVLQJ606LPSOHPHQWDWLRQWHDPPHPEHUVKLSDQG x(QVXULQJVDIHW\FRQFHUQVDUHFRQVLGHUHGDQGDGGUHVVHGLQWKHDJHQF\¶VRQJRLQJEXGJHW SODQQLQJSURFHVV x(QVXULQJWUDQVSDUHQF\LQVDIHW\SULRULWLHVIRUWKH%RDUGDQGIRUWKHHPSOR\HHV x(VWDEOLVKLQJJXLGDQFHRQWKHOHYHORIVDIHW\ULVNDFFHSWDEOHWRWKHDJHQF\ x$VVXULQJVDIHW\SROLF\LVDSSURSULDWHO\FRPPXQLFDWHGWKURXJKRXWWKHDJHQF\ x2WKHUGXWLHVDVDVVLJQHGQHFHVVDU\ Packet Page 51 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Subsection 5.4.2 Chief Safety Officer 7KH&KLHI6DIHW\2IILFHUKDVWKHDXWKRULW\DQGUHVSRQVLELOLW\IRUGD\WRGD\LPSOHPHQWDWLRQDQG RSHUDWLRQRI6/27UDQVLW¶V606 &KLHI6DIHW\2IILFHU¶V5ROHVLQFOXGH x'HFLVLRQPDNLQJDERXWUHVRXUFHV HJSHRSOHDQGIXQGV WRVXSSRUWDVVHWPDQDJHPHQW 606DFWLYLWLHVDQGFDSLWDOLQYHVWPHQWV x2YHUVHHLQJWKHVDIHW\ULVNPDQDJHPHQWSURJUDPE\IDFLOLWDWLQJKD]DUGLGHQWLILFDWLRQ VDIHW\ULVNDVVHVVPHQWDQGWKHGHYHORSPHQWDQGLPSOHPHQWDWLRQRIVDIHW\ULVN PLWLJDWLRQV x0RQLWRULQJVDIHW\ULVNPLWLJDWLRQDFWLYLWLHV x3URYLGLQJSHULRGLFUHSRUWVRQVDIHW\SHUIRUPDQFH x%ULHILQJWKH$FFRXQWDEOH([HFXWLYHRQ606LPSOHPHQWDWLRQSURJUHVV x3ODQQLQJVDIHW\PDQDJHPHQWWUDLQLQJDQG x'HYHORSLQJDQGRUJDQL]LQJDQQXDODXGLWVUHYLHZVRI606SURFHVVHVDQGWKH$JHQF\ 6DIHW\3ODQWRHQVXUHFRPSOLDQFHZLWK&)53DUWUHTXLUHPHQWV x0DLQWDLQLQJVDIHW\GRFXPHQWDWLRQ x2WKHUGXWLHVDVDVVLJQHGQHFHVVDU\  Subsection 5.4.3 Agency Leadership and Executive Management 7KHFRQWUDFWLQJ*HQHUDO0DQDJHU2SHUDWLRQV0DQDJHU6DIHW\0DQDJHUDQG0DLQWHQDQFH 0DQDJHUFRPSULVH$JHQF\/HDGHUVKLS6RPHRIWKHLUUHVSRQVLELOLWLHVLQFOXGH x'D\WRGD\LPSOHPHQWDWLRQRIWKH$JHQF\¶V606WKURXJKRXWWKHLUGHSDUWPHQWDQGWKH RUJDQL]DWLRQ x&RPPXQLFDWLQJVDIHW\DFFRXQWDELOLW\DQGUHVSRQVLELOLW\IURPWKHIURQWOLQHHPSOR\HHVWR WKHWRSRIWKHRUJDQL]DWLRQ x(QVXULQJHPSOR\HHVDUHIROORZLQJWKHLUZRUNLQJUXOHVDQGSURFHGXUHVVDIHW\UXOHVDQG UHJXODWLRQVLQSHUIRUPLQJWKHLUMREVDQGWKHLUVSHFLILFUROHVDQGUHVSRQVLELOLWLHVLQWKH LPSOHPHQWDWLRQRIWKLV$JHQF\6DIHW\3ODQDQGWKH$JHQF\¶V606 x(QVXULQJWKDWHPSOR\HHVFRPSO\ZLWKWKHVDIHW\UHSRUWLQJSURJUDPDQGDUHUHSRUWLQJ XQVDIHFRQGLWLRQVDQGKD]DUGVWRWKHLUGHSDUWPHQWPDQDJHPHQWDQGPDNLQJVXUHUHSRUWHG XQVDIHFRQGLWLRQVDQGKD]DUGVDUHDGGUHVVHGLQDWLPHO\PDQQHU x(QVXULQJWKDWUHVRXUFHVDUHVXIILFLHQWWRFDUU\RXWHPSOR\HHWUDLQLQJFHUWLILFDWLRQDQGUH WUDLQLQJDVUHTXLUHGE\WKHLUMREFODVVLILFDWLRQV Subsection 5.4.4 Key Staff 7KHDJHQF\.H\6WDII(PSOR\HHVPD\LQFOXGHPDQDJHUVVXSHUYLVRUVVSHFLDOLVWVDQDO\VWV GDWDEDVHDGPLQLVWUDWRUVDQGRWKHUNH\HPSOR\HHVZKRDUHSHUIRUPLQJKLJKO\WHFKQLFDOZRUNDQG Packet Page 52 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  RYHUVHHLQJHPSOR\HHVSHUIRUPLQJFULWLFDOWDVNVDQGSURYLGLQJVXSSRUWLQWKHLPSOHPHQWDWLRQRI WKLV$JHQF\6DIHW\3ODQDQG606SULQFLSOHVLQYDULRXVGHSDUWPHQWVWKURXJKRXWWKHDJHQF\  6/27UDQVLW¶V.H\6WDII(PSOR\HHVUHVSRQVLELOLWLHVLQFOXGH x(QVXULQJWKDWHPSOR\HHVDUHFRPSO\LQJZLWKWKHVDIHW\UHSRUWLQJSURJUDP x(QVXULQJVXSHUYLVRUVDUHFRQGXFWLQJWKHLUWRROER[VDIHW\PHHWLQJV x3URPRWLQJVDIHW\LQHPSOR\HH¶VUHVSHFWLYHDUHDRIUHVSRQVLELOLWLHV±7KDWPHDQV]HUR DFFLGHQWVDEVHQFHRIDQ\VDIHW\FRQFHUQVSHUIHFWHPSOR\HHSHUIRUPDQFHDQG FRPSOLDQFHZLWKDJHQF\UXOHVDQGSURFHGXUHVDQGUHJXODWRU\UHTXLUHPHQWV x(QVXULQJVDIHW\RISDVVHQJHUVHPSOR\HHVDQGWKHSXEOLF x5HVSRQGLQJWRFXVWRPHUFRPSODLQWVDQGH[SHFWDWLRQVIRUIUHTXHQF\UHOLDELOLW\DQG FRQYHQLHQFHRIVHUYLFH x5HSODFLQJDQGPDLQWDLQLQJDJLQJIDFLOLWLHVHTXLSPHQWDQGLQIUDVWUXFWXUH x0HHWLQJLQFUHDVLQJGHPDQGVIRUIL[HGURXWHFRPPXWHUVHUYLFHDQGSDUDWUDQVLWVHUYLFH x'HYHORSLQJDQGPDLQWDLQLQJSURJUDPVWRJDWKHUSHUWLQHQWGDWDHOHPHQWVWRGHYHORSVDIHW\ SHUIRUPDQFHUHSRUWVDQGFRQGXFWXVHIXOVWDWLVWLFDODQDO\VHVWRLGHQWLI\WUHQGVDQGV\VWHP SHUIRUPDQFHWDUJHWV x(VWDEOLVKLQJFOHDUOLQHVRIVDIHW\FRPPXQLFDWLRQDQGKROGLQJDFFRXQWDELOLW\IRUVDIHW\ SHUIRUPDQFH x$VVLVWLQJDVVXEMHFWPDWWHUH[SHUWVLQVDIHW\ULVNDVVHVVPHQWDQGVDIHW\ULVNPLWLJDWLRQ SURFHVVHV Section 6 Safety Risk Management (SRM) 7KHVHFRQGFRPSRQHQWRI6/27UDQVLW¶V606LV6DIHW\5LVN0DQDJHPHQWZKLFKLQFOXGHV SURFHVVHVDQGSURFHGXUHVWRSURYLGHDQXQGHUVWDQGLQJRIWKH$JHQF\¶VRSHUDWLRQVDQGYHKLFOH PDLQWHQDQFHWRDOORZLQGLYLGXDOVWRLGHQWLI\KD]DUGVDVVRFLDWHGZLWKWKRVHDFWLYLWLHV 6/27UDQVLWKDVLPSOHPHQWHGD6DIHW\5LVN0DQDJHPHQWSURFHVVIRUDOOHOHPHQWVRILWV WUDQVSRUWDWLRQV\VWHP7KH6DIHW\5LVN0DQDJHPHQWSURFHVVLQFOXGHVWKHIROORZLQJDFWLYLWLHV VDIHW\KD]DUGLGHQWLILFDWLRQVDIHW\ULVNDVVHVVPHQWDQGVDIHW\ULVNPLWLJDWLRQ Subsection 6.1 Safety Hazard Identification +D]DUGLGHQWLILFDWLRQLVWKHILUVWVWHSLQWKH6DIHW\5LVN0DQDJHPHQWSURFHVVDQGDNH\FRPSRQHQW,W LQYROYHVWKHVHIXQGDPHQWDOVDIHW\UHODWHGDFWLYLWLHV,GHQWLI\LQJVDIHW\KD]DUGVDQGWKHLU FRQVHTXHQFHVDVVHVVLQJWKHULVNVDVVRFLDWHGZLWKWKHFRQVHTXHQFHVRIWKHKD]DUGVDQGGHYHORSLQJ PLWLJDWLRQVWRUHGXFHWKHSRWHQWLDOFRQVHTXHQFHVRIWKHLGHQWLILHGKD]DUGV 7KHIROORZLQJLV6/27UDQVLW¶VPHWKRGVDQGSURFHVVHVWRLGHQWLI\KD]DUGV7KH$JHQF\ FRQVLGHUVDVDVRXUFHIRUKD]DUGLGHQWLILFDWLRQGDWDDQGLQIRUPDWLRQSURYLGHGE\DQRYHUVLJKW DXWKRULW\DQGWKH)7$+D]DUGVDUHLGHQWLILHGWKURXJKDYDULHW\RIVRXUFHVLQFOXGLQJ Packet Page 53 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  x(PSOR\HHVDIHW\UHSRUWLQJ x5HYLHZRIYHKLFOHFDPHUDIRRWDJH x5HYLHZRIPRQWKO\SHUIRUPDQFHGDWDDQGVDIHW\SHUIRUPDQFHWDUJHWV x2EVHUYDWLRQVIURPVXSHUYLVRUV x0DLQWHQDQFHUHSRUWV x&RPPHQWVIURPFXVWRPHUVSDVVHQJHUVDQGWKLUGSDUWLHV x6DIHW\FRPPLWWHHGULYHUDQGDOOVWDIIPHHWLQJV x5HVXOWVRIDXGLWVDQGLQVSHFWLRQVRIYHKLFOHVDQGIDFLOLWLHV x5HVXOWVRIWUDLQLQJDVVHVVPHQWV x,QYHVWLJDWLRQVLQWRVDIHW\HYHQWVLQFLGHQWVDQGRFFXUUHQFHVDQG x,QIRUPDWLRQIURP)7$DQGRYHUVLJKWDXWKRULWLHV :KHQDKD]DUGKDVEHHQLGHQWLILHGZKDWHYHUWKHVRXUFHLWLVUHSRUWHGWRWKH6/27UDQVLW&KLHI 6DIHW\2IILFHUZKRHQWHUVLWLQWRWKH+D]DUG/RJ7KH&KLHI6DIHW\2IILFHUDOVRPD\HQWHU KD]DUGVLQWRWKLVORJEDVHGRQUHYLHZVRIRSHUDWLRQVDQGPDLQWHQDQFHDFWLYLWLHVDQGSURFHGXUHV 7KH&KLHI6DIHW\2IILFHUZLOOLQYHVWLJDWHKD]DUGVWRFROOHFWLQIRUPDWLRQDQGGHWHUPLQHLIKD]DUGV QHHGWREHHQWHUHGLQWRWKHVDIHW\ULVNDVVHVVPHQWSURFHVV,QIROORZLQJXSRQLGHQWLILHGKD]DUGV WKH&KLHI6DIHW\2IILFHUPD\ x5HDFKRXWWRWKHUHSRUWLQJSDUW\LIDYDLODEOHWRJDWKHUDOONQRZQLQIRUPDWLRQDERXWWKH UHSRUWHGKD]DUG x&RQGXFWDZDONWKURXJKRIWKHDIIHFWHGDUHDDVVHVVLQJWKHSRVVLEOHKD]DUGRXVFRQGLWLRQ JHQHUDWLQJYLVXDOGRFXPHQWDWLRQ SKRWRJUDSKVDQGRUYLGHR DQGWDNLQJDQ\ PHDVXUHPHQWVGHHPHGQHFHVVDU\ x&RQGXFWLQWHUYLHZVZLWKHPSOR\HHVLQWKHDUHDWRJDWKHUSRWHQWLDOO\UHOHYDQWLQIRUPDWLRQ RQWKHUHSRUWHGKD]DUG x5HYLHZDQ\GRFXPHQWDWLRQDVVRFLDWHGZLWKWKHKD]DUG UHFRUGVUHSRUWVSURFHGXUHV LQVSHFWLRQVWHFKQLFDOGRFXPHQWVHWF  x&RQWDFWRWKHUGHSDUWPHQWVWKDWPD\KDYHDVVRFLDWLRQZLWKRUWHFKQLFDONQRZOHGJH UHOHYDQWWRWKHUHSRUWHGKD]DUG x5HYLHZDQ\SDVWUHSRUWHGKD]DUGVRIDVLPLODUQDWXUHDQG x(YDOXDWHWDVNVDQGRUSURFHVVHVDVVRFLDWHGZLWKWKHUHSRUWHGKD]DUG $Q\LGHQWLILHGKD]DUGWKDWSRVHVDQLPPHGLDWHULVNWRWUDQVLWRSHUDWLRQVWKHKHDOWKDQGVDIHW\RI HPSOR\HHVRUWKHSXEOLFRUHTXLSPHQWPXVWLPPHGLDWHO\EHEURXJKWWRWKHDWWHQWLRQRIWKH $FFRXQWDEOH([HFXWLYHDQGSODFHGWKURXJKWKH6DIHW\5LVN0DQDJHPHQWSURFHVVIRUVDIHW\ULVN DVVHVVPHQWDQGPLWLJDWLRQ2WKHUZLVHKD]DUGVZLOOEHSULRULWL]HGIRUIXUWKHU6DIHW\5LVN 0DQDJHPHQWDFWLYLW\ Packet Page 54 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Subsection 6.2 Safety Risk Assessment 6DIHW\ULVNDVVHVVPHQWGHILQHVWKHOHYHORUGHJUHHRIWKHVDIHW\ULVNE\DVVHVVLQJWKHOLNHOLKRRG DQGVHYHULW\RIWKHFRQVHTXHQFHVRIKD]DUGVDQGSULRULWL]HVKD]DUGVEDVHGRQWKHVDIHW\ULVN7KH &KLHI6DIHW\2IILFHUZLWKDVVLVWDQFHIURPNH\VWDIIVXEMHFWPDWWHUH[SHUWVLVUHVSRQVLEOHIRU DVVHVVLQJLGHQWLILHGKD]DUGVDQGUDWLQJVXVLQJWKHVDIHW\ULVNPDWUL[EHORZ3ULRULWL]LQJVDIHW\ ULVNSURYLGHVWKH$FFRXQWDEOH([HFXWLYHZLWKWKHLQIRUPDWLRQQHHGHGWRPDNHGHFLVLRQVDERXW UHVRXUFHDSSOLFDWLRQ 7KHIROORZLQJPDWUL[DGRSWHGIURPWKH76,3DUWLFLSDWLRQ*XLGH±6063ULQFLSOHVIRU7UDQVLW IDFLOLWDWHVWKHUDQNLQJRIKD]DUGVEDVHGRQWKHLUSUREDELOLW\RIRFFXUUHQFHDQGVHYHULW\RIWKHLU RXWFRPH 3UREDELOLW\/HYHOV 'HVFULSWLRQ /HYHO 6SHFLILF,QGLYLGXDO,WHP )OHHW,QYHQWRU\ )UHTXHQW $ /LNHO\WRRFFXURIWHQLQWKHOLIHRIDQLWHP &RQWLQXRXVO\H[SHULHQFHG 3UREDEOH % :LOORFFXUVHYHUDOWLPHVLQWKHOLIHRIDQ LWHP:LOORFFXUIUHTXHQWO\ 2FFDVLRQDO & /LNHO\WRRFFXUVRPHWLPHLQWKHOLIHRIDQ LWHP:LOORFFXUVHYHUDOWLPHV 5HPRWH ' 8QOLNHO\EXWSRVVLEOHWRRFFXULQWKHOLIH RIDQLWHP 8QOLNHO\EXWFDQUHDVRQDEO\EHH[SHFWHG WRRFFXU ,PSUREDEOH ( 6RXQOLNHO\LWFDQEHDVVXPHGRFFXUUHQFH PDQQRWEHH[SHULHQFHGLQWKHOLIHRIDQ LWHP 8QOLNHO\WRRFFXUEXWSRVVLEOH (OLPLQDWHG ) ,QFDSDEOHRIRFFXUUHQFH7KLVOHYHOLVXVHG ZKHQSRWHQWLDOKD]DUGVDUHLGHQWLILHGDQG ODWHUHOLPLQDWHG ,QFDSDEOHRIRFFXUUHQFH7KLVOHYHOLVXVHG ZKHQSRWHQWLDOKD]DUGVDUHLGHQWLILHGDQG ODWHUHOLPLQDWHG 7KHPHDVXULQJJRHVIURP$WR)ZLWK$EHLQJIUHTXHQWRUOLNHO\WRRFFXUIUHTXHQWO\DQG(EHLQJ LPSUREDEOHRUH[SHFWHGWKDWWKLVHYHQWZLOOPRVWOLNHO\QHYHURFFXU7KHGHVLJQDWLRQ)LVXVHG ZKHQSRWHQWLDOKD]DUGVDUHLGHQWLILHGDQGODWHUHOLPLQDWHG 6HYHULW\/HYHOV 'HVFULSWLRQ /HYHO 0LVKDS5HVXOW&ULWHULD &DWDVWURSKLF  &RXOG5HVXOWLQRQHRUPRUHRIWKHIROORZLQJGHDWKSHUPDQHQWWRWDOGLVDELOLW\ LUUHYHUVLEOHVLJQLILFDQWHQYLURQPHQWDOLPSDFWRUPRQHWDU\ORVVHTXDOWRRUH[FHHGLQJ 0 &ULWLFDO  &RXOGUHVXOWLQRQHRUPRUHRIWKHIROORZLQJSHUPDQHQWSDUWLDOGLVDELOLW\LQMXULHVRU RFFXSDWLRQDOLOOQHVVWKDWPD\UHVXOWLQKRVSLWDOL]DWLRQRIDWOHDVWWKUHHSHUVRQQHO UHYHUVLEOHVLJQLILFDQWHQYLURQPHQWDOLPSDFWRUPRQHWDU\ORVVHTXDOWRRUH[FHHGLQJ 0EXWOHVVWKDQ0 Packet Page 55 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  6HYHULW\/HYHOV 0DUJLQDO  &RXOGUHVXOWLQRQHRUPRUHRIWKHIROORZLQJLQMXULHVRURFFXSDWLRQDOLOOQHVVUHVXOWLQJLQ RQHRUPRUHORVWZRUNGD\ V UHYHUVLEOHPRGHUDWHHQYLURQPHQWDOLPSDFWRUPRQHWDU\ ORVVHTXDOWRRUH[FHHGLQJNEXWOHVVWKDQ0 1HJOLJLEOH  &RXOGUHVXOWLQRQHRUPRUHRIWKHIROORZLQJLQMXULHVRURFFXSDWLRQDOLOOQHVVQRW UHVXOWLQJLQORVWZRUNGD\PLQLPXPHQYLURQPHQWDOLPSDFW2UPRQHWDU\ORVVOHVVWKDQ N 7KH6DIHW\5LVN6HYHULW\7DEOHSUHVHQWVDW\SLFDOVDIHW\ULVN,WLQFOXGHVIRXUFDWHJRULHVWRGHQRWH WKHOHYHORIVHYHULW\RIWKHRFFXUUHQFHRIDFRQVHTXHQFHWKHPHDQLQJRIHDFKFDWHJRU\DQGWKH DVVLJQPHQWRIDYDOXHWRHDFKFDWHJRU\XVLQJQXPEHUV,QWKLVWDEOHLVFRQVLGHUHGFDWDVWURSKLF PHDQLQJSRVVLEOHGHDWKVDQGHTXLSPHQWGHVWUR\HGDQGLVFRQVLGHUHGQHJOLJLEOHRURIOLWWOH FRQVHTXHQFHZLWKWZROHYHOVLQEHWZHHQ 6DIHW\5LVN3UREDELOLW\DQG6DIHW\5LVN6HYHULW\DUHFRPELQHGLQWRWKH6DIHW\5LVN,QGH[ 5DQNLQJWRKHOSSULRULWL]HVDIHW\ULVNVDFFRUGLQJWRWKHWDEOHEHORZ  6DIHW\5LVN$VVHVVPHQW0DWUL[ 6HYHULW\o 3UREDELOLW\p &DWDVWURSKLF  &ULWLFDO  0DUJLQDO  1HJOLJLEOH  $)UHTXHQW$$$$ %3UREDEOH%%%% &2FFDVLRQDO&&&& '5HPRWH'''' (,PSUREDEOH(((( )(OLPLQDWHG 6DIHW\5LVN,QGH[5DQNLQJ $%&$%+LJK 8QDFFHSWDEOH '&$%6HULRXV 8QGHVLUDEOH:LWKPDQDJHPHQWGHFLVLRQUHTXLUHG ('(&'($%0HGLXP $FFHSWDEOHZLWKUHYLHZE\PDQDJHPHQW &'(/RZ $FFHSWDEOHZLWKRXWUHYLHZ 7KH&KLHI6DIHW\2IILFHUGRFXPHQWVUHFRPPHQGDWLRQVUHJDUGLQJKD]DUGUDWLQJDQGPLWLJDWLRQRSWLRQVDQG UHSRUWVWKLVLQIRUPDWLRQWRWKH$FFRXQWDEOH([HFXWLYH Subsection 6.3 Safety Risk Mitigation 7KH&KLHI6DIHW\2IILFHUDVVLVWHGE\.H\6WDIIVXEMHFWPDWWHUH[SHUWVUHYLHZVFXUUHQWVDIHW\ ULVNPLWLJDWLRQVDQGHVWDEOLVKSURFHGXUHVWR HOLPLQDWH PLWLJDWH DFFHSWVSHFLILFULVNV 3ULRULWL]DWLRQRIVDIHW\UHPHGLDWLRQPHDVXUHVLVEDVHGRQULVNDQDO\VLVDQGDFRXUVHRIDFWLRQ DFFHSWDEOHWR6/27UDQVLWPDQDJHPHQW Packet Page 56 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  7KHVDIHW\ULVNPXVWEHPLWLJDWHGLIUDQNHGDV8QDFFHSWDEOH +LJK5HG 7KRVHVDIHW\ULVNVWKDW KDYHEHHQPLWLJDWHGHYHQWKRVHPLWLJDWHGULVNVVKRZQDV$FFHSWDEOHVWDWXV /RZ*UHHQ  XQGHUJRUHJXODUDQGFRQVLVWHQWPRQLWRULQJWRHQVXUHWKHPLWLJDWLRQVWUDWHJ\LVHIIHFWLYH .H\VWUDWHJLHVWRPLQLPL]HWKHW\SHVRIULVNVWKDWSRWHQWLDOO\H[LVWLQFOXGH x'HYHORSPHQWDQGGHSOR\PHQWRISROLFLHVDQGSURFHGXUHVWKDWDGGUHVVNQRZQKD]DUGVDQG ULVNV x'LVFXVVLRQRIRWKHUDFWLRQVVWUDWHJLHVDQGSURFHGXUHVWKDWPLJKWKHOSVDIHJXDUGDJDLQVW XQNQRZQXQIRUHVHHQULVNV x7UDLQLQJRIGULYHUVDQGRWKHUDJHQF\VWDIIRQDOOVDIHW\SROLFLHVDQGSURFHGXUHV x7UDLQLQJRIGULYHUVDQGRWKHUDJHQF\VWDIIRQPHWKRGRORJLHVIRUKDQGOLQJHPHUJHQFLHV DQG x7UDLQLQJRIGULYHUVDQGVWDIIRQSURSHUDQGHIIHFWLYHXVHRIHPHUJHQF\HTXLSPHQWDQG FRPPXQLFDWLRQWHFKQRORJLHVDQGSURWRFRO 6DIHW\ULVNPLWLJDWLRQVDUHWUDFNHGDQGXSGDWHGLQWKH+D]DUG/RJE\WKH&KLHI6DIHW\2IILFHU Section 7 Safety Assurance 7KHWKLUGFRPSRQHQWRIWKH$JHQF\¶V606LV6DIHW\$VVXUDQFHZKLFKHQVXUHVWKHSHUIRUPDQFH DQGHIIHFWLYHQHVVRIVDIHW\ULVNFRQWUROVHVWDEOLVKHGXQGHUVDIHW\ULVNPDQDJHPHQW6DIHW\ DVVXUDQFHDOVRKHOSVHQVXUHWKDWWKHRUJDQL]DWLRQPHHWVRUH[FHHGVLWVVDIHW\REMHFWLYHVWKURXJK WKHFROOHFWLRQDQDO\VLVDQGDVVHVVPHQWRIGDWDUHJDUGLQJWKHRUJDQL]DWLRQ VSHUIRUPDQFH6DIHW\ DVVXUDQFHLQFOXGHVLQVSHFWLRQDFWLYLWLHVWRVXSSRUWRYHUVLJKWDQGSHUIRUPDQFHPRQLWRULQJ 6/27UDQVLWPRQLWRUVLWVRSHUDWLRQVDQGPDLQWHQDQFHSURWRFROVDQGSURFHGXUHVDQGDQ\VDIHW\ ULVNPLWLJDWLRQVWRHQVXUHWKDWLWLVLPSOHPHQWLQJWKHPDVSODQQHG)XUWKHUPRUHWKH$JHQF\ LQYHVWLJDWHVVDIHW\HYHQWV DVGHILQHGLQ$SSHQGL[& DQGDQ\UHSRUWVRIQRQFRPSOLDQFHZLWK DSSOLFDEOHUHJXODWLRQVVWDQGDUGVDQGOHJDODXWKRULW\)LQDOO\WKH$JHQF\FRQWLQXDOO\PRQLWRUV LQIRUPDWLRQUHSRUWHGWRLWWKURXJKDQ\LQWHUQDOVDIHW\UHSRUWLQJSURJUDPVLQFOXGLQJWKHHPSOR\HH VDIHW\UHSRUWLQJSURJUDP 6RPHRIWKHNH\HOHPHQWVRI6/27UDQVLW¶V6DIHW\3HUIRUPDQFH0RQLWRULQJDQG0HDVXUHPHQW DUHVKRZQEHORZLQVXEVHFWLRQ Subsection 7.1 Safety Performance Monitoring and Measurement $VSDUWRIWKH6DIHW\$VVXUDQFH3URFHVV6/27UDQVLW x0RQLWRUVWKHV\VWHPIRUFRPSOLDQFHZLWKDQGVXIILFLHQF\RIWKH$JHQF\¶VSURFHGXUHV IRURSHUDWLRQVDQGPDLQWHQDQFHWKURXJK o6DIHW\DXGLWV o,QIRUPDOLQVSHFWLRQV Packet Page 57 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  o5HJXODUUHYLHZRIRQERDUGFDPHUDIRRWDJHWRDVVHVVGULYHUVDQGVSHFLILF LQFLGHQWV o6DIHW\VXUYH\V o(PSOR\HHVDIHW\UHSRUWLQJSURJUDP o,QYHVWLJDWLRQRIVDIHW\RFFXUUHQFHV o6DIHW\UHYLHZSULRUWRWKHODXQFKRUPRGLILFDWLRQRIDQ\IDFHWRIVHUYLFH o'DLO\GDWDJDWKHULQJDQGPRQLWRULQJRIGDWDUHODWLQJWRWKHGHOLYHU\RIVHUYLFH o5HJXODUYHKLFOHLQVSHFWLRQVDQGSUHYHQWDWLYHPDLQWHQDQFHDQG o&RQWLQXRXVIHHGEDFNORRSEHWZHHQOHDGHUVKLSDQGDOOOHYHOVRIWKHDJHQF\ x0RQLWRUVLWVRSHUDWLRQVWRLGHQWLI\DQ\VDIHW\ULVNPLWLJDWLRQVWKDWPD\EHLQHIIHFWLYH LQDSSURSULDWHRUZHUHQRWLPSOHPHQWHGDVLQWHQGHGWKURXJK o5HYLHZLQJUHVXOWVIURPDFFLGHQWLQFLGHQWDQGRFFXUUHQFHLQYHVWLJDWLRQV o0RQLWRULQJHPSOR\HHVDIHW\UHSRUWLQJ o5HYLHZLQJUHVXOWVRILQWHUQDOVDIHW\DXGLWVDQGLQVSHFWLRQVDQG o$QDO\]LQJRSHUDWLRQDODQGVDIHW\GDWDWRLGHQWLI\HPHUJLQJVDIHW\FRQFHUQV x&RQGXFWVLQYHVWLJDWLRQVRIVDIHW\HYHQWVWRLGHQWLI\FDXVDOIDFWRUVDQG x0RQLWRUVLQIRUPDWLRQUHSRUWHGWKURXJKDQ\LQWHUQDOVDIHW\UHSRUWLQJSURJUDPV o7KH&KLHI6DIHW\2IILFHUURXWLQHO\UHYLHZVVDIHW\GDWDFDSWXUHGLQHPSOR\HH VDIHW\UHSRUWVVDIHW\PHHWLQJPLQXWHVFXVWRPHUFRPSODLQWVDQGRWKHUVDIHW\ FRPPXQLFDWLRQFKDQQHOV:KHQQHFHVVDU\WKH&KLHI6DIHW\2IILFHUHQVXUHVWKDW WKHLVVXHVDQGFRQFHUQVDUHLQYHVWLJDWHGRUDQDO\]HGWKURXJKWKHVDIHW\ULVN DVVHVVPHQWSURFHVV o7KH&KLHI6DIHW\2IILFHUDOVRUHYLHZVWKHUHVXOWVRILQWHUQDODQGH[WHUQDOUHYLHZV LQFOXGLQJDXGLWVDQGDVVHVVPHQWVZLWKILQGLQJVDIIHFWLQJVDIHW\SHUIRUPDQFH FRPSOLDQFHZLWKRSHUDWLRQVDQGPDLQWHQDQFHSURFHGXUHVRUWKHHIIHFWLYHQHVVRI VDIHW\ULVNPLWLJDWLRQV7KH&KLHI6DIHW\2IILFHUGLVFXVVHVUHOHYDQWVDIHW\LVVXHV DQGFRQFHUQVZLWKWKH$FFRXQWDEOH([HFXWLYHDQGH[HFXWLYHPDQDJHPHQWDQG GRFXPHQWVWKHUHVXOWVRIWKHVHUHYLHZVLQWKH+D]DUG/RJ ,QWKHHYHQWRIDIDWDOLW\6/27UDQVLWFRPSOLHVZLWKDOO)7$GUXJDQGDOFRKROUHTXLUHPHQWV ,Q&DOLIRUQLDHYHU\GULYHULQYROYHGLQDQDFFLGHQWWKDWUHVXOWVLQGHDWKLQMXU\RUSURSHUW\ GDPDJHRYHUHIIHFWLYH-DQXDU\PXVWUHSRUWWKHDFFLGHQWRQD5HSRUWRI7UDIILF $FFLGHQW2FFXUULQJLQ&DOLIRUQLD 65 IRUPWR'097KHUHSRUWIRUPVDUHDYDLODEOHDW ZZZGPYFDJRYE\FDOOLQJDQGDW&+3DQG'09RIILFHV$OVRXQGHU &DOLIRUQLD9HKLFOH&RGH† E WKHGULYHURIDYHKLFOHWKDWLVRZQHGRURSHUDWHGE\D SXEOLFO\RZQHGRURSHUDWHGWUDQVLWV\VWHPRUWKDWLVRSHUDWHGXQGHUFRQWUDFWZLWKDSXEOLFO\ RZQHGRURSHUDWHGWUDQVLWV\VWHPDQGWKDWLVXVHGWRSURYLGHUHJXODUO\VFKHGXOHGWUDQVSRUWDWLRQ WRWKHJHQHUDOSXEOLFRUIRURWKHURIILFLDOEXVLQHVVRIWKHV\VWHPVKDOOZLWKLQGD\VRIWKH Packet Page 58 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  RFFXUUHQFHRIWKHDFFLGHQWUHSRUWWRWKHWUDQVLWV\VWHPDQ\DFFLGHQWRIDW\SHRWKHUZLVHUHTXLUHG WREHUHSRUWHGSXUVXDQWWRVXEGLYLVLRQ D RI6HFWLRQ6/27UDQVLWUHTXLUHVGULYHU QRWLILFDWLRQWR6/27UDQVLWLPPHGLDWHO\DQGPDLQWDLQVUHFRUGVRIDQ\UHSRUWILOHGSXUVXDQWWR WKLVSDUDJUDSK Section 8 Safety Promotion 7KHIRXUWKFRPSRQHQWRIWKH$JHQF\¶V606LV6DIHW\3URPRWLRQZKLFKLQFOXGHVDFRPELQDWLRQ RIWUDLQLQJDQGFRPPXQLFDWLRQRIVDIHW\LQIRUPDWLRQWRHPSOR\HHVWRHQKDQFHWKH$JHQF\¶V VDIHW\SHUIRUPDQFH6DIHW\3URPRWLRQVHWVWKHWRQHIRUWKH606DQGKHOSV6/27UDQVLWWR HVWDEOLVKDQGPDLQWDLQDUREXVWVDIHW\FXOWXUH6DIHW\3URPRWLRQKDVWZRFRPSRQHQWV  6DIHW\ &RPPXQLFDWLRQDQG  &RPSHWHQFLHVDQG7UDLQLQJ Subsection 8.1 Safety Communication 6/27UDQVLWFRPPXQLFDWHVVDIHW\DQGVDIHW\SHUIRUPDQFHLQIRUPDWLRQWKURXJKRXWWKH RUJDQL]DWLRQWKDWDWDPLQLPXPFRQYH\VLQIRUPDWLRQRQKD]DUGVDQGVDIHW\ULVNVUHOHYDQWWR HPSOR\HHV¶UROHVDQGUHVSRQVLELOLWLHVDQGLQIRUPVHPSOR\HHVRIVDIHW\DFWLRQVWDNHQLQUHVSRQVH WRUHSRUWVVXEPLWWHGWKURXJKDQHPSOR\HHVDIHW\UHSRUWLQJSURJUDP 2QJRLQJVDIHW\FRPPXQLFDWLRQLVFULWLFDODQG6/27UDQVLWHQVXUHVFRPPXQLFDWLRQRFFXUVXS GRZQDQGDFURVVDOOOHYHOVRIWKHRUJDQL]DWLRQ$Q\OHVVRQVOHDUQHGDUHFRPPXQLFDWHGWRDOO FRQFHUQHG0DQDJHPHQWFRPPLWPHQWWRDGGUHVVVDIHW\FRQFHUQVDQGKD]DUGVLVFRPPXQLFDWHG RQDUHJXODUEDVLV0DQDJHPHQWHQFRXUDJHVDQGPRWLYDWHVHPSOR\HHVWRFRPPXQLFDWHRSHQO\ DXWKHQWLFDOO\DQGZLWKRXWFRQFHUQIRUUHSULVDOHQVXUHVHPSOR\HHVDUHDZDUHRI606SULQFLSOHV DQGXQGHUVWDQGWKHLUVDIHW\UHODWHGUROHVDQGUHVSRQVLELOLWLHVFRQYH\VVDIHW\FULWLFDOLQIRUPDWLRQ VXFKDVDFFLGHQWGDWDLQMXULHVDQGUHSRUWHGVDIHW\FRQFHUQVDQGKD]DUGVDQGWKHLUUHVROXWLRQVWR HPSOR\HHV6/27UDQVLW¶VWRROVWRVXSSRUWVDIHW\FRPPXQLFDWLRQLQFOXGH x6DIHW\EXOOHWLQV x6DIHW\QRWLFHV x3RVWHUV x&'VRU7KXPEGULYHVRURQOLQHVDIHW\YLGHRDFFHVV x1HZVOHWWHUV x%ULHILQJVRU7RROER[WDONV x6HPLQDUVDQGZRUNVKRSV x1HZHPSOR\HHWUDLQLQJDQGUHIUHVKHUWUDLQLQJ x,QWUDQHWRUVRFLDOPHGLD x0RQWKO\6DIHW\0HHWLQJV &RPSHWHQFLHVDQG7UDLQLQJ([HFXWLYH0DQDJHPHQWHQVXUHVWKDWDOOHPSOR\HHVDWWHQGWKH WUDLQLQJSURYLGHGWRXQGHUVWDQGWKHLUVSHFLILFUROHVDQGUHVSRQVLELOLWLHVIRUWKHLPSOHPHQWDWLRQRI 6066/27UDQVLWSURYLGHV606WUDLQLQJLQWKHIROORZLQJDUHDV  Packet Page 59 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  $OO(PSOR\HHV x8QGHUVWDQGLQJRI6DIHW\3HUIRUPDQFH7DUJHWV x8QGHUVWDQGLQJRIIXQGDPHQWDOSULQFLSOHVRI606 x8QGHUVWDQGLQJRI6DIHW\5HSRUWLQJ3URJUDP±5HSRUWLQJXQVDIHFRQGLWLRQVDQG KD]DUGVQHDUPLVVHV x8QGHUVWDQGLQJRIWKHLULQGLYLGXDOUROHVDQGUHVSRQVLELOLWLHVXQGHU606  0DQDJHUVDQG6XSHUYLVRUV x8QGHUVWDQGLQJRI6DIHW\5LVN0DQDJHPHQW x8QGHUVWDQGLQJRI6DIHW\$VVXUDQFH x8QGHUVWDQGLQJRI6DIHW\3URPRWLRQ x8QGHUVWDQGLQJRIWKHLULQGLYLGXDOUROHVDQGUHVSRQVLELOLWLHVIRU606  ([HFXWLYH0DQDJHPHQW x8QGHUVWDQGLQJRIPDQDJHPHQWFRPPLWPHQWWRDQGVXSSRUWRIDOO606DFWLYLWLHV  $OOHPSOR\HHVDUHUHTXLUHGWRDFTXLUHWKHFRPSHWHQFLHVDQGNQRZOHGJHIRUWKHFRQVLVWHQW DSSOLFDWLRQRIWKHLUVNLOOVDVWKH\UHODWHWRVDIHW\SHUIRUPDQFHREMHFWLYHV6/27UDQVLWGHGLFDWHV UHVRXUFHVWRFRQGXFWHIIHFWLYHVDIHW\UHODWHGVNLOOWUDLQLQJ7KHVFRSHRIWKHVDIHW\WUDLQLQJLV DSSURSULDWHWRHDFKHPSOR\HH¶VLQGLYLGXDOVDIHW\UHODWHGMREUHVSRQVLELOLWLHVDQGWKHLUUROHLQ 606&RPSRQHQWVRI6/27UDQVLW¶VVNLOOUHODWHGWUDLQLQJLQFOXGH x&RQGXFWLQJWUDLQLQJQHHGVDQDO\VHVWRHQVXUHWKDWWKHULJKWLQIRUPDWLRQLVEHLQJWDXJKWWR WKHULJKWHPSOR\HHVXVLQJWKHPRVWHIILFLHQWWUDLQLQJPHWKRGV x&RPPXQLFDWLQJSXUSRVHREMHFWLYHVDQGRXWFRPH x(QVXULQJUHOHYDQWFRQWHQWE\GLUHFWO\OLQNLQJWUDLQLQJWRWKHWUDLQHH¶VMREH[SHULHQFHVVR WUDLQHHVDUHPRUHPRWLYDWHGWROHDUQ x8VLQJDFWLYHKDQGVRQGHPRQVWUDWLRQVDQGSUDFWLFHWRGHPRQVWUDWHVNLOOVWKDWDUHEHLQJ WDXJKWDQGSURYLGHRSSRUWXQLWLHVIRUWUDLQHHVWRSUDFWLFHVNLOOV x3URYLGLQJUHJXODUIHHGEDFNGXULQJKDQGVRQSUDFWLFHDQGH[HUFLVHV x5HLQIRUFLQJWUDLQLQJFRQFHSWVLQWKHSRVWWUDLQLQJZRUNHQYLURQPHQWE\JLYLQJHPSOR\HHV RSSRUWXQLWLHVWRSHUIRUPZKDWWKH\¶YHOHDUQHG  Section 9 Documentation 3XUVXDQWWR&)53DUW6/27UDQVLWPDLQWDLQVUHFRUGVUHODWHGWRWKLV6DIHW\3ODQDQG 606LPSOHPHQWDWLRQIRUDPLQLPXPRIWKUHH\HDUV7KHVHGRFXPHQWVLQFOXGHEXWDUHQRWOLPLWHG WRWKHUHVXOWVIURP606SURFHVVHVDQGDFWLYLWLHV6/27UDQVLWZLOOPDNHWKHVHGRFXPHQWV DYDLODEOHWR)7$5HJLRQ&DOWUDQVDQGRWKHU)HGHUDODQGVWDWHDJHQFLHVXSRQUHTXHVW Packet Page 60 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Appendices $±&RXQFLO5HVROXWLRQ±6/27UDQVLW3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ 37$63  %±2UJDQL]DWLRQDO&KDUW )<  &±([DPSOHVRI6DIHW\(YHQW,QYHVWLJDWLRQ )LUVW7UDQVLW   Packet Page 61 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Appendix A – Board Approval – Signed Council Resolution 6LJQHG&RXQFLOUHVROXWLRQWREHLQFOXGHGIROORZLQJ%RDUGDSSURYDO Packet Page 62 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Appendix B - Organizational Chart FY 2020-21     ƉƉƌŽǀŝŶŐŽĂƌĚ ^ĂŶ>ƵŝƐKďŝƐƉŽŝƚLJ ŽƵŶĐŝů ĐĐŽƵŶƚĂďůĞdžĞĐƵƚŝǀĞ ŝƚLJdƌĂŶƐŝƚDĂŶĂŐĞƌ ŚŝĞĨ^ĂĨĞƚLJKĨĨŝĐĞƌ ŽŶƚƌĂĐƚŝŶŐ'ĞŶĞƌĂů DĂŶĂŐĞƌ <ĞLJ^ƚĂĨĨ ŽŶƚƌĂĐƚŝŶŐ^ĂĨĞƚLJ DĂŶĂŐĞƌ <ĞLJ^ƚĂĨĨ ŽŶƚƌĂĐƚŝŶŐKƉĞƌĂƚŝŽŶƐ DĂŶĂŐĞƌ <ĞLJ^ƚĂĨĨ ŽŶƚƌĂĐƚŝŶŐ DĂŝŶƚĞŶĂŶĐĞDĂŶĂŐĞƌ ^ƵƉƉŽƌƚŝŶŐZĞǀŝĞǁ dĞĂŵ ŝƚLJdƌĂŶƐŝƚŽŽƌĚŝŶĂƚŽƌ Packet Page 63 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  Appendix C – Examples of Safety Event Investigation (First Transit, Inc.) 5HSRUWRI8QXVXDO,QFLGHQW   Packet Page 64 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  1HDU0LVVDQG+D]DUG5HSRUW    Packet Page 65 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI  5RRW&DXVH$QDO\VLV   Packet Page 66 Item 6   3XEOLF7UDQVSRUWDWLRQ$JHQF\6DIHW\3ODQ5HJXODWLRQ &)53DUW   3DJHRI     Packet Page 67 Item 6 COVID-19 – Emergency Response and Enhanced Cleaning Protocol for SLO Transit The City of San Luis Obispo continues to provide fixed-route public transit (SLO Transit) to meet travel needs within our community. Many individuals depend on public transit for access to vital services including employment, medical care, and community services. SLO Transit has been taking preventative steps to provide healthy and safe public transit for all. In response to the California declared State of Emergency, the City began implementing emergency response plans as well as extra precautions as guided by the County of San Luis Obispo Public Health Department to reduce the spread of COVID-19. These precautions include a more stringent and regimented cleaning schedule and enhanced cleaning methods to keep buses disinfected and sanitized. Enhanced cleaning efforts include disinfecting vehicles every 24 hours and cleaning frequently touched surfaces during daily service. Additionally, the City implemented modified bus service, limite d passenger capacity, and reduced seating to help promote physical distancing on board. Service levels have been monitored and adjusted to meet service demand and promote passenger distancing. To help protect the health of fellow passengers and drivers, SLO Transit passengers are encouraged to use public transit for essential travel, wash hands regularly, and remain home or pursue alternatives to public transit if sick. In accordance with the California State mandat e, passengers are required to wear face coverings when waiting for or riding on the bus. SLO Transit will continue to implement these measures to maintain health and wellness within our community. SLO Transit is here for you now with essential trave l and we are here for you as our community is supporting one another on the road to recovery. Packet Page 68 Item 6 Precautionary Measures Face Coverings x Provided to operations team for employee PPE. Face coverings include N95 protective masks, single use face masks (3ply), and SLO Transit promotional masks. x Drivers wear face coverings while in service on buses as well as at the bus yard and public facilities. x June 2020 – Per the State mandate, passengers are required to w ear a face covering when waiting for or riding on public transportation. Face coverings help minimize the spread of COVID-19. Nitrile Gloves x Provided to operations team for employee PPE. Drivers wear nitrile gloves while in service. x Nitrile is a chemical resistant and puncture resistant material for protection against most chemicals and infectious agents. Infrared Thermometers x Provided to operations team for employee health screening. x Infrared thermometers allow temperature to be measured from a distance if needed. First Aid Medical Kits x Provided to operations team to address health and safety concerns as well as small incidents that can be managed outside of further overwhelming the medical system. x Nitrile gloves, alcohol wipes, skin cleansing wipes, and fever strips included. Driver Barriers x July 2020 – Protective plexiglass driver barriers installed on every vehicle to physically separate drivers from passengers. x Barriers provide added protection against airborne virus transmission. Hand Sanitizer x Sept 2014 – Two touch-free hand sanitizer dispensers installed on every vehicle, one toward front entrance and one toward the back exit. Dispensers initially installed near front door entrance in anticipation of the winter cold/flu season. x Sept 2019 – Program expanded to include dispensers near the rear door exit on every vehicle. x March 2020 – Three dispensers installed in various areas of bus yard facility. x Sanitizer solution is alcohol-based and contains 70% ethyl alcohol. Per the CDC, using a hand sanitizer with at least 60% alcohol can help you avoid getting sick and spreading germs to others by quickly reducing the number of microbes on your hands. Packet Page 69 Item 6 Limited Capacity x March 2020 – Passenger capacity reduced to 15 passengers to pro mote distancing and prevent overcrowding on buses. Standby drivers and chase vehicles available when capacity is reached. x April 2020 – Limited seating notices posted on seats in buses. Notices reduce seating by approximately 50 percent and serve as guidance for passengers to maintain distance (approximately two seats) from other passengers. x August 2020 – Summer service levels (“A” and “B” routes) implem ented. Passengers encouraged to ride “A” and “B” routes to reduce passenger capacity on individual buses. “Maintain Six Feet” Floor Decals for Distancing x June 2020 – “Maintain Six Feet” concrete floor decals applied at Transit Center and high ridership bus stops. Vinyl floor decals also applied on every fixed-route vehicle and at bus yard facility. Decals are reminders for passengers to maintain distance from other passengers. Digital Bus Passes x Digital bus passes available on the Token Transit mobile app. D igital bus passes help minimize cash handling and reduce passenger interaction. These passes allow passengers to manage bus passes easily from their mobile device. x July 2020 – Social media and physical ads released to encourage passengers to use digital bus passes. Public Engagement x March 2020 – CDC notices and public health guidance shared through social media, the website, and on buses x Late March 2020 – SLO Transit began a campaign of awareness through social media, the website, and the on-board infotainment system. Graphics displaying healthy guidelines such as using transit for essential travel only, washing hands, remaining home if sick, and encouraging face coverings and physical distancing were designed and posted. Riders were encouraged to follow guidelines while waiting for or riding on public transportation. x April 2020 – SLO Transit released posts highlighting the essent ial work of drivers and employees and reminding the community we are working together to maintain wellness on the bus. x June 2020 – SLO Transit created the “We Are Here for You” campaign reassuring the community that SLO Transit is taking extra precautions to maintain wellne ss on the bus. This campaign is aimed to capture the eye of our audience and reassure them that the wellness of riders and our community is our top priority. Photo and copy released in the June/July, Aug/Sept, and Oct/Nov edition of SLO LIFE magazine. Packet Page 70 Item 6 x Sept 2020 – SLO Transit developed “We Are Here for You” video spot for television and social media distribution. Video spot highlighted the cleaning procedures and steps SLO Transit is taking during this unprecedented time. Packet Page 71 Item 6 Enhanced Cleaning Products and Equipment UVC Surface Sterilizers (Qty 12) (Secured March 2020) x UVC sterilization for bus interior cleaning protocol to be used at bus yard facility. x Light wave: UV-C 253.7nm wavelength x UV intensity: 169 μW/cm² x More info here HEPA Air Purifiers (Qty 4) (Secured March 2020) x Air purification to enhance buses and bus yard facility x Medical Grade True HEPA filter (MERV17) tested to remove 99.99% of airborne particulates at 0.3 microns, 98.79% at 0.1 microns and 97.34% at 0.03 microns (30 nanometers). x More info here Cintas Signet Neutral Disinfectant (DS1) x Provided to drivers for cleaning and disinfecting interior surfaces x Meets the Environmental Protection Agency (EPA) criteria for use against SARS-CoV-2, the cause of COVID-19. x DS1 is a one-step disinfectant that is effective against a broad-spectrum of bacteria, is virucidal, and inhibits the growth of mold and mildew and their smells whe n used as directed. x Meets the OSHA Bloodborne Pathogen standard for decontamination of blood and bodily fluids and is bactericidal, virucidal, and fungicidal. x More info here Peroxigard Disinfectant Wipes x Provided to drivers for cleaning and disinfecting interior surfaces x Designed to meet each of the three levels defined in the EPA’s Emerging Viral Pathogen Guidance. x In cases of emerging viral pathogens like SARS-CoV-2, the virus that causes COVID-19, when there is no test that can be conducted to validate the efficacy of a disinfectant, the EPA utilizes Emerging Viral Pathogen Guidance to determine the expected efficacy of a disinfectant against an emerging virus. This guidance, used previously during the 2003 SARS epidemic, mandates that for disinfectant products to be approved, they must be an EPA registered Hospital or Broad- Spectrum disinfectant and have proven efficacy against two small, non-enveloped viruses, such as Poliovirus and Parvovirus. x More info here Packet Page 72 Item 6 Sani-Kleen Disinfectant Cleaner x Virucide, bactericide, disinfectant, germicidal cleaner, non-rinse sanitizer (D1) x More info here SaniDate All Purpose Disinfectant Cleaner x EPA-registered, antibacterial disinfectant, cleaner and deodorizer x More info here Ongoing Cleaning Products x Cintas Signet Neutral Disinfectant (DS1) x Road Away All Vehicle Wash Concentrate x Zep Concentrated Industrial Lemon Grass Deodorant x Lemon Clean Disinfectant Virucidal Cleaner x Clorox Bleach x Simple Green Industrial Cleaner and Degreaser x Misty Disinfectant Foam Cleaner x PineSol Disinfectant Cleaner x Magic Upholstery Cleaner and Protectant x Windex Window Cleaner Ongoing Cleaning Procedures Inside of buses cleaned and sanitized daily, process takes about 30 – 45 minutes per bus: x Sweep and mop the interior. Mop water changed for each bus. x Wipe down the seats with disinfectant x Wipe down all handrails with disinfectant. x Wipe down all surfaces with disinfectant. x Wipe down driver area, steering wheel, dash, and controls with disinfectant. x Clean windows and door with window cleaner. x Two UV lights placed in vehicle for 20 minutes x Peroxigard wipes and neutral disinfectant spray provided in each bus for drivers to wipe down interior surfaces. x Weekend detailer repeats and uses the vacuum on cloth seats and any dirt left behind from sweeping. Bus yard facility cleaned and sanitized every evening. Packet Page 73 Item 6 Response Timeline January 2020 x January 20 – First confirmed COVID-19 case in the United States x January 26 – First confirmed COVID-19 case in California February 2020 x Early February – City and First Transit begin meeting weekly to review emergency response plans and procedures x February 27 – SLO Transit established and implemented new COVID-19 policies and procedures to help reduce the spread. March 2020 x March 3 – SLO Transit orders personal protective equipment (PPE) and enhanced cleaning equipment for disinfection and sanitization. Includes N95 Protective Masks, Nitrile Gloves, First Aid Medical Kits, UVC Surface Sterilizers, HEPA Air Purifiers, and Infrared Thermometers. x March 4 – City verifies First Transit cleaning, disinfection, and sanitization solutions meets WHO and CDC guidance for COVID-19. x March 4 – Governor Newsom declares California State of Emergency x March 5 – SLO Transit enacts enhanced cleaning and disinfection requirements x March 11 – HEPA MERV-17 medical grade air purifiers delivered to bus yard facility x March 13 – N95 Protective Masks delivered to bus yard facility and available to employees. Face coverings optional provision for drivers and not yet a mandate. x March 13 – First Aid Medical Kits arrived and intended to addre ss small incidents that can be managed outside of further overwhelming the medical system x March 14 – First confirmed COVID-19 case in SLO County x March 17 – Press Release – City Takes Action to Implement Emergency Response Measures for SLO Transit x March 17 – SLO Transit encourages passengers to take essential trips only to promote social distancing, use onboard hand sanitizer when entering the bus, purchasing physical and digital bus passes to limit cash handling, and stay home if sick. x March 19 – SLO Transit implements weekend service levels (“A” routes only) 8am - 8pm and authorizes six standby drivers for emergency response. x March 23 – SLO Transit now fare-free to alleviate drivers from handling cash and bus passes. Passengers encouraged to enter and exit from the rear door, as they are able, to limit close contact with drivers. Packet Page 74 Item 6 x Late March – SLO Transit limits bus capacity to 15 passengers to promote distancing on board and prevent overcrowding. Standby drivers and chase vehicles available when capacity is reached. x Late March – SLO Transit shares CDC notices and public health guidance through social media, the website, and on buses. x Late March – SLO Transit begins public engagement campaign encouraging health and wellness on the bus. April 2020 x Early April – Limited seating notices posted on buses. x Mid-April – SLO Transit releases public engagement content highlighting essential work of drivers and employees. x Mid-April – SLO Transit posts notices on buses stating “SLO Transit strongly encourages face coverings while on the bus.” x April 14 – UVC Surface Sterilizers delivered to bus yard facility and implemented in evening cleaning protocol. Two units provided to San Luis Obispo Regional Transit Authority (RTA). May 2020 x May 27 – SLO Transit orders “Maintain Six Feet” floor decals to encourage passenger distancing on buses and at high ridership bus stops. June 2020 x Early June – SLO Transit releases the “We Are Here for You” public engagement campaign reassuring the community that SLO Transit is taking extra precautions to maintain wellness on the bus. x June 11 – SLO Transit orders protective plexiglass driver barriers. x June 11 – “Maintain Six Feet” concrete floor decals applied at Transit Center and high ridership bus stops. x June 12 – “Maintain Six Feet” vinyl floor decals applied on buses. x June 18 – Governor Newsom issues State mandate requiring the use of face coverings in high- risk settings. This includes waiting for or riding on public transportation. Per State issued guidance, SLO Transit now requires all riders to wear face cove rings while on the bus and waiting at stops, unless a medical condition prevents them from doing so. x Mid-June – SLO Transit posts new face covering notices in buses stating “The State of California now requires the use of face coverings in high-risk settings. This includes when waiting for or riding on public transportation. Certain people are exempt from wearing a face covering under specific circumstances.” Packet Page 75 Item 6 July 2020 x July 1 – SLO Transit reinstates full-fare. Digital bus passes are encouraged to limit cash handling. x July 22 – SLO Transit begins installing plexiglass driver barriers. August 2020 x August 3 – SLO Transit implements summer service levels (“A” an d “B” routes) 6am - 8pm. Passengers encouraged to ride “A” and “B” routes to reduce passenger capacity on individual buses. September 2020 x Early Sept – SLO Transit secures promotional masks and distributes to drivers and passengers. x Sept 12 – SLO Transit airs “We Are Here for You” commercial on TV and social media. Further x Daily/ongoing – City and Local First Management hold a call on transit related issues x Daily/ongoing – Industry periodicals and best practices shared with First Transit x Daily/ongoing – Communication shared between transit partners; SLOCOG, Cal Poly, and RTA x Daily/ongoing – First Transit briefings and updates from Corporate Safety and our regional VP’s x As needed – City staff holds phone conversations with First Transit Corporate Packet Page 76 Item 6 Department Name: Transit Cost Center:5201 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Matt Horn, Public Works Director Prepared By:Gamaliel Anguiano, Transit Manager SUBJECT:AUTHORIZATION TO ENTER INTO A CONTRACT WITH PG&E TO PARTICIPATE IN THE ELECTRIC VEHICLE FLEET PROGRAM RECOMMENDATION Authorize the City Manager to execute an agreement, once provided by PG&E, to participate in the PG&E Electric Vehicle (EV) Fleet Program. DISCUSSION Senate Bill 350 directs the California Public Utilities Commission (CPUC) to address the single largest emitting sector in the state's greenhouse gas (GHG) emissions inventory: transportation. Specifically, the law declares that meeting the state's 2030 and 2050 GHG reduction goals will require widespread transportation electrification. The law solidifies the role of utilities in supporting transit electrification. PG&E has demonstrated its commitment to accelerating widespread transit electrification and supporting customer adoption of clean-fuel vehicles across all sectors and communities by introducing its EV Fleet Program. The program supports on-road and off-road medium and heavy-duty vehicles including support for public transit buses. By 2024, PG&E’s EV Fleet Program goal is to help 700+ organizations convert to electric vehicles in their fleet operations. The PG&E EV Fleet Program is funded through customer rates. In compliance with CPUC requirements, participation in the PG&E EV Fleet Program requires a purchase order for a minimum of two medium or heavy-duty electric vehicles. The EV Fleet customers maintain the current business rate plans until their new Commercial EV Rate proposal is approved by the CPUC. To participate in PG&E’s EV Fleet Program, agencies must apply and be selected by PG&E. The City has applied and been selected by PG&E to participate in the EV Fleet Program. PG&E’s has already once before identified the City of San Luis Obispo’s bus yard electric fleet infrastructure upgrade as a viable project, in early 2020. An invitation for the City to join the EV Fleet Program and a draft agreement for participation in the Program was extended to the City, included in Attachment A. Packet Page 77 Item 7 However, due to the need of addressing possible fleet expansion and solar arrays at the bus yard, the City has sent PG&E revised locations for EV chargers. The City has received notice from PG&E that a revised contract based on these new locations will likely be made available in late November. The revised contract is anticipated to be similar to the one previously offered and attached with the exception to site locations for the charger units. Staff is asking Council that based on the general similarities between the previously offered and attached contract with the pending contract, to authorize the City Manager to enter into the agreement if after evaluation it so deemed advantageous for the City. Previous Council or Advisory Body Action On July 7, 2020, City Council approved the purchase of two electric transit buses, qualifying the City to apply and participate in the PG&E EV Fleet Program. Policy Context Per City’s Financial Management Policy all contracts of this nature must receive Council approval. Participation in the PG&E EV Fleet Program is consistent with the Council’s adopted sustainability goals of community carbon neutrality by 2035 and municipal operations carbon neutrality by 2030. Additionally, participation in the program implements Climate Action Plan Action Connected 4.1 (Develop a Transit Electronation Strategic Plan and Begin Implementing in 2020). Public Engagement No public outreach was conducted in support of this agreement as this is considered an administrative item. However, extensive outreach was conducted as part of the Climate Action Plan process, which identified rapid implementation of an electric transit fleet as a foundational action for achieving the community’s sustainability goals. CONCURRENCE The Office of Sustainability concurs with the recommendations of this report. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: N/A Budget Year: N/A Funding Identified: N/A Packet Page 78 Item 7 Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund N/A State 0 Federal 0 Fees 0 Other:0 Total 0 0 0 There is no cost to the City to participate in PG&E’s EV Fleet program. Participation in the PG&E EV Fleet program provides 100% the towards the City upgraded infrastructure to support the City’s future EV transit fleet.Any work that may incidentally lay outside of the project can be covered by a $180,000 previously awarded Air Pollution Control District grant made to the City to support electric vehicle infrastructure needs. ALTERNATIVES Deny participation in PG&E’s EV Fleet Program.The City Council could choose to deny participation in PG&E EV Fleet program. Staff does not recommend this action as two EV transit buses have been purchased and this action will provide the necessary charging infrastructure to support the new buses. Attachments: a - PG&E invitation to join the EV Fleet Program and Contract No. FLEET000905190 Packet Page 79 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 1 of 15 Contract version revised 8.7.19 September 30, 2019 City of San Luis Obispo (SLO) 29 Prado Road San Luis Obispo, CA 93401 RE: FLEET000905190 Dear Gamaliel Anguiano, Congratulations! We are pleased to extend City of San Luis Obispo (SLO) an invitation to join PG&E’s EV Fleet Electrification program. Upon your completion of the action items below, we will move your project into the design phase and begin the engineering, design and construction plans for 29 Prado Road, San Luis Obispo, CA 93401. Please note, future changes to the project scope may change your eligibility for the program. Included in this contract are the following items: x Offer description o Rebate and/or incentive description o Preliminary design x EV Fleet Program Terms and Conditions (“Contract”) Immediate action items: x Sign and return Contract x Provide purchase order (as defined, below) for vehicles By signing this Contract, I hereby confirm my participation in PG&E’s Fleet Electrification program and acknowledge that: x I agree to the minimum number of charging ports and charger location specified in the attached preliminary design; x Upon execution of this Contract, PG&E will begin incurring design fees and costs as my project moves forward; x If I withdraw from the program prior to the site being activated, then PG&E reserves the right to recover all fees and costs incurred by it and its subcontractors after the execution of this Contract including, but not limited to, design cost, site walk costs, etc.; x PG&E will conduct a comprehensive design site walk; x If the existing infrastructure or physical site or equipment is substantially different than anticipated or described, then PG&E will make reasonable effort to redesign the project in a manner acceptable to both parties, but reserves the right to cancel my participation in the program; x If I do not submit required documentation (signed easement; etc.) in a timely manner, then PG&E may grant extensions by request but reserves the right to waitlist my application and/or cancel my participation in the program; and x My EV Charger meets the Safety Checklist requirements and has networking protocols. I agree to ensure that EVSE network connectivity is in good condition for least five years from the date of activation. Packet Page 80 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 2 of 15 Contract version revised 8.7.19 Offer Description After careful consideration of the project costs and scope of work, PG&E has determined you are eligible for the Make-Ready Incentive option. PG&E will design, construct, own and maintain EV supply infrastructure to the meter only. City of San Luis Obispo (SLO) will design, build, own, operate, and maintain the behind the meter make-ready infrastructure, hereafter referred to as customer-owned make-ready infrastructure. PG&E provides an incentive that is equal to the lesser amount of either 80% of the customer-owned make-ready infrastructure costs or the incentive cap, as described below, on a per vehicle basis. Along with the make-ready incentive option, you are eligible for a rebate of up to $180,000. Below is a summary of the qualified allowance under the make-ready incentive: EV Supply Infrastructure Incentive Applies to Site Hosts who pay for, own, and maintain EV Supply Infrastructure. Vehicle type Incentive # of vehicles Transit bus or Class 8 vehicle $9k per vehicle 20 Transit Buses (Public Use) Vehicle type (Total) Incentive (Total) Total Lesser amount of either 80% of the customer-owned make-ready infrastructure costs or the incentive cap, as described above, on a per vehicle basis 20 Transit Buses (Public Use) x $9,000 per vehicle = $180,000 Please note, in all instances, you will be responsible for procuring and installing all charging stations. PG&E will not own and maintain any facilities installed by the customer and those facilities will be the responsibility of the customer. OR PG&E Ownership option. PG&E will design, construct, own and maintain EV infrastructure including all work to the base of the chargers. EV Charger Rebate You also qualify for a rebate of up to $264,000 capped at 50% of the purchase cost, for qualified EV Supply Equipment (EVSE or “EV Charger”) for your fleet. EVSE rebate Applies to transit buses, school buses, or Premises in a Disadvantaged Community. Power output Rebate # of EVSE Up to 50 kW 50% of the cost of EVSE, up to $15,000 per EVSE 12 Chargers 150 kW and above 50% of the cost of EVSE, up to $42,000 per EVSE 2 Chargers Power output (Total) Rebate (Total) Max Allowance (Total) Up to 50kW 50% of cost, up to allowance 12 Chargers x $15,000 = $180,000 150 kW and above 50% of cost, up to allowance 2 Chargers x $42,000 = $84,000 Packet Page 81 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 3 of 15 Contract version revised 8.7.19 *As a reminder, to participate in the EV Fleet program, your EV Charger at a minimum must meet our Safety Checklist requirements. In addition, to qualify for the above rebate, the EV Charger must at least meet the following network communications requirements: x Electric Vehicle Supply Equipment (EVSE) SHALL have metering capability through an internal device and SHALL be able to measure power and usage parameters to enable reporting of the metrics in the Contractor Requirement section. x After loss of power, provided the EVSE connector to vehicle has not been removed, the EVSE SHALL return to its post-configuration state (i.e., SHALL persist communication and registration configurations. This does not include continuing user sessions when authorization is required to start a session). x EVSE SHALL provide a reset option, which returns the device to its pre-charge state (e.g., card or message- not user accessible). Preliminary Design Next Step: Please note that you will need to provide a purchase order (PO) for a minimum of 2 vehicles for the Contract to be counter-signed by PG&E. A PO is any documentation of clear intent to procure and deploy vehicles, e.g. Packet Page 82 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 4 of 15 Contract version revised 8.7.19 budget approval, grant agreement, request for proposal results, governance-body mandated procurement and deployment etc., in lieu of an actual purchase order provided by a seller. We respectfully request that you return your signed contract as soon as possible. After we receive your signed contract, I will introduce you to your Project Manager, who will lead you through the design and construction process for your site. Thank you for your participation in this exciting program! You’re taking an important step to support California’s ambitious climate and air quality goals, and we appreciate that you’ve elected to work with PG&E to electrify your fleet. Please contact me if you have any questions. Regards, Dean Dean Kunesh | Electric Vehicle Onboarding Pacific Gas and Electric Company 415.238.9934 cell | Dean.Kunesh@pge.com Packet Page 83 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 5 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company EV Fleet Program Terms and Conditions (“Contract”) Definitions As used in this Contract, the following terms have the following meanings: Disadvantaged Community: Census tracts in PG&E’s service territory with a top quartile score according to California Environmental Protection Agency’s CalEnviroScreen 3.0, or current version. EV Service Connection: Traditional utility infrastructure from the utility distribution system to the meter, which may include but is not limited to cable, conductors, conduit, transformers and associated substructures from the utility distribution system. Also referred to as “To The Meter” (TTM) infrastructure. EV Supply Infrastructure: Infrastructure from the meter (“but not including the meter”) to the parking space, this may include an electrical panel, cable and conduit necessary to deliver power to the parking space. Also referred to as “Behind The Meter” (BTM) infrastructure. Electric Vehicle Supply Equipment (EVSE): Equipment used for charging EVs. The conductors, including the ungrounded, grounded, and equipment grounding conductors, the electric vehicle chargers, connectors, attachment plugs, and all other fittings, devices, power outlets, or apparatuses installed specifically for the purpose of delivering energy from the Premises wiring to the electric vehicle. EVSE Package: EVSE hardware, software, and network services. EV Service Provider (EVSP): A company that provides EV charging solutions to Site Host, including but not limited to network services, billing, and customer support. Operation and Maintenance (O&M): O&M includes, but is not limited to, network fees, resetting of breakers, replacement of parts, and associated services necessary to keep the EVSE and/or EV Supply Infrastructure operational. Premises: Premises includes all of the real property and apparatus employed in a single enterprise on an integral parcel of land undivided, excepting in the case of industrial, agricultural, oil field, resort enterprises, and public or quasi-public institutions, by a dedicated street, highway or public thoroughfare or railway. Automobile parking lots constituting a part of and adjacent to a single enterprise may be separated by an alley from the remainder of the Premises served. All Premises must be reviewed by PG&E to determine where service could be provided and at what cost. PG&E may agree to include some or all of the Premises in the EV Fleet Program. Multiple Premises may be listed in Exhibit A. Rate Plan: The PG&E electric rate that Site Host pays for using EVSE. Detail on PG&E rates and eligibility criteria can be found at www.pge.com/tariffs. Site Host: The entity participating in the EV Fleet Program that owns, leases or manages the Premises where the EVSE Packages are installed. The Site Host is also the customer of record for PG&E. Site Host will receive the bill for the energy delivered to the EVSE Package. Packet Page 84 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 6 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company Specific Terms Acknowledgement and Term: All parties agree to abide by the terms and conditions of this Contract for participation in the EV Fleet Program (part of California Public Utilities Commission, or “CPUC”, Decision Number 18-05-040 issued May 31, 2018), including all requirements included by reference. The duration of this Contract (the “Term”) will commence on the date Site Host’s EVSE Package becomes operational and will continue in effect for ten (10) years thereafter (unless otherwise earlier terminated pursuant to the terms herein). PG&E will inform Site Host in writing when the EVSE Package becomes operational. Ownership: Site Host has two options for ownership of EV Supply Infrastructure. Ownership of other components is listed below for reference. Sections in this Contract labeled “Site Host Owned EV Supply Infrastructure” or “PG&E Owned EV Supply Infrastructure” will apply depending on the ownership option a Site Host selects. Site Host should indicate their ownership option in Exhibit A. All other terms are common to both ownership options. EV Service Connection: PG&E always constructs, owns, operates, and maintains the EV Service Connection. EV Supply Infrastructure: Site Host has two options for EV Supply Infrastructure ownership; 1. PG&E owned: PG&E constructs, owns and maintains the EV Supply Infrastructure. PG&E covers costs in accordance with CPUC requirements. 2. Site Host owned: Site Host is responsible for construction and maintenance of EV Supply Infrastructure, and receives an incentive in accordance with CPUC requirements. EV Supply Equipment (EVSE): Site Host always installs, owns, operates, and maintains the EVSE. Selection of EVSE Package: Upon approval of application by PG&E, Site Host shall select and procure one EVSE Package from the PG&E approved list of qualified vendors. PG&E will share qualified vendor list with Site Host. Site Host shall install, operate and maintain the number and type of the EVSE Package, associated equipment and signage as selected by Site Host and approved by PG&E. Site Host acknowledges that PG&E makes no representations regarding manufacturers, dealers, contractors, materials or workmanship of the EVSE Package. Site Host agrees that PG&E has no liability whatsoever concerning the quality and safety of such EVSE Package. At PG&E sole discretion, Site Host may use an EVSE Package that is not on the approved list of qualified vendors. If EVSE Package is not on the approved list of qualified vendors, EVSE Package must be compliant with minimum requirements. These minimum requirements are attached to this Contract, as applicable. Site Host agrees to provide all information requested by PG&E about non-approved EVSE Packages, including but not limited to technical and safety specifications. EVSE Rebate: Site Host may qualify for a rebate of EVSE, in accordance with the CPUC requirements. Rebate amounts will vary in accordance with the CPUC requirements. Rebates will be paid after (1) Site Host provides proof of purchase of EVSE Package, (2) at PG&E discretion PG&E inspects the installation of the EVSE and the physical location, and (3) Packet Page 85 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 7 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company the EVSE is operational. Additional Services from EVSP: Separate and apart from the application and PG&E’s obligations under the EV Fleet Program, the EVSP selected by Site Host may offer and contract directly with the Site Host to provide any additional or complementary services, as long as these services do not interfere with the objectives of the EV Fleet Program as fully described in the CPUC decision. The costs of additional EVSP services, and any cost related to O&M of any additional EVSP services, will not be borne by PG&E, unless they are complementary services necessary to support the EV Fleet Program objectives and are approved by PG&E in writing. EV Drivers Right to Access: Site Host shall not restrict access to or use of the EVSE for reasons including, but not limited to, race, color, religion, age, sex, national origin, ancestry, physical or mental disability, or any basis prohibited by applicable law. However, Site Host may decide to make the EVSE available only to its employees or tenants; under the terms of the EV Fleet Program, Site Host decides whether to make the EVSE available to other 3rd parties. Accessibility Requirements: The installation of the EVSE and EV Service Connection is required to comply with the Americans with Disabilities Act (ADA) and California Building Standards. Site Host understands and accepts that such standards may impact parking layouts and reduce the number of non-accessible parking spaces available. Site Host understands and accepts that changes to initial design representations may occur during the design, construction and operational phases of the EVSE as may be dictated by design constraints, by law or regulation or by local jurisdictional authorities. Easement Requirement: An easement may be required to maintain PG&E owned facilities. PG&E will use existing easements when possible to minimize encumbrances on Site Host property. If a new easement is required, access rights will follow standard utility requirements for providing electrical service. PG&E will determine if a new easement is required when Site Host application is evaluated, and will communicate that to Site Host. If Site Host does not wish to grant an easement for one or more Premises, Site Host or PG&E may remove those Premises from the EV Fleet program. If Site Host accepts easement requirement, Site Host agrees to grant PG&E an easement for the installation of EV Service Connection and EV Supply Infrastructure. If the EV Service Connection must cross property owned by a third party to serve Site Host, PG&E may, at its option, install such EV Service Connection after appropriate rights of way or easements, satisfactory to PG&E, are obtained without cost to PG&E. Site Host agrees to sign and return easement to PG&E within 30 days of receipt. If the Site Host does not respond within 30 days, PG&E reserves the right to rescind Site Host’s participation in the EV Fleet Program. Upon termination of the Contract, PG&E shall upon written demand therefor execute and deliver to Site Host a good and sufficient quitclaim of said easement and right of way or such portion thereof conveyed in this document, at Site Host expense. EVSE O&M: The Site Host is required to maintain the EVSE for the Term. Site Host will pay all O&M costs associated with the EVSE. Site Host shall maintain a consistent uptime at the direction of PG&E for EVSE installed. Site Host shall maintain the common area improvements immediately surrounding the EVSE in good condition, ordinary wear and tear excepted, and will promptly notify PG&E of any problems it is aware of related to the EVSE. Such maintenance by Site Host of the immediately surrounding common areas shall include, but not be limited to, pavement maintenance and snow removal services, if applicable. Uninterrupted service is not guaranteed, and PG&E may interrupt service when necessary to ensure safety or to perform maintenance on PG&E owned infrastructure. PG&E will use reasonable efforts to notify Site Host in advance of interruptions to service, planned maintenance, and physical access to Premises. Site Host will immediately shut down chargers if there is a safety issue. Billing: Site Host will be the PG&E customer of record and will be served according to the applicable Rate Plan. As the customer of record, Site Host will be responsible for paying the PG&E bill. Compensation: Under no conditions shall Site Host or EV Drivers receive compensation of any kind (including but not limited to: cash, in-kind services, or otherwise) for any duties or requirements provided for in this Contract or for participation in any way as part of the EV Fleet Program, including but not limited to: easements, use of data for lawful purposes, loss of business activity during construction or maintenance activities, or any other inconvenience or loss, without limitation, related to participation. Packet Page 86 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 8 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company Changing Rate Plan: Site Host may change Rate Plan during the Term, but must remain on a retail PG&E rate for the duration of the Term. If Site Host switches to a non-retail PG&E rate during the Term, Site Host shall bear the full cost and sole expense, as circumstances may dictate, for losses incurred by PG&E on behalf of ratepayers, such as pro- rated costs of equipment, site design and installation. Reliability: PG&E does not guarantee uninterrupted service. Site Host may pursue options to ensure that any impact to Site Host operations from potential loss of power is sufficiently mitigated. Site Host is responsible for the cost of any supplemental solutions to improve reliability. Expansion of EVSE Installation: Site Host may add more charging ports to their installation in the future, in accordance with the provisions of CPUC filed tariffs such as Electric Rule 16. Site Host must coordinate with PG&E prior to any approved installation extension. Any installations or related work performed outside of EV Fleet program will be at Site Host’s expense and its liability. EVSE Replacement: Site Host may replace their EVSE during the Term. Site Host must notify PG&E ahead of replacement to ensure infrastructure can accommodate the additional load and new EVSE complies with necessary CPUC requirements for program. If adequate infrastructure does not exist, Site Host must request increased capacity in accordance with the provisions of CPUC filed tariffs such as Electric Rule 16. Any replacements will be at Site Host’s expense and its liability. Vehicle Purchase Plans: PG&E will work with Site Host to understand its fleet electrification plans, and may install infrastructure to support future vehicle purchases. In Exhibit A, Site Host will provide the number, type, and charging levels of electric vehicles that will be used at the Premises over time to justify the requested infrastructure. At PG&E discretion, during the Term PG&E may request evidence that Site Host is operating these vehicles and associated charging in accordance with its plan. If Site Host is not operating vehicles consistent with its plan, at PG&E discretion Site Host may be responsible for PG&E costs associated with installing the excess infrastructure. This includes costs, as circumstances may dictate, for losses incurred by PG&E on behalf of ratepayers, such as costs of equipment, site design and installation. Site Host may, at any time within the Term request from PG&E projected and final costs associated with this. If Site Host wishes to change its plan, Site Host must provide a modified plan to PG&E. This modified plan must be mutually agreed upon by PG&E and Site Host. Project Scope: Site Host acknowledges that: x Site Host agrees to the high-level project scope listed in Exhibit A; x Upon execution of this Contract, PG&E will begin incurring design fees and costs as Site Host project moves forward; x If Site Host withdraws from the program, then PG&E reserves the right to recover all fees and costs incurred by it and its subcontractors after the execution of this Contract including, but not limited to, design cost, site walk costs, etc.; x PG&E will conduct a site walk; x If the existing infrastructure or physical site or equipment is substantially different than anticipated or described, then PG&E will make reasonable effort to redesign the project in a manner acceptable to both parties, but reserves the right to cancel Site Host participation in the program; and x If Site Host does not submit required documentation (e.g., signed easement if needed) in a timely manner, then PG&E may grant extensions by request but reserves the right to waitlist Site Host application and/or cancel participation in the program. External Funding Sources: Site Host understands that the total infrastructure and EVSE rebate and incentive amounts the Site Host receives from all sources, which may include but is not limited to, utilities, state programs, manufacturer, retailer or otherwise, cannot exceed Site Host’s total cost of purchasing the EVSE, installing the EVSE, and constructing the EV Supply Infrastructure. Site Host agrees to keep records of all infrastructure and EVSE incentives and rebates received for Site Host’s EV Fleet project. Site Host understands that PG&E may request and review said records up to one year after project completion date. If rebates and incentives received exceed incurred project cost, PG&E may inform all other funding sources, which Packet Page 87 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 9 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company may include but is not limited to, utilities, state programs, manufacturer, retailer or other, of the violation, including the name of the Site Host, a description of the project, and details regarding the excessive rebates and incentives. Site Host Owned EV Supply Infrastructure Section EV Supply Infrastructure Incentive: Site Host qualifies for an incentive towards the cost of EV Supply Infrastructure if they choose to own and maintain the EV Supply Infrastructure. Incentive amounts will vary in accordance with the CPUC requirements. Incentive will be paid after (1) Site Host provides proof of actual EV Supply Infrastructure construction cost, (2) EV Supply Infrastructure construction is complete, (3) the EVSE is operational. Installation of EV Service Connection: PG&E and/or its contractors shall design and construct the EV Service Connection in compliance with the terms of this Contract, as well as all applicable local, state and federal laws and regulatory requirements. Site Host is responsible for providing all disclosures, including but not limited to hazardous materials, located at the site of the installation. If an easement is required, PG&E will provide a preliminary layout of proposed facilities to Site Host prior to preparation of easement for Site Host review and approval; such approval will not unreasonably be withheld. The easement will be executed and recorded in favor of PG&E so that PG&E may access the EV Service Connection as needed. It will be the Site Host’s responsibility to provide a preliminary design of the EV Supply Infrastructure and associated electrical loads, so that PG&E can provide the associated EV Service Connection design. PG&E and Site Host will approve final design prior to construction beginning. Once design is approved, no material changes will be made without approval from PG&E and Site Host. After the EVSE is operational, Site Host may request a copy of “as built” designs, which will be provided by PG&E. Installation of EV Supply Infrastructure: The Site Host and/or its contractors shall construct the EV Supply Infrastructure and EVSE, in compliance with the terms of this Contract, as well as all applicable local, state and federal laws and regulatory requirements; including PG&E requirements found at www.pge.com/greenbook. The Site Host is responsible for (i) the costs to construct the EV Supply Infrastructure, (ii) the purchase of the EVSE Package, and (iii) installation of the EVSE. After the EVSE is operational, Site Host receives incentive for EV Supply Infrastructure in accordance with terms of this Contract. EV Supply Infrastructure O&M: If Site Host owns the EV Supply Infrastructure, Site Host is responsible for O&M of the EV Supply Infrastructure for the Term. Site Host will pay all O&M costs associated with the EV Supply Infrastructure. Site Host shall maintain the common area improvements immediately surrounding the EV Supply Infrastructure in good condition, ordinary wear and tear excepted, and will promptly notify PG&E of any problems it is aware of related to the EV Supply Infrastructure. Such maintenance by Site Host of the immediately surrounding common areas shall include, but not be limited to, pavement maintenance and snow removal services, if applicable. Uninterrupted service is not guaranteed, and PG&E may interrupt service when necessary to ensure safety or to perform maintenance. PG&E will use reasonable efforts to notify Site Host in advance of interruptions to service, planned maintenance, and physical access to Premises. Access to Site Host’s Premises: PG&E shall at all times have the right to enter and leave the Site Host’s Premises for any purpose connected with the furnishing of electric service to the EV Service Connection (meter reading, inspection, testing, routine repairs, replacement, maintenance, vegetation management, emergency work, etc.) and the exercise of any and all rights secured to it by law, or under PG&E's applicable tariff schedules. If Site Host does not grant PG&E reasonable access to the Premises, then PG&E may deenergize the EV Service Connection until access is granted. PG&E will work closely with Site Host to ensure this access does not unreasonably interfere with Site Host’s property or operations. End of Term: At the end of the Term, the Site Host will have the following options; 1. Continue operating EVSE and EV Supply Infrastructure o Site Host has continued responsibility for O&M of EVSE and EV Supply Infrastructure. o If an easement was required for installation, easement remains in place. o PG&E continues to own EV Service Connection and will treat this under the standard provisions of CPUC filed tariffs such as Electric Rule 16. 2. Stop operating EVSE and EV Supply Infrastructure Packet Page 88 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 10 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company o Remove the EVSE and/or EV Supply Infrastructure at Site Host’s cost and expense. o If an easement was required for installation, PG&E will deliver a quitclaim for the easement and the easement will be removed. o PG&E will require access to any energized PG&E facilities. If EV Service Connection serves other load or assets, for example building load or solar, PG&E continues to own EV Service Connection and will treat this under the standard provisions of CPUC filed tariffs such as Electric Rule 16. If EV Service Connection serves only the EVSE installed under this Contract, PG&E will deenergize EV Service Connection and abandon facilities in place. PG&E Owned EV Supply Infrastructure Section Installation of Equipment: PG&E and/or its contractors shall design and construct the EV Service Connection and EV Supply Infrastructure in compliance with the terms of this Contract, as well as all applicable local, state and federal laws and regulatory requirements. Site Host is responsible for providing all disclosures, including but not limited to hazardous materials, located at the site of the installation. If an easement is required, PG&E will provide a preliminary layout of proposed facilities to Site Host prior to preparation of easement for Site Host review and approval; such approval will not unreasonably be withheld. The easement will be executed and recorded in favor of PG&E so that PG&E may access the EV Service Connection and EV Supply Infrastructure as needed. After Site Host approval of the preliminary design, PG&E will coordinate with the Site Host if there are any proposed material changes. A final design with no material changes from the agreed upon design, will be provided by PG&E prior to any installation activities. PG&E and Site Host will approve final design prior to construction beginning. Once design is approved, no material changes will be made without approval from PG&E and Site Host. An estimated installation schedule shall be provided by PG&E after execution of required easement and timely selection of EVSE Package. Should the installation schedule require modification, PG&E shall notify Site Host within a reasonable amount of time of such changes. PG&E is responsible for the costs to construct the EV Supply Infrastructure. The Site Host is responsible for (i) the purchase of the EVSE Package and (ii) installation of the EVSE. Upon completion of installation of the EVSE, the Site Host understands and acknowledges that it will be responsible for the O&M of the EVSE installed through the EV Fleet Program. After the EVSE is operational, Site Host may request a copy of “as built” designs, which will be provided by PG&E. EV Supply Infrastructure O&M: If PG&E owns the EV Supply Infrastructure, PG&E is responsible for O&M of the EV Supply Infrastructure for the Term. PG&E will pay all O&M costs associated with the EV Supply Infrastructure. Site Host shall maintain the common area improvements immediately surrounding the EV Supply Infrastructure in good condition, ordinary wear and tear excepted, and will promptly notify PG&E of any problems it is aware of related to the EV Supply Infrastructure. Such maintenance by Site Host of the immediately surrounding common areas shall include, but not be limited to, pavement maintenance and snow removal services, if applicable. Uninterrupted service is not guaranteed, and PG&E may interrupt service when necessary to ensure safety or to perform maintenance. PG&E will use reasonable efforts to notify Site Host in advance of interruptions to service, planned maintenance, and physical access to Premises. Access to Site Host’s Premises: PG&E shall at all times have the right to enter and leave the Site Host’s Premises for any purpose connected with the furnishing of electric service to the EV Supply Infrastructure and EV Service Connection (meter reading, inspection, testing, routine repairs, replacement, maintenance, vegetation management, emergency work, etc.) and the exercise of any and all rights secured to it by law, or under PG&E's applicable tariff schedules. If Site Host does not grant PG&E reasonable access to the Premises, then PG&E may deenergize the EV Supply Infrastructure or EV Service Connection until access is granted. PG&E will work closely with Site Host to ensure this access does not unreasonably interfere with Site Host’s property or operations. End of Term: At the end of the Term, the Site Host will have the following options; 1. Continue operating EVSE o Site Host has continued responsibility for O&M of EVSE. o If an easement was required for installation, easement remains in place. Packet Page 89 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 11 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company o PG&E continues to own EV Service Connection and EV Supply Infrastructure, and will treat these under the standard provisions of CPUC filed tariffs such as Electric Rule 16. 2. Stop operating EVSE o Remove the EVSE at Site Host’s cost and expense o If an easement was required for installation, PG&E will deliver a quitclaim for the easement and the easement will be removed. o PG&E will require access to any energized PG&E facilities. If EV Service Connection and/or EV Supply Infrastructure serves other load or assets, for example solar, PG&E continues to own EV Service Connection and/or EV Supply Infrastructure and will treat these under the standard provisions of CPUC filed tariffs such as Electric Rule 16. If EV Service Connection and/or EV Supply Infrastructure serves only the EVSE installed under this Contract, PG&E will deenergize EV Service Connection and EV Supply Infrastructure and abandon facilities in place. General Terms Permission to Use Data: Site Host agrees to allow PG&E, its agents and representatives to use data gathered as part of the EV Fleet Program for use in regulatory reporting, ordinary business use, industry forums, case studies or other similar activities, in accordance with applicable laws and regulations. Representations: Site Host understands that its participation in EV Fleet Program shall not be construed as creating any agency, partnership, or other form of joint enterprise between the Site Host, PG&E, or their affiliates, contractors, vendors, representatives or designees nor create any obligations or responsibilities on their behalf except as may be expressly granted in writing, nor make any representations of any kind to this effect. Site Host represents and warrants that it is either (i) the fee title owner and has the ability to grant an easement (if required), or (ii) it is the authorized manager of the proposed EV Fleet Program site working with the fee title owner, it has the power, authority and capacity to bind itself to undertake the EV Fleet Program terms and conditions and to perform each and every obligation required of Site Host, and such fee title owner has the ability to grant an easement (if needed). Changes: PG&E may initiate changes to the EV Fleet Program as necessary to comply with CPUC directives. PG&E shall endeavor to provide Site Host with advance notice of any such changes. Site Host has the option to opt out of the Program subject to section “Site Host Removal or Termination” below. Compliance with Laws: All parties shall comply with all applicable federal, state, and local statutes, rules, regulations, laws, orders and decisions that relate to or govern its participation in the EV Fleet Program and/or Site Host’s interactions with customers in connection with the EV Fleet Program. Failure to Comply with Terms and Conditions: Without limitation, and to the greatest extent allowed by law, PG&E and Site Host reserve the right to seek damages and recovery for losses incurred due to any breach of this Contract on the part of Site Host or PG&E, whether intentional or unintentional. Relocations: Should Site Host request relocation of EVSE or parts thereof, such relocation shall be per mutually agreeable terms and shall be at sole expense of Site Host and in accordance with any EV Fleet Program requirements, laws, regulations or other applicable jurisdictional requirements. Additionally, if applicable and requested by PG&E, Site Host shall either amend the easement to include the legal description of the new location or enter into a new easement with PG&E. PG&E Termination or Suspension: PG&E may terminate, or for any duration suspend, Site Host’s participation in the EV Fleet Program, with or without cause, at any time, and for any reason, with reasonable advance notice. Such reasons may include but are not limited to: failure to provide or maintain terms of easement, failure to abide by EV Fleet Program terms and conditions, permitting issues, exceptional installation costs, environmental concerns, or any other reason(s) not in the best interests of the EV Fleet Program or PG&E’s ratepayers. Packet Page 90 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 12 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company Site Host Removal or Termination: Should Site Host request removal or termination of EVSE or parts thereof prior to expiration of the Term, then Site Host shall bear the full cost and sole expense of such removal as well as all fees and costs, as circumstances may dictate, for losses incurred by PG&E on behalf of ratepayers, such as pro-rated costs of equipment, site design and installation. Site Host may, at any time within the Term request from PG&E projected and final costs associated with such a removal request. Such costs will include all amounts paid by PG&E, divided equally over a ten-year period (e.g., if amounts total $100k and Site Host leaves after 1 year it is responsible for $90k). If the Site Host wishes to assign its rights and obligations of this Contract to a new Site Host prior to the expiration of the Term, the new Site Host may assume all rights and obligations for the remaining Term with PG&E consent. Such consent not to be unreasonably withheld. Indemnification: Site Host shall indemnify, hold harmless and defend PG&E, its affiliates, subsidiaries, parent company, officers, managers, directors, agents, and employees, from and against all claims, demands, losses, damages, costs, expenses, and liability (legal, contractual, or otherwise), which arise from or are in any way connected with any: (i) injury to or death of persons, including but not limited to employees of PG&E or Site Host; (ii) injury to property or other interests of PG&E, Site Host, or any third party; (iii) violation of a local, state, or federal common law, statute or regulation, including but not limited to environmental laws or regulations; (iv) strict liability imposed by any law or regulation; so long as such injury, violation, or strict liability (as set forth in (i) - (iv) above) arises from or is in any way connected with Site Host’s performance of, or failure to perform, this Contract. This indemnification obligation shall not apply to the extent that such injury, loss or damage is caused by the negligence or willful misconduct of PG&E, its officers, managers, or employees. Site Host shall, on PG&E's request, defend any action, claim, or suit asserting a claim which might be covered by this indemnity, using counsel acceptable to PG&E. Site Host shall pay all costs and expenses that may be incurred by PG&E in enforcing this indemnity, including reasonable attorney's fees. To the extent necessary, each Party was represented by counsel in the negotiation and execution of this Contract. PG&E represents and warrants that it has indemnification language in its contract with any third party who PG&E may send to perform work on Site Host’s physical site. PG&E agrees to work closely with Site Host on any concerns that may arise related to the party who will perform work on Site Host’s physical site. Insurance Requirements: Site Host shall procure, carry and maintain the following insurance coverage and Site Host is also responsible for its Subcontractors maintaining sufficient limits of the appropriate insurance coverage: A. Personal Liability 1. The limit shall not be less than One Million Dollars ($1,000,000) each occurrence for bodily injury, property damage and personal injury. 2. Coverage shall: a) By "Additional Insured" endorsement add as insureds PG&E, its directors, officers, agents and employees with respect to liability arising out of work performed by or for the ‘Site Host’; b) Be endorsed to specify that the ‘Site Host’ insurance is primary and that any insurance or self-insurance maintained by PG&E shall not contribute with it. B. Workers’ Compensation and Employers’ Liability 1. Workers’ Compensation insurance or self-insurance indicating compliance with any applicable labor codes, acts, laws or statutes, state or federal, where Site Host performs Work. 2. Employers’ Liability insurance shall not be less than $1,000,000 for injury or death in each accident. C. Commercial General Liability 1. Coverage shall be at least as broad as the Insurance Services Office (ISO) Commercial General Liability Coverage “occurrence” form, with no coverage deletions. 2. The limit shall not be less than $1,000,000 each occurrence for bodily injury, property damage and personal injury. Packet Page 91 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 13 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company 3. Coverage shall: a) by “Additional Insured” endorsement add as insureds PG&E, its affiliates, subsidiaries, and parent company, and PG&E’s directors, officers, agents and employees with respect to liability arising out of or connected with the Work performed by or for the Site Host. (ISO Form CG2010 or equivalent is preferred.) In the event the Commercial General Liability policy includes a “blanket endorsement by contract,” the following language added to the certificate of insurance will satisfy PG&E’s additional insured requirement: “PG&E, its affiliates, subsidiaries, and parent company, and PG&E’s directors, officers, agents and employees with respect to liability arising out of the work performed by or for the Site Host are additional insureds under a blanket endorsement.”; b) be endorsed to specify that the Site Host’s insurance is primary and that any insurance or self-insurance maintained by PG&E shall not contribute with it. D. Documentation Requirements 1. Site Host shall have all insurance in place before beginning any Work. Upon request, Site Host shall furnish PG&E with certificates of insurance, declaration pages and endorsements (collectively, “Documentation”) of all required insurance. Documentation shall be signed and submitted by a person authorized by that insurer to issue certificates of insurance and endorsements on its behalf 2. The insurer shall deliver notification to PG&E in accordance with the policy provisions if any of the above- described policies are cancelled before the stated expiration date 3. PG&E may inspect the original policies in Section A or B or require copies, at any time. Site Host/Owner may redact non-essential exposure information from copies. 4. The minimum liability insurance requirements established in this Contract are not a representation by PG&E that the insurance limits are sufficient, nor do these requirements in any way limit Site Host’s liability under this Contract. 5. Upon request, Site Host shall furnish PG&E the same evidence of insurance for its Subcontractors as PG&E requires of Site Host. Casualty: If all or any portion of the EVSE on the Premises are damaged or destroyed by fire or other casualty which materially and adversely affects the operation of the EVSE (any such occurrence, a “Casualty”), Site Host shall have the right to terminate this Contract by written notice to PG&E in which event this Contract shall terminate on the date that is 10 days after the date of Site Host’s termination notice and PG&E may elect to remove or replace the EVSE from the Premises. In the event of any Casualty which materially and adversely affects the operation of the EVSE, PG&E shall have the right to terminate this Contract by written notice to Site Host within 14 days after the Casualty, in which event this Contract shall terminate on the date that is 10 days after the date of PG&E’s termination notice and PG&E may elect to remove or replace the EVSE from the Premises. Dispute Resolution: After attempting in good faith to resolve a dispute, a party may request mediation by written notice to the other Party. The mediation shall be conducted by a mutually-agreeable mediator with appropriate experience. All negotiations and any mediation conducted pursuant to this provision are confidential and shall be treated as compromise and settlement negotiations, to which Section 1119 of the California Evidence Code shall apply, and Section 1119 is incorporated herein by reference. No Partnership: This Contract shall not be construed as creating a partnership, joint venture, agency relationship, franchise or association, nor shall this Contract render PG&E and Site Host liable as partners, co-venturers or principals. Enforceability: If any of the provisions, or application of any of the provisions, of this Contract are held to be illegal or invalid by a court of competent jurisdiction, PG&E and Site Host shall negotiate an equitable adjustment in the provisions of this Contract with a view toward effectuating the purpose of this Contract. The illegality or invalidity of any of the provisions, or application of any of the provisions, of this Contract will not affect the legality or enforceability of the remaining provisions or application of any of the provisions of the Contract. Integration: This Contract, including all items incorporated herein by reference, constitutes the entire agreement and understanding between the parties as to the subject matter of the Contract. It supersedes all prior or contemporaneous agreements, commitments, representations, writings, and discussions between parties, whether oral or written, express or implied, that relate in any way to the subject matter of this Contract. This Contract has been induced by no Packet Page 92 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 14 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company representations, statements or agreements other than those expressed herein. Neither party shall be bound by any prior or contemporaneous obligations, conditions, warranties or representations with respect to the subject matter of this Contract. Survival: The provisions of this Contract which by their nature should survive expiration, cancellation or other termination of this Contract, including but not limited to provisions regarding warranty, indemnity, insurance, confidentiality, document retention, business ethics and availability of information, shall survive such expiration, cancellation or other termination. Notice: Any and all notices shall be in writing and addressed to the parties at the addresses specified below or such other addresses as either party may direct by notice given in accordance with this section, and shall be delivered in one of the following manners: (i) by personal delivery, in which case notice shall be deemed to have been duly given when delivered; (ii) by certified mail, return receipt requested, with postage prepaid, in which case notice shall be deemed to have been duly given on the date indicated on the return receipt; or (iii) by reputable delivery service (including by way of example and not limitation Federal Express, UPS and DHL) which makes a record of the date and time of delivery, in which case notice shall be deemed to have been duly given on the date indicated on the delivery service’s record of delivery. If to PG&E: Pacific Gas and Electric Company Attn: EV Fleet Program Manager 77 Beale St San Francisco, CA 94105 Email Address: EVChargeNetwork@pge.com If to Site Host: __________________________________(Company Name) __________________________________(Street Address) __________________________________ (City, zip) __________________________________ (Name) The Parties have executed this Contract on the dates indicated below, to be effective upon the later date. ________________________________ Company Name PACIFIC GAS AND ELECTRIC COMPANY ________________________________ Signature ________________________________ Signature ________________________________ Print Name ________________________________ Print Name ________________________________ Title ________________________________ Title ________________________________ Date ________________________________ Date Packet Page 93 Item 7 Clean Energy Transportation Pacific Gas and Electric Company 77 Beale Street San Francisco, CA 94105 Page 15 of 15 Contract version revised 8.7.19 EV Fleet Program Terms and Conditions (“Contract”) Between San Luis Obispo (SLO) and Pacific Gas and Electric Company EXHIBIT A PROJECT SCOPE 29 Prado Road, San Luis Obispo Summary (Year 1 = year contract signed) Description Year 1 Year 2 Year 3 Year 4 Year 5 Total # of vehicles 14 0 0 0 6 20 Anticipated load (kW) 900 kW 0 0 0 0 900 kW # and type of vehicle 14 Transit Buses (Public Use) 0 0 0 6 Transit Buses (Public Use) 20 Transit Buses (Public Use) # and type of chargers to support vehicles 2 Chargers @ 150 kW 12 Chargers @ 50 kW 0 0 0 0 14 Chargers 900 kW Packet Page 94 Item 7 Department Name: Admin and IT Cost Center:1101 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Greg Hermann, Deputy City Manager Prepared By:Lynn Wilwand, Administrative Analyst SUBJECT:MEMORANDUM OF UNDERSTANDING FOR UNDERGROUND UTILITY CONDUIT INFRASTRUCTURE WITH THE COUNTY OF SAN LUIS OBISPO RECOMMENDATION Approve and authorize the Deputy City Manager or their designee to execute the Memorandum of Understanding (MOU) for Underground Utility Conduit Infrastructure with the County of San Luis Obispo (Attachment A). DISCUSSION Information Technology staff from the City and the County meet periodically to share information and determine ways in which collaboration would be beneficial. During one of these meetings, the County expressed a need for additional fiber cable to connect County sites. The City has also expressed a need for an off-site disaster recovery site. As such, City and County IT staff created a plan that would fulfill both the City’s and the County’s needs. The plan is detailed in the Memorandum of Understanding (MOU) between the County and the City and allows (at no-cost to either party) the City to share data center facilities at the County for a disaster recovery site, provides the City access to new County installed fiber, and allows the County to install new fiber optic cable in the City’s existing underground conduit connecting to other County fiber cable. As part of this project, the County will also be replacing an existing obsolete fiber cable between the 842 Palm Parking structure and the City Hall data center for increased capacity. Specifically, the County will install new fiber optic cable along Stenner Creek Road connecting existing County fiber optic cable located at the City Water Treatment Plant to existing County fiber optic cable located at the intersection of State Highway 1 and Stenner Creek Road. This will connect to new County fiber optic cable being installed at the corner of Walnut and Osos Streets in the City of San Luis Obispo. To save on construction cost, the County will use the City’s existing underground utility conduit infrastructure that runs along the intended path of new fiber to be installed by County within the City of San Luis Obispo. In return, the County has granted the City use of rack space at their data center located at 976 Osos. An additional offsite backup location ensures that the City is able to maintain critical City operations in the event that one of the City’s other locations goes offline due to a disaster (e.g. fire, flood, earthquake, etc.). Packet Page 95 Item 8 In addition, secure secondary copies of all City backups are stored in this location as part of the City’s strategy to combat ransomware threats. The MOU grants the County a no-cost, nonexclusive license to use certain specified City conduit for the purpose of installing fiber optic cable within the conduit for use by the County in exchange for: 1) No-cost server and network rack space occupancy by the City within the County Datacenter and 2) No-cost County-installed fiber at Stenner Creek Road. Sharing data center facilities at the County Data center and Underground Utility Conduit Infrastructure at no-cost to either party provides numerous benefits and cost savings to the public. Cost estimates for the City to get the same amount of rack space at a commercial co- location facility would cost approximately $43,000 per year, which would have been cost prohibitive for the City. This partnership allows the City to further its disaster recovery goals without that additional cost. The cost of alternative construction options for the County would have added significant cost to their construction budget. CONCURRENCE Public Works has reviewed this report and concur with the recommendation. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: No Budget Year: Funding Identified: No Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund -0--0--0- State Federal Fees Other: Total -0--0--0- This project aligns with the Fiscal Sustainability and Responsibility Major City Goal. Packet Page 96 Item 8 There are no costs associated with approval of the MOU. The impact of this project to City staff will be minimal, (staff hours are estimated at less than 20 and covered by operating budget) as the project is being managed by the County. ALTERNATIVES Do not approve the MOU.This would incur costs to provide the City with an off-site disaster recovery site. Attachments: a - Draft MOU for Underground Utility Conduit Infrastructure Packet Page 97 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 1 of 7 MEMORANDUM OF UNDERSTANDING OF THE UNDERGROUND UTILITY CONDUIT INFRASTRUCTURE FOR THE COUNTY of SAN LUIS OBISPO FIBER PROJECT BETWEEN THE COUNTY OF SAN LUIS OBISPO AND THE CITY OF SAN LUIS OBISPO This Memorandum of Understanding (MOU) is entered into on ___________________________ by and between the County of San Luis Obispo (County) and City of San Luis Obispo (City) regarding the use of City’s existing underground utility conduit infrastructure by County for installation of new fiber op tic cabling as part of the County of San Luis Obispo Fiber Project. RECITALS WHEREAS, the County seeks to install new fiber optic cable along Stenner Creek Road in the unincorporated portion of San Luis Obispo County, connecting existing County fiber optic cable located at the City Water Treatment Plant to existing County fiber optic cable located at the intersection of State Highway 1 and Stenner Creek Road that will connect to new County fiber optic cable being installed at the corner of Walnut and Osos Streets in the City of San Luis Obispo. WHEREAS, the County seeks to install new fiber optic cable within the City’s corporate boundaries from the corner of Walnut and Osos Streets to the County main datacenter located at 976 Osos St. (hereinafter, “County Datacenter”) in the City of San Luis Obispo, as depicted on Exhibit ’A’ attached hereto and incorporated herein. WHEREAS, the City has existing underground utility conduit infrastructure that runs along the intended path of new fiber to be installed by County within the City of San Luis Obispo and is currently used for a City-wide fiber optic network, as well as street and signal lights. WHEREAS, the County and the City desire to create a working relationship which will enable mutually beneficial conduit occupancy within portions of the City and the County of San Luis Obispo. WHEREAS, the City has agreed to grant the County a no-cost nonexclusive license to use certain specified City conduit for the purpose of installing fiber optic cable within the conduit for use by the County in exchange for: 1) no-cost server and network rack space occupancy by the City within the County Datacenter and 2) no-cost County-installed fiber at Stenner Creek Road. NOW, THEREFORE, IT IS AGREED by the parties hereto as follows: 1. Definitions The following terms, whether used in the singular or plural, when used in this MOU and initially capitalized, shall have the meaning specified below. Packet Page 98 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 2 of 7 1.1. Cable – the fiber optic cable, the fiber contained therein, and associated splicing connections and enclosures. 1.2. Conduit – a structure, usually underground, which may contain one or more fiber optic, electrical, or other communication and signaling cables. 1.3. Fiber – a filament of dielectric material designed for the purpose of light-wave transmission. 1.4. Datacenter – a physically secure and environmentally controlled facility with redundant electrical and emergency backup power used for the purpose of centrally housing computer data servers, storage devices, and network connectivity for organizational enterprise operations. 1.5. Manhole – a subsurface enclosure which qualified personnel may enter and use for the purpose of installing, operating, and maintaining cable in the Underground Utility Conduit Infrastructure. 1.6. Underground Utility Conduit Infrastructure – existing underground conduits constructed by the City including any combination of conduits, manholes, hand holes, and vaults joined to form an integrated whole. Installed and incorporated with the conduits are both buried and at-grade pull boxes, junction boxes, mule tape, buried warning tape, and tracer wire. 2. Beneficial Purpose of Use of Underground Utility Conduit Infrastructure Both the County and the City recognize that sharing datacenter facilities at the County Datacenter and Underground Utility Conduit Infrastructure at no-cost to either party provides numerous benefits and cost savings to the public. 3. Terms Upon agreeing to this MOU, both the County and the City agree to adhere to the terms as follows: 3.1. Construction - Any construction work completed by the County for the benefit of the County will comply with all prevailing wage laws. Any construction work completed by the City for the benefit of the City will comply with all prevailing wage laws. 3.2. Ownership of Underground Utility Conduit Infrastructure – The City will maintain ownership of existing Underground Utility Conduit Infrastructure. New conduit installed by the County to provide fiber optic cable egress to County Datacenter will be owned by the County once built. 3.3. Access to Underground Utility Conduit Infrastructure – The County shall be granted access to specified existing City Underground Utility Conduit Infrastructure for the purpose of installing new fiber optic cable for use by County. 3.4. Granting of Rights and Authority. The County and the City grants certain rights to each party herein described. The County and City will work to meet the needs of each party to the maximum degree possible. The City Information Technology Manager reserves the final decision on all matters related to County use of the existing City Underground Utility Conduit Infrastructure. The County Information Technology Director reserves the final decision on all matters related to City occupancy and City equipment located within the County Datacenter. Either party may bring any final decisions made respectively by the City and County to their respective boards/councils for discussion. 3.5. County’s Use. Subject to the provisions of this MOU and any other applicable state law, federal law, and local law, the County is granted a license to use specified City conduit within the existing Underground Utility Conduit Infrastructure along the pathway of new fiber optic cabling to be installed by the County from the corner of Walnut and Osos Streets to the County Datacenter as Packet Page 99 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 3 of 7 delineated in Exhibit ‘B’. County will remove, at County’s sole cost, specified City fiber optic cabling, as delineated in Exhibit ’B’ from the existing Underground Utility Conduit Infrastructure and replace it with new fiber optic cabling, at County’s sole cost. The new fiber optic cabling will be owned by County upon installation, consistent with section 3.2. City will own the six (6) strands of new fiber optic cabling to be installed by County between the City parking booth and existing splice case at intersection of Morro and Palm streets. 3.6. City’s Use. Subject to the provisions of this MOU and any other applicable state law, federal law, and local law, City is granted occupancy in the County Datacenter and permitted to install and operate City network and computer hardwaretherein. City will be granted access to new conduit installed by County as delineated in Exhibit ‘B’ for purposes of an alternate access path to the County Datacenter and will be responsible for the installation of new City fiber to be used for alternate access. At no cost to the City, County will replace an existing City Manhole located near AT&T Pole #16 at Stenner Creek Road with a larger Manhole and install new conduit between the existing City and County Manholes. County will install twelve (12) strands of new fiber optic cable between the existing County and City Manholes which will be spliced into existing City fiber optic cables as delineated in Exhibit ’C’. 3.7. Operation, Maintenance and/or Replacement. The City is responsible for all costs for the operation, maintenance, repair, and/or replacement of the City’s existing Underground Utility Conduit Infrastructure, except as provided below. The County is responsible for the operation, maintenance, repair, and/or replacement of the County’s fiber optic cabling being installed in the City Underground Utility Conduit Infrastructure as well as any damage to the City’s existing Underground Utility Conduit Infrastructure caused by such installation. County is responsible for maintenance, repair, and/or replacement of the new conduit installed by County. City is responsible for operation, maintenance, repair and/or replacement of the City’s network and computer hardware located in the County’s datacenter, and City will be responsible for operation, maintenance, repair and/or replacement of the City’s fiber within the County conduit. 3.8. Modification. Modifications altering this MOU shall only be affected by written amendments between the County and the City. 3.9. Effective Date. The effective date of this MOU is the date signed by both parties and shall remain in effect indefinitely unless either party decides to terminate this MOU or if the City Underground Utility Conduit Infrastructure becomes defunct and is non-operational and will not be rebuilt. 4. Termination. This MOU shall continue in effect for a term of fifteen (15) years. If either party chooses to terminate this MOU, the party must furnish written notice to the other party at least six months (180 days) prior to termination. Alternatively, this MOU may be extended for up to three additional five (5) year terms upon the request and mutual agreement of City and County. Each party shall be responsible for all costs and services incurred under this MOU up to the date of termination. 4.1. Force Majeure. Performance of any obligations by either party under this MOU will be excused if prevented or delayed by floods, earthquakes, other acts of God, war, strikes, other labor difficulties, or other causes beyond either parties’ control. 4.2. Relationship of the Parties. The relationship between the County and City shall not be that of partners, agents, or joint venture for one another, and nothing contained in this MOU shall be deemed to constitute a partnership or agency license between them for any purposes, including, but not limited to, federal income tax purposes. Packet Page 100 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 4 of 7 4.3. Assignment. The provisions of this MOU shall apply to and bind the successors and assigns of the respective parties, but no assignment or transfer of this MOU, or any part hereof or interest herein, shall be valid until and unless approved by both parties. 4.4. Counterparts/Fax Delivery: This MOU may be executed in one or more counterparts, all of which taken together shall constitute one and the same instrument. The MOU may be duly executed and delivered by a party by execution and facsimile of the signature page of a counterpart to the other party. 4.5. Notices. Any notice required to be given pursuant to the terms and provisions hereof shall be in writing as follows: 5. Indemnification. To the fullest extent permitted by law, each party shall indemnify, defend, and hold harmless the other party and the other party’s officers, partners, agents, employees, and volunteers from and against all claims, demands, damages, liabilities, loss, costs, and expense (including attorney’s fees and costs of litigation) of every nature arising out of or in connection with the indemnifying party’s performance or non-performance of any obligation or duty provided for or relating to this MOU, except such loss or damage which was caused by sole negligence or willful misconduct of the potential indemnitee. TO COUNTY: _______________________________ Daniel Milei Information Technology Director County of San Luis Obispo 976 Osos St., Rm 400 San Luis Obispo, CA 93408 TO CITY: _______________________________ Greg Hermann Deputy City Manager City of San Luis Obispo 990 Palm St. San Luis Obispo, CA 93401 Packet Page 101 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 5 of 7 EXHIBIT A San Luis Obispo County Datacenter, 976 Osos Street, San Luis Obispo, CA 93401 Packet Page 102 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 6 of 7 EXHIBIT B Fiber optic cabling pathway using City Underground Utility Conduit Infrastructure highlighted in green. New County-installed conduit highlighted in orange. Existing 12 strand multi-mode City fiber to be removed by County from Underground Utility Conduit Infrastructure and replaced with new 48 strand County fiber highlighted in dashed blue. Existing 6 strand multi-mode City fiber to be removed by County from Underground Utility Conduit Infrastructure and replaced with new 12 strand City fiber highlighted in dashed black. Packet Page 103 Item 8 County of San Luis Obispo Fiber Project Underground Utility Conduit Infrastructure MOU Page 7 of 7 EXHIBIT C Vicinity of City of San Luis Obispo Water Treatment Plant, Stenner Creek Road, San Luis Obispo Existing City manhole to be replaced by County and owned by City highlighted in green. New County installed conduit and 12 strand fiber optic cabling highlighted in orange. Packet Page 104 Item 8 Department Name: Public Works Cost Center:5201 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Matt Horn, Public Works Director Prepared By:Gamaliel Anguiano, Transit Manager Geoff Straw, RTA Executive Director SUBJECT:REVISIONS TO THE SAN LUIS OBISPO REGIONAL TRANSIT AUTHORITY JOINT POWERS AGREEMENT RECOMMENDATION Adopt resolution (Attachment A) authorizing execution of the amended and restated Joint Powers Agreement for the San Luis Obispo Regional Transit Authority allowing consolidation of South County Transit into the San Luis Obispo Regional Transit Authority. DISCUSSION Background The City of San Luis Obispo is a member of the San Luis Obispo Regional Transit Authority (RTA) Joint Powers Authority (JPA). Other members of the RTA JPA include the cities of Arroyo Grande, Atascadero, Grover Beach, Morro Bay, Paso Robles, Pismo Beach and the County of San Luis Obispo. Although the City is not a member of the South County Transit JPA, it is being asked to execute amendments to the RTA Joint Powers Agreement that would allow consolidation of South County Transit services into the RTA. The four South County Transit JPA member agencies include the cities of Arroyo Grande, Grover Beach, Pismo Beach, and the County of San Luis Obispo. Council Member Pease is the primary delegate on the RTA Board of Directors, and Mayor Harmon is the alternate. Following significant analysis by RTA and San Luis Obispo Council of Governments (SLOCOG) staff members over the past several years, as well as recommendations by the Triennial Performance Auditor and the three South County City Managers, the South County Transit Board of Directors requested consolidation into the RTA at its January 9, 2018 meeting. At its March 7, 2018 meeting, the RTA Board of Directors conceptually agreed to the consolidation, pending further input from each jurisdiction and planned April 4, 2018 actions by the SLOCOG Board of Directors (discussed below). Action was subsequently delayed due to the temporary shifting of priorities towards pandemic response. Packet Page 105 Item 9 Of particular interest to the four South County Transit member jurisdictions is the issue of continued local control over the local fixed-route services operated within the Five Cities Area under consolidation. To that end, local fixed-route service levels (days, hours, routes, etc.), marketing efforts, and operating/capital budgets for South County local fixed-routes would be solely controlled through a new standing RTA South County Transit Committee (SCTC). The SCTC would be comprised of the RTA Board members from the cities of Grover Beach, Arroyo Grande, Pismo Beach, and one member from the Board of Supervisors. As detailed in the attached amended and restated RTA Joint Powers Agreement, the SCTC would meet at least annually to address public transit issues of interest to the SCTC members and to consider the following year’s budget for local public transit services in the Five Cities Area. Funding of the services authorized by the SCTC would be borne exclusively by the cities of Arroyo Grande, Grover Beach and Pismo Beach, as well as the County on behalf of the communities of Oceano and Avila Beach. A red-lined version depicting changes to the amended and restated Joint Powers Agreement is provided as Attachment B. Consolidation of South County Transit local fixed-route services into the RTA has significant net financial benefits for the South County Transit jurisdictions. In addition, SLOCOG agreed to a concession at its April 4, 2018 meeting on farebox recovery ratio requirements under consolidation in the Arroyo Grande –Grover Beach Urbanized Area that will have long-term financial benefits for the RTA and the SCTC member jurisdictions. The principal benefit to the SCTC member jurisdictions is that consolidation would avoid a roughly $70,000 annual penalty for failing to achieve the new/higher State of California 20% farebox recovery ratio requirement that was triggered by the Federal designation of the area as “urban” in the 2010 Census (it was 10% prior to the urban designation). In summary, while some operating costs would increase under consolidation (principally as it relates to provision of healthcare benefits to six current part-time South County Transit employees who do not currently have health insurance), the on- going net benefit to the SCTC member jurisdictions is anticipated to be on the order of $82,000 annually. The effective date for the transition would be on January 1, 2021. This date was chosen because it corresponds with the annual start date of employees’ healthcare plans, and thus would minimize disruptions for South County Transit employees. Previous Council or Advisory Body Action RTA Executive Director Geoff Straw –who also serves as the South County Transit Administrator –presented the notion of consolidating South County Transit into the RTA to the San Luis Obispo City Council on July 10, 2018 as an information item. No action was requested at that public meeting, although Mr. Straw has had continuing discussions with City Manager and other city staff regarding the consolidation. Policy Context This action has no direct policy context, although with consolidation SLOCOG would permit a lower farebox recovery ratio for the RTA for operations in the Arroyo Grande –Grover Beach Urbanized Area and the El Paso de Robles –Atascadero Urbanized Area, resulting in a benefit for RTA fixed-route operations in those areas (Routes 10 and 9, respectively). Packet Page 106 Item 9 Public Engagement This item has been discussed at several RTA Board of Directors meetings, as well as at SLOCOG Board of Directors meetings. As noted above, Mr. Straw also presented consolidation of South County Transit into the RTA to the City Council in July 2018. CONCURRENCE The City Managers from Arroyo Grande, Pismo Beach, Grover Beach as well as the RTA Board of Directors. This report has been made available to City Attorney’s office, which concurs with the recommendation and has reviewed, edited and approved the proposed resolution and supporting documents. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: N/A Budget Year: N/A Funding Identified: N/A Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund State Federal Fees Other: Total Consolidation of South County Transit into RTA does not have a fiscal impact to the City of San Luis Obispo. SCTC member jurisdictions (Grover Beach, Arroyo Grande, Pismo Beach, County of San Luis Obispo) are anticipated to save $82,000 annually due to increased operational efficiencies. ALTERNATIVES 1.Modify the RTA amended and restated Joint Powers Agreement. This is not recommended as the action would delay the process and have significant fiscal impacts on the four South County Transit JPA member jurisdictions. 2.Do not approve the Resolution to execute the RTA amended and restated Joint Powers Agreement. This is not recommended as the action would leave in place the existing RTA Joint Powers Agreement. Packet Page 107 Item 9 Attachments: a - Draft Resolution b - Amended Joint Powers Agreement with SCTC Red-line Mark-up Packet Page 108 Item 9 R _____ RESOLUTION NO. ______ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF SAN LUIS OBISPO, CALIFORNIA, AUTHORIZING EXECUTION OF THE AMENDED AND RESTATED JOINT POWERS AGREEMENT FOR THE SAN LUIS OBISPO REGIONAL TRANSIT AUTHORITY WHEREAS, South County Transit provides fixed-route public transportation services in the cities of Arroyo Grande, Grover Beach and Pismo Beach, as well as the unincorporated area of Oceano, as authorized under a Joint Powers Agreement originally enacted in 1978 and subsequently amended in 2001 and 2016; and WHEREAS, South County Transit has been provided professional administrative services, vehicle maintenance and operations oversight under contract to the San Luis Obispo Regional Transit Authority since 1997; and WHEREAS, both South County Transit Board of Directors and the San Luis Obispo Regional Transit Authority Board of Directors have extensively discussed the possibility of consolidating South County Transit into the San Luis Obispo Regional Transit Authority to realize cost efficiencies and to avoid farebox recovery ratio penalties in the South County Transit service area; and WHEREAS, the San Luis Obispo Regional Transit Authority Board of Directors will consider an amended and restated Joint Powers Agreement that consolidates South County Transit services into the agency at its December 2, 2020 meeting; and WHEREAS, the amended and restated Joint Powers Agreement for the San Luis Obispo Regional Transit Authority includes provisions that allow local control of service levels and budgetary control for fixed-route services in the Arroyo Grande –Grover Beach Urbanized Area, which includes the cities of Arroyo Grande, Grover Beach and Pismo Beach, as well as the unincorporated communities of Avila Beach and Oceano; and WHEREAS, the amended and restated Joint Powers Agreement for the San Luis Obispo Regional Transit Authority becomes effective at 12:00 AM on January 1, 2021 upon ratification by the County of San Luis Obispo Board of Supervisors and by each of the seven City Councils in the county; and WHEREAS, the existing South County Area Transit Joint Powers Agreement states that the Agency may sell, lease or assign all of its real and personal property and may cease operations upon such terms and conditions as the Board determines to be reasonable and upon affirmative vote by all member agencies; and WHEREAS, the existing South County Area Transit Joint Powers Agreement also states that the Agreement shall continue in full force and effect until cancelled by affirmative vote of a majority of the member agencies, and Packet Page 109 Item 9 R _____ WHEREAS, the South County Transit Board of Directors resolved at its October 6, 2020 meeting to terminate the South County Area Transit Joint Powers agreement effective 11:59 PM on December 31, 2020 upon ratification of the majority of the member agencies and upon full ratification of the amended and restated Joint Powers Agreement for the San Luis Obispo Regional Transit Authority by its member agencies. NOW, THEREFORE, BE IT RESOLVED, by the Council of the City of San Luis Obispo as follows: Section 1. The City Council hereby finds and determines that all of the recitals are true and correct. Section 2. The City Council supports consolidation of South County Transit into the San Luis Obispo Regional Transit Authority. Packet Page 110 Item 9 R _____ Section 3.The City Manager is directed to execute the San Luis Obispo Regional Transit Authority amended and restated Joint Powers Agreement. Upon motion of Council Member _____________, seconded by Council Member _____________ and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ____ day of _________ 2020. ________________________________ Mayor Heidi Harmon ATTEST: ________________________________ Teresa Purrington City Clerk APPROVED AS FORM: ________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on ________________________. ________________________________ Teresa Purrington City Clerk Packet Page 111 Item 9 1 SAN LUIS OBISPO REGIONAL TRANSIT AUTHORITY AMENDED AND RESTATED JOINT POWERS AGREEMENT WITNESSETH: This Agreement is made and entered into this 9 th day of March, 1990, and amended on 2nd day of September, 1998,and further amended on the 24th day of June, 2013, by and among the incorporated cities of Arroyo Grande, Atascadero, El Paso de Robles, Grover Beach, Morro Bay, Pismo Beach and San Luis Obispo, all being municipal corporations in the County of San Luis Obispo, California (hereinafter called “Cities”) and the County of San Luis Obispo, a body politic and corporate, and a subdivision of the State of California, (hereinafter called “County”). WHEREAS, Section 6500 et seq. of the California Government Code (Title 1, Div. 7, Chapter 5, Article 1) provides for agreements between two or more public agencies to jointly exercise any power common to the contracting parties, subject to certain mandatory provisions contained therein; and WHEREAS, the Cities and County have previously entered into a joint powers agreement for the formation of the San Luis Obispo Council of Governments for the purpose of providing, among other things, for a regional transportation agency; and WHEREAS, the San Luis Obispo Council of Governments, at a regularly held meeting on May 10, 1989, voted to consolidate the administration of several transportation systems through a regional transit joint powers agreement. WHEREAS, the cities of Arroyo Grande, Grover Beach and Pismo Beach, and the County of San Luis Obispo, were formerly members of the South County Area Transit Joint Powers Agency,which began operating a public transit system within those jurisdictions in January, 1978, and which ceased towill cease to exist and transferred its assets to the San Luis Obispo Regional Transit Authority in return for amendments made to this Agreement effective January 1, 2021. NOW THEREFORE, it is agreed as follows: ARTICLE I General Provisions Section 1. Purpose: The purpose of this Agreement is to exercise the common powers of the member agencies for the formation of a Joint Powers Agreement with full power and authority to own, operate and administer a county-wide public transportation system within the boundaries and over the territory over which the Joint Powers Agency has jurisdiction. Section 2. Name: The official name of the entity shall be San Luis Obispo Regional Transit Authority and hereafter referred to as the RTA. Packet Page 112 Item 9 2 ARTICLE II Organization Section 1. Board Members: The membership of the RTA Governing Board shall be the same as the membership of the San Luis Obispo Council of Governments (hereinafter referred to as SLOCOG). Section 2. Board Meetings - Voting - Quorum: Regular meetings shall be generally held in the first week of July, September, November, January, March and May or as specified in a biannually adopted meeting calendar. Special meetings may be called by the President or upon written request of at least three (3) members of the RTA Board. Voting and quorum provisions shall be the same as those provided in the SLOCOG Joint Powers Agreement, however, any vote regarding local fixed-route services or other public transportation services operated solely within the Arroyo Grande –Grover Beach Urbanized Area, including the budgeting and funding of such services, shall require at least three affirmative votes from Board members who also sit on the South County Transit Committee . Section 3. Officers: The officers of SLOCOG shall serve as officers of RTA. Section 4. Executive Director: The RTA Board shall designate an Executive Director to operate RTA. The Executive Director shall serve at the pleasure of the RTA Board, with delegated powers to certify documents of the RTA Board as required by the law and to assume such duties and responsibilities as the Board may direct. Section 5. Members: 1. The County of San Luis Obispo and all cities incorporated in the County of San Luis Obispo presently or in the future, are declared eligiblefor membership. 2. Member city agencies may elect to have an alternate member(s) from their city council in addition to any official member, but said alternate(s) shall be able to vote only in the absence of the official representative. 3. Membership shall be contingent upon the execution of this Joint Powers Agreement. Section 6. Boundaries and Service Levels: The service area boundaries shall be all of the area within the boundaries of San Luis Obispo County as designated by the RTA Board. Any additional services beyond the level recommended by the Regional Transportation Plan or mandated in the Unmet Transit Needs Hearing (PUC Section 99401.5) may be instituted, but shall require unanimous approval of affected Packet Page 113 Item 9 3 jurisdictions, with costs for the extra service to be distributed on the basis of formula developed by the RTA Board members representing the affected jurisdictions. Section 7. Committees: 1. Committees and subcommittees may be established as RTA may deem appropriate. 2.Membership on “ad-Hoc” policy committees shall be at the discretion of the President. Nothing herein shall be construed to limit membership on these aforesaid committees to officials of the member agencies.The President may appoint any individual deemed qualified to serve on a committee. 3. Standing committees shall include the: a. Regional Transit Advisory Committee (RTAC) serving as a Regional Transit Productivity Committee to advise the Board on the efficiency and effectiveness of the transit system. b.An Executive Committee comprised of the President, Vice President and the past President and at least one representatives from the county of San Luis Obispo (if none of the above) shall advise the Executive Director and RTA on: draft agendas, personnel issues, budget and Overall Work Program; controversial, sensitive and major policy issues; and shall facilitate the annual performance evaluation of the Executive Director. Items for review shall be selected by the Executive Director in consultation with the President. All Committee members may include agenda items as they desire. For purposes of conducting business, two members shall constitute a quorum. c. South County Transit Committee (SCTC) comprised of RTA Board members representing the four jurisdictions included in the Arroyo Grande –Grover Beach Urbanized Area as defined in the 2010 Decennial Census (hereinafter referred to as the AG-GB UZA). The SCTC member jurisdictions include the cities of Arroyo Grande, Grover Beach and Pismo Beach, and the County of San Luis Obispo, representing the Oceano Area and the Avila Beach Area. The SCTC’s roles and responsibilities include: i. The SCTC shall effectively control local fixed-route services and any other public transportation services operated solely within the AG-GB UZA by virtue of the voting requirements for matters provided above in Section 2 of this Agreement. Packet Page 114 Item 9 4 ii. At a minimum, the SCTC shall meet annually to consider annual service levels, fare levels, major marketing campaigns, capital improvement plans, and to ratify financial commitments for each jurisdiction participating in public transportation services operated solely within the AG-GB UZA. At the request of two or more SCTC members, properly noticed special SCTC meetings may also be conducted. iii. For purposes of conducting business, three of the four SCTC members shall constitute a quorum. iv. The SCTC shall submit an annual operating budget and multi-year capital improvement plan for fixed-route and other public transportation services operated solely within the AG-GB UZA to the full RTA Board prior to May 1 for consideration as part of the RTA Overall Annual Budget. v. Any additional services beyond the level recommended by the Regional Transportation Plan or mandated in the annual Unmet Transit Needs Hearing (PUC Section 99401.5) may be instituted in the SCTC service area, but shall require unanimous approval of affected jurisdictions, with costs for the extra service to be distributed on the basis of a formula developed by the SCTC members representing the affected jurisdictions. vi. Each SCTC member agency shall make an annual Transportation Development Act contribution based upon the percentage of total SCTC-served population related to the area served within that member agency. All population percentages utilized shall be those annually adopted by the San Luis Obispo Council of Governments for allocating Transportation Development Act Funds based annually on estimates prepared by the State Department of Finance pursuant to Section 2227 of the Revenue and Taxation Code for cities and by the County Planning Department for unincorporated communities. i.vii.Any member of the SCTC may withdraw from the SCTC after providing written notice to the RTA Board President one year in advance of the requested withdrawal date. A withdrawing member’s financial obligation under this subsection is limited to the withdrawing member’s pro - rata share of the currently adopted SCTC operating Packet Page 115 Item 9 5 budget within the service area of the obligated commitments affecting the withdrawing member and any San Luis Obispo Council of Governments finding as to Unmet Transit Needs that are Reasonable to Meet pursuant to Public Utilities Code Section 99401.5. However, the obligations of a withdrawing member under this subsection are limited to the special transportation funds to which the withdrawing member would be entitled, such as Transportation Development Act funds, and this section shall not impose any obligation on the general funds of the withdrawing member. 4. No committee shall commit the RTA on any matter or questions of policy. Such matters or questions can only be decided by the RTA. 5. All committees shall receive clerical assistance from RTA staff and, by agreement, SLOCOG staff for the purpose of maintaining minutes of meetings and other such duties as the Executive Director may direct. The chair of each committee shall sign the original copy of the minutes indicating verification of contents upon committee adoption. Copies of minutes of all meetings shall be sent to members of the RTA and the Executive Director. ARTICLE III Financial Provisions Section 1. Budget: The Executive Director shall prepare an Overall Annual Budget annual budget for RTA Board adoption prior to commencement of each fiscal year.The Overall Annual Budget shall include financial details on core RTA services, as well as financial details for those various public transportation services provided under agreement to other agencies. Core RTA services include intercity fixed-routes along the US-101 and SR-1 corridors, and regional Americans with Disabilities Act complementary paratransit services. The approval of the Overall Annual Budget shall be in accordance with those procedures prescribed by the Joint Powers Agreement of SLOCOG. The annual operating and capital budgets for non-core services provided under agreement to another agency requires ratification by its governing body prior to consideration of the Overall Annual Budget by the RTA Board. Accounting practices to be applied will conform to those used by San Luis Obispo County, consistent with Transportation Development Act rules and regulations. A Consolidated Fund balance and cash balance for RTA core services will carry forward from one year to the next.Separate Consolidated Fund balances and cash balances will be maintained for public transportation services provided by RTA under Packet Page 116 Item 9 6 agreement to other agencies, including those public transportation services provided under the direction of the SCTC. The Overall Annual Budget may additionally carry funds for future fiscal years where necessary to develop a multi-year Capital Improvement Program and to reflect obligations under state or federal funding agreements, to the extent allowable by California law. No member Agency shall be required to expend any of its general fund monies to support the operations of the RTA. The operation of the transit system shall be funded from revenues derived from operations, member Transportation Development Act fund contributions, grants, and any other appropriate revenue sources. Each member agency shall make an annual contribution to the RTA in accordance with the adopted budget. Any formula may be amended upon approval of all jurisdictions affected by that formula and ratified by the RTA. All population percentages utilized shall be those annually adopted by SLOCOG for allocating Transportation Development Act Funds based annually on estimates prepared by the State Department of Finance pursuant to Section 2227 of the Revenue and Taxation Code for cities and by the County Planning Department for unincorporated communities. Section 2. Expenditures:The RTA may establish procedures and policies to insure competitive prices for the purchases of goods and services. Formal bidding shall not be required unless directed specifically by the RTA or unless required by state or federal law. Particularly in the purchase of equipment, including buses, the RTA may consider the design, maintenance and operating costs, and other similar factors in determining the most suitable equipment and need not purchase equipment having the lowest initial cost. Section 3. Treasurer and Auditor: Pursuant to Government Code Section 6505.5, the Treasurer of the County of San Luis Obispo is hereby designated as Treasurer of the RTA. The Treasurer shall have the powers and duties set forth in Government Code Section 6505.5. The Auditor/Controller of the County of San Luis Obispo is designated as the Auditor of the RTA pursuant to Government Code Section 6505.5. Section 4. Annual Audit:The RTA shall cause an annual audit to be prepared and filed in accordance with Government Code Section 6505 and Public Utilities Code Section 99245.This audit shall include RTA core services, as well as those service provided under agreement for other agencies. Section 5. Annual Report: The Executive Director shall prepare and submit an annual report of the operations to the RTA Board, SLOCOG and State Controller within 90 days of the by January 31 following each fiscal year pursuant to Public Utilities Code, Section 99243. Packet Page 117 Item 9 7 Section 6. Periodic Reporting: The RTA Board may require periodic reporting of ridership, finances, or other information.This periodic reporting shall include RTA core services, as well as those service provided under agreement to other agencies. It shall be the responsibility of the Executive Director to provide such reports in a form acceptable to the RTA Board. ARTICLE IV Authority Section 1. Powers:The RTA shall have all Powers necessary to carry out the purpose of this Agreement, except the power to tax. Its power to expend funds shall be limited only by the availability of funds as set forth in ARTICLE III: Finances, Section 1. The Powers of the RTA specifically include, but are not limited to, the following: 1. To solicit bids and negotiate contracts from private enterprise for services and/or operation. 2. To sue or be sued. 3. To employ agents, employees and contract for professional services. 4. To make and enter contracts, including labor, purchase agreement and employment contracts. 5. To acquire, convey, construct, manage, maintain and operate necessary equipment, building and improvements. 6. To acquire and convey real and personal property. 7.To incur debts, liabilities and obligations, as well as obligations of financial assistance from State and Federal agencies, and to obligate RTA to operate the improvements, equipment or transportation system in accordance with the terms and conditions of said financial assistance. 8. To purchase insurance. 7.9.To develop policies and procedures necessary to remain in compliance with Federal Transit Administration Section 5307 Urbanized Area Formula Program and other federal grant program funding requirements. Section 2. RTA is a Public Legal Entity:The RTA is a public entity duly formed and existing under the laws of the State of California. It is a separate and distinct legal entity from its member agencies. The debts, duties and obligations created pursuant to Formatted: Space After: 0 pt Packet Page 118 Item 9 8 this Agreement, shall be solely the obligations of the RTA and not those of its officers, employees, members of the Board of Directors or the member agencies. ARTICLE V Miscellaneous Provisions Section 1. Withdrawal of Member:A withdrawing member’s financial obligation under this Section is limited to the withdrawing member’s pro -rata share of the currently adopted operating budget based upon ARTICLE III, Section 1 within the service area of the obligated commitments affecting the withdrawing member and any SLOCOG’s finding as to unmet transit needs that are reasonable to meet pursuant to Public Utilities Code Section 99401.5. Section 2. Amendment of Agreement: No amendment to this Agreement shall be made without the consent of all member agencies at the time of the amendment. Section 3. Ratification - Effective Date: This Agreement shall be deemed effective as to those parties executing this agreement upon their execution of the agreement. Section 4. Assignability: In the event it is deemed in the best public interest to have the RTA operated by another individual or entity, whether public or private, and provided that the assignment complies with State and Federal laws, the agency on affirmative vote of the majority in accordance with Section 2 of ARTICLE II, may sell, lease or assign all of its real and personal property and cease operations upon such terms and conditions as the RTA determines to be reasonable. Section 5. Termination: This Agreement shall continue in full force and effect until rescinded by a majority of the member agencies. Section 6. Notification to Secretary of State: Pursuant to Government Code Section 6503.5,the RTA shall cause a notice of the execution of this Agreement to be prepared and filed with the Office of the Secretary of the State of California, within thirty (30) days after the effective date of any amendment to this Agreement. Until such filings are completed, the RTA shall not incur indebtedness of any kind. IN WITNESS WHEREOF, the parties have executed this Agreement as of the day and year first hereinabove written. IN WITNESS THEREOF, the parties have executed this Agreement as of the day and year first hereinabove written. Packet Page 119 Item 9 9 City of Arroyo Grande By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of Atascadero By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of Grover Beach By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of Morro Bay By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of Paso Robles By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of Pismo Beach By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk City of San Luis Obispo By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk Packet Page 120 Item 9 10 County of San Luis Obispo By: ___________________________ Date:______________________ ___________________________ Resolution No._______________ Clerk Approved as to form and legal effect: RITA L.NEAL County Counsel By: ___________________________ DeputyAssistant County Counsel Date: __________________________ Packet Page 121 Item 9 Department Name: Community Development Cost Center:4003 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Michael Codron, Director of Community Development Prepared By:Dan Van Beveren, Senior Civil Engineer SUBJECT:PARTIAL ACCEPTANCE OF PUBLIC IMPROVEMENTS FOR TRACTS 3063-2, 3066-2, 3095, AND 3111, RESIDENTIAL SUBDIVISIONS IN THE ORCUTT AREA RECOMMENDATION Adopt resolutions for Tract 3063-2 (Attachment A), Tract 3066-2 (Attachment B), Tract 3095 (Attachment C), and Tract 3111 (Attachment D) accepting the completed public improvements, certifying the completed private subdivision improvements, releasing the securities for the completed portions, and authorizing the Director of Public Works to accept the remaining improvements and to release the remaining securities once the improvements are deemed complete. DISCUSSION Background The Orcutt Area Specific Plan area (Attachment E) contains several subdivisions which are now complete or nearing completion. Those subdivisions are summarized as follows: Tract 3063-2 (Phase 2 of the Righetti Ranch Subdivision) consists of the creation of 124 lots consisting of: 1. 87 single family lots 2. 32 multi-family residential lots 3. Three small public park lots 4. One private drainage basin lot 5. One private street lot Tract 3066-2 (Phase 2 of the subdivision commonly known as the Jones Subdivision) consists of the creation of 33 lots consisting of: 1. Three mixed-use lots 2. Seven lots for up to 43 condominium units 3. Five common area lots for parking, private streets, and private drive aisles 4. Two common area lots for private open space and drainage 5. Two HOA-owned lots for preservation of creek/biological open space 6. Nine lots for single family homes for subdivider 7. Five lots for the Jones homestead site Packet Page 122 Item 10 Tract 3095 (Imel Ranch Subdivision) consists of the creation of 23 lots consisting of: 1. 18 single-family lots 2. Two private drainage basin lots 3. Two private open space lots, and 4. One public open space lot. Tract 3111 (Pratt Subdivision) consists of the creation of 31 lots consisting of: 1. 30 single-family lots, and 2. One homeowners’ association common area lot. Partial Acceptance of a Portion of Improvements For each of these subdivisions, work has been completed for most of the required public improvements. These improvements include new public streets including Imel Road, Phyliss Way, Hayfield Loop, Kilbern Way and portions or extensions of Ranch House Road, Sponza Drive, Tiburon Way, and Bullock Lane. New roundabouts have been installed at the intersections of Tiburon Way and Ranch House Road, and at Tiburon Way and Righetti Ranch Road. A map showing the locations of these new public street improvements is included as Attachment F. In general, the improvements consist of street construction, street widening, medians, curb, gutter, sidewalks, Class 1 multi-use paths, streetlights, water main and sewer main extensions, fire hydrants, reclaimed water main, storm drain improvements, and landscaping. Each of the draft resolutions includes a partial acceptance of these improvements, accepts the completion of a portion of the required improvements, reduces the securities for the work that is completed, and authorizes the Public Works Director to accept the remaining public improvements once they are deemed complete and to release the remaining securities on behalf of the City Council once the work is completed. Previous Council Action The tentative subdivision map for Tract 3063 (Righetti Ranch) was approved by City Council on May 19, 2015, by Resolution No. 10619 (2015 Series). The final map for Tract 3063-2 (Phase 2 of Righetti Ranch) was approved by City Council on October 1, 2019, by Resolution No. 11047 (2019 Series). The tentative subdivision map for Tract 3066 (Jones Subdivision) was approved by City Council on May 19, 2015 by Resolution No. 10620 (2015 Series). The final map for Tract 3066-2 (Phase 2 of the Jones Subdivision) was approved by City Council on March 21, 2017 by Resolution No. 10779 (2017 Series). The tentative subdivision map for Tract 3095 (Imel Ranch) was approved by City Council on March 20, 2017 by Resolution No. 10773 (2018 Series). The final map for Tract 3095 (Imel Ranch) was approved by City Council on February 5, 2019 by Resolution No. 10977 (2019 Series). Packet Page 123 Item 10 The tentative subdivision map for Tract 3111 (Pratt Subdivision) was approved by City Council on May 1, 2018 by Resolution No. 10884 (2018 Series). The final map for Tract 3111 (Pratt Subdivision) was approved by City Council on April 2, 2019 by Resolution No. 10995 (2019 Series). Policy Context The City Council accepts public improvements and certifies completion of private improvements in accordance with the Subdivision Map Act and the City’s Subdivision Regulations. Public Engagement Public Engagement was completed with the approval of the Tentative Map and the development of the Orcutt Area Specific Plan. CONCURRENCE The Public Works Director and the Utilities Director concur with the recommended action. ENVIRONMENTAL REVIEW There is no environmental review associated with the acceptance of these improvements. Prior Environmental review consisted of the review of the Orcutt Area Specific Plan and its Final Environmental Impact Report (FEIR) in March 2010. Subsequent environmental review included each of the Vesting Tentative Tract Maps, which tiered off the 2010 FEIR, and were analyzed in project-specific Initial Study/Mitigated Negative Declarations. FISCAL IMPACT Budgeted: No Budget Year: N/A Funding Identified: No Fiscal Analysis: Funding Sources Total Budget Available Current Funding Request Remaining Balance Annual Ongoing Cost General Fund N/A State Federal Fees Other: Total Packet Page 124 Item 10 Typical maintenance and operation of newly accepted public facilities will be required for the street and utility improvements. Increasing the maintenance budget for the small, incremental increase in infrastructure to be maintained does not occur with each acceptance of public facilities. The maintenance budget for the improvements is evaluated and adjusted as needed with the City’s adoption of its two-year financial plan. Council action accepting these improvements, however, itself does not have an associated budget increase. ALTERNATIVES Limited alternatives exist only regarding the timing of the acceptance of these improvements. Ultimately, acceptance of the public improvements is required in accordance with the OASP, Tentative Mapp approvals, Department of Real Estate process assumptions, and Homeowners Association CC&R’s. Attachments: a - Draft Resolution - Righetti Phase 2 Acceptance, Tract 3063-2 b - Draft Resolution - Jones Phase 2 Acceptance, Tract 3066-2 c - Draft Resolution - Imel Acceptance, Tract 3095 d - Draft Resolution - Pratt Acceptance, Tract 3111 e - Vicinity Map f-Site Map Packet Page 125 Item 10 R _____ RESOLUTION NO. ________ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ACCEPTING THE COMPLETED PUBLIC IMPROVEMENTS OF TRACT 3063-2; CERTIFYING THE COMPLETED PRIVATE SUBDIVISION IMPROVEMENTS OF TRACT 3063-2; RELEASING THE SECURITIES FOR THE COMPLETED PORTIONS OF TRACT 3063-2; AND AUTHORIZING THE DIRECTOR OF PUBLIC WORKS TO ACCEPT THE REMAINING IMPROVEMENTS AND TO RELEASE THE REMAINING SECURITIES ONCE ALL THE IMPROVEMENTS ARE DEEMED COMPLETE WHEREAS, the City Council made certain findings concerning Tract 3063, as prescribed in Resolution No. 10619 (2015 Series); and WHEREAS, the City Council approved the final map for Tract 3063-2 per Resolution No. 11047 (2019 Series); and WHEREAS, the subdivider has satisfactorily completed the majority of the required public improvements in accordance with City standards, specifications, and the subdivision agreement; and has requested that the City accept of these public improvements for maintenance and operation by the City; and WHEREAS, the subdivider has satisfactorily completed a portion of the private improvements in accordance with City standards, specifications and the approved plans, and has requested that the City certify completion of these private improvements; and WHEREAS, the subdivider has on file the appropriate securities to guarantee the completion of the remaining Phase 2 subdivision improvements as shown on the approved plans. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1. The City Council hereby acceptsa portion of the public improvements for Tract 3063-2, specifically the public improvements for Kilbern Way and Hayfield Loop with the exception of improvements at and in the vicinity of the intersection of Hayfield Loop and Tiburon Way. SECTION 2.The City Council hereby certifies completion of a portion of the required private subdivision improvements within the Tract 3063-2 boundary. SECTION 3.The Faithful Performance securities guaranteeing completion of the on-site and off-site public improvements may be reduced with the approval of the Director of Public Works upon submittal of the following items: 1. Progress record drawings for the completed improvements; and 2. Certification by the Engineer of Record for the completion of the public improvements. Packet Page 126 Item 10 Resolution No. _______ (2020 Series) Page 2 R _____ SECTION 4.The corresponding Labor & Materials security may be released after 90 days from the date of acceptance of the improvements in accordance with Section 66499.7(h) of the California Government Code. SECTION 5.The Director of Public Works is hereby authorized to accept the remaining improvements and to release the remaining securities on behalf of the City Council once the work is completed to the City’s satisfaction. SECTION 6.The security guaranteeing the workmanship and materials may be released by the Director of Public Works upon the successful completion of the 12-month warranty time period from the date of acceptance of the improvements. Upon motion of Council Member ________________, seconded by Council Member _________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ______ day of _______________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on __________________. ____________________________________ Teresa Purrington City Clerk Packet Page 127 Item 10 R _____ RESOLUTION NO. ________ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ACCEPTING THE COMPLETED PUBLIC IMPROVEMENTS OF TRACT 3066-2; CERTIFYING THE COMPLETED PRIVATE SUBDIVISION IMPROVEMENTS OF TRACT 3066-2; RELEASING THE SECURITIES FOR THE COMPLETED PORTIONS OF TRACT 3066-2; AND AUTHORIZING THE DIRECTOR OF PUBLIC WORKS TO ACCEPT THE REMAINING IMPROVEMENTS AND TO RELEASE THE REMAINING SECURITIES ONCE ALL THE IMPROVEMENTS ARE DEEMED COMPLETE WHEREAS, the City Council made certain findings concerning Tract 3066, as prescribed in Resolution No. 10620 (2015 Series); and WHEREAS, the City Council approved the final map for Tract 3066-2 per Resolution No. 10779 (2017 Series); and WHEREAS, the subdivider has satisfactorily completed the majority of the required public improvements in accordance with City standards, specifications, and the subdivision agreement; and has requested that the City accept of these public improvements for maintenance and operation by the City; and WHEREAS, the subdivider has satisfactorily completed the majority of the private improvements in accordance with City standards, specifications and the approved plans, and has requested that the City certify completion of these private improvements; and WHEREAS, the subdivider has on file the appropriate securities to guarantee the completion of the remaining subdivision improvements as shown on the approved plans. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1. The City Council hereby acceptsa portion of the public improvements for Tract 3066-2, specifically the public improvements fronting the tract boundary along Sponza Drive, Ranch House Road, and Tiburon Way, and all utilities withing the Tract boundary. SECTION 2.The City Council hereby certifies completion of the required private subdivision improvements within the Tract 3066-2 boundary. SECTION 3.The Faithful Performance securities guaranteeing completion of the on-site and off-site public improvements may be reduced with the approval of the Director of Public Works upon submittal of the following items: 1. Progress record drawings for the completed improvements; and 2. Certification by the Engineer of Record for the completion of the public improvements. Packet Page 128 Item 10 Resolution No. _______ (2020 Series) Page 2 R _____ SECTION 4.The corresponding Labor & Materials security may be released after 90 days from the date of acceptance of the improvements in accordance with Section 66499.7(h) of the California Government Code. SECTION 5.The Director of Public Works is hereby authorized to accept the remaining improvements and to release the remaining securities on behalf of the City Council once the work is completed to the City’s satisfaction. SECTION 6.The security guaranteeing the workmanship and materials may be released by the Director of Public Works upon the successful completion of the 12-month warranty time period from the date of acceptance of the improvements. Upon motion of Council Member ________________, seconded by Council Member _________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ______ day of _______________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on __________________. ____________________________________ Teresa Purrington City Clerk Packet Page 129 Item 10 R _____ RESOLUTION NO. ________ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ACCEPTING THE COMPLETED PUBLIC IMPROVEMENTS OF TRACT 3095; CERTIFYING THE COMPLETED PRIVATE SUBDIVISION IMPROVEMENTS OF TRACT 3095; RELEASING THE SECURITIES FOR THE COMPLETED PORTIONS OF TRACT 3095; AND AUTHORIZING THE DIRECTOR OF PUBLIC WORKS TO ACCEPT THE REMAINING IMPROVEMENTS AND TO RELEASE THE REMAINING SECURITIES ONCE ALL THE IMPROVEMENTS ARE DEEMED COMPLETE WHEREAS, the City Council made certain findings concerning Tract 3095, as prescribed in Resolution No. 10773 (2017 Series); and WHEREAS, the City Council approved the final map for Tract 3095 per Resolution No. 10977 (2019 Series); and WHEREAS, the subdivider has satisfactorily completed the majority of the required public improvements in accordance with City standards, specifications, and the subdivision agreement; and has requested that the City accept of these public improvements for maintenance and operation by the City; and WHEREAS, the subdivider has satisfactorily completed the majority of the private improvements in accordance with City standards, specifications and the approved plans, and has requested that the City certify completion of these private improvements; and WHEREAS, the subdivider has on file the appropriate securities to guarantee the completion of the remaining subdivision improvements as shown on the approved plans. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1. The City Council hereby accepts the public improvements, including utility installation, for Tract 3095 except for the final street paving which is currently under staff review, and the installation of one streetlight which has not yet been energized. SECTION 2.The City Council hereby certifies completion of the required private subdivision improvements within the Tract 3095 boundary. SECTION 3.The Faithful Performance securities guaranteeing completion of the on-site and off-site public improvements may be reduced with the approval of the Director of Public Works upon submittal of the following items: 1. Progress record drawings for the completed improvements; and 2. Certification by the Engineer of Record for the completion of the public improvements. Packet Page 130 Item 10 Resolution No. _______ (2020 Series) Page 2 R _____ SECTION 4.The corresponding Labor & Materials security may be released after 90 days from the date of acceptance of the improvements in accordance with Section 66499.7(h) of the California Government Code. SECTION 5.The Director of Public Works is hereby authorized to accept the remaining improvements and to release the remaining securities on behalf of the City Council once the work is completed to the City’s satisfaction. SECTION 6.The security guaranteeing the workmanship and materials may be released by the Director of Public Works upon the successful completion of the 12-month warranty time period from the date of acceptance of the improvements. Upon motion of Council Member ________________, seconded by Council Member _________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ______ day of _______________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on __________________. ____________________________________ Teresa Purrington City Clerk Packet Page 131 Item 10 R _____ RESOLUTION NO. ________ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ACCEPTING THE COMPLETED PUBLIC IMPROVEMENTS OF TRACT 3111; RELEASING THE SECURITIES FOR THE COMPLETED PORTIONS OF TRACT 3111; AND AUTHORIZING THE DIRECTOR OF PUBLIC WORKS TO ACCEPT THE REMAINING IMPROVEMENTS AND TO RELEASE THE REMAINING SECURITIES ONCE ALL THE IMPROVEMENTS ARE DEEMED COMPLETE WHEREAS, the City Council made certain findings concerning Tract 3111, as prescribed in Resolution No. 10884 (2018 Series); and WHEREAS, the City Council approved the final map for Tract 3111 per Resolution No. 10995 (2019 Series); and WHEREAS, the subdivider has satisfactorily completed the required public improvements in accordance with City standards, specifications, and the subdivision agreement; and has requested that the City accept of these public improvements for maintenance and operation by the City; and WHEREAS, the subdivider has on file the appropriate securities to guarantee the completion of the remaining subdivision improvements as shown on the approved plans. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1. The City Council hereby accepts the public improvements, including utility installation, for Tract 3111. SECTION 2.The Faithful Performance securities guaranteeing completion of the on-site and off-site public improvements may be reduced with the approval of the Director of Public Works upon submittal of the following items: 1. Progress record drawings for the completed improvements; and 2. Certification by the Engineer of Record for the completion of the public improvements. SECTION 3.The corresponding Labor & Materials security may be released after 90 days from the date of acceptance of the improvements in accordance with Section 66499.7(h) of the California Government Code. SECTION 4.The Director of Public Works is hereby authorized to accept the remaining improvements and to release the remaining securities on behalf of the City Council once the work is completed to the City’s satisfaction. Packet Page 132 Item 10 Resolution No. _______ (2020 Series) Page 2 R _____ SECTION 5.The security guaranteeing the workmanship and materials may be released by the Director of Public Works upon the successful completion of the 12-month warranty time period from the date of acceptance of the improvements. Upon motion of Council Member ________________, seconded by Council Member _________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ______ day of _______________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on __________________. ____________________________________ Teresa Purrington City Clerk Packet Page 133 Item 10 Packet Page 134 Item 10 Packet Page 135 Item 10 Page intentionally left blank. Packet Page 136 Item 10 Department Name: Administration Cost Center:1005 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Greg Hermann, Deputy City Manager Prepared By:Robert Hill, Sustainability & Natural Resources Official SUBJECT:AUTHORIZE A TEMPORARY EXTENSION OF OPEN SPACE EVENING HOURS OF USE PILOT PROGRAM RECOMMENDATION In the absence of recent opportunities to seek City Council direction on next steps for the Open Space Evening Hours of Use Pilot Program (“Pilot Program”) due to the City’s COVID-19 pandemic emergency response, the following near-term actions are recommended: 1. Approve a Resolution (Attachment A) adopting an Addendum to the previously adopted Mitigated Negative Declaration for the Project under the California Environmental Quality Act (Attachment B) and temporarily extending the Pilot Program for one additional season with no other changes and with all programmatic elements and implementation of mitigation measures to continue, and 2. Direct staff to return to City Council in April 2021 following the conclusion of the additional third season of the Pilot Program to receive and file the final summary report and provide direction regarding any future open space evening hours of use that the City Council may wish to consider. DISCUSSION Background The City of San Luis Obispo owns and manages over 4,000 acres of open space lands that feature a trail network totaling over 50 miles for passive recreation purposes. The City’s current Open Space Regulations allow for passive recreational use of these properties from one hour before sunrise until one hour after sunset, unless otherwise approved by the Parks and Recreation Director (SLO Muni Code 12.22; 1998). On August 16, 2016, in response to public testimony regarding a request for reconsideration of the City’s published hours of use for open space, a majority of the City Council directed staff to bring back on a future agenda a project plan for revising the ordinance limiting public access of the open space from dusk to dawn. On February 21, 2017, a majority of the City Council voted (4-1) to receive and file the Project Plan for evaluation of the Open Space hours of use regulations as a Consent Agenda item. Numerous individuals and interested groups provided written public comments, as well as testimony at the hearing. Packet Page 137 Item 11 The City Council provided parameters including eliminating from consideration any extended hours of use at the Bishop Peak Natural Reserve and to consider winter hours up to a level commensurate with summer hours of use. On March 21, 2017, the City Council received and filed the staff-prepared report, An Evaluation of Hours of Use for City of San Luis Obispo Open Space,and conducted a study session to receive public input and testimony regarding Open Space hours of use and regulations. At that meeting, a majority of Council members (4-1) directed staff to bring back an approach for Council consideration that would allow for limited, site specific expanded hours of use, including the possibility of a pilot program that would allow for additional data to be collected and the ability to scale back down, if needed. On January 16, 2018, the City Council approved a two-year pilot program and adopted a Mitigated Negative Declaration pursuant to the California Environmental Quality Act (Harmon, Gomez, Rivoire “Yes” and Pease, Christianson “No”: Council Agenda Report and Council Minutes, January 16, 2018). Pilot Program at Cerro San Luis Natural Reserve - Winters of 2018-19 and 2019-20 In accordance with Council direction and approval, staff implemented a pilot program at the 118- acre Cerro San Luis Natural Reserve (the “Reserve”) that included a detailed and specific project description allowing extended evening hours of use for passive recreational purposes along approximately 4.9 miles of trails during the winter months when daylight savings time is not in effect. The Pilot Program took place during the winter season with the change of daylight savings time for 2018-19 (Sunday, November 4 to Sunday, March 10) and 2019-20 (Sunday November 3 to Sunday March 8). During these time periods, public use was allowed between one hour before sunrise until 8:30 PM. At the conclusion of each year of the Pilot Program, the hours of use for the public returned back to one hour before sunrise through one hour after sunset. No change to the City’s existing Open Space Regulations [Municipal Code 12.22, adopted by Ordinance 1332 § 1 (1998)] was required to implement this limited-duration pilot program over the course of two winter seasons: 12.22.050(B.):Presence in Open Space Lands Restricted to Certain Hours—No Overnight Usage. Open space lands where public access is permitted shall be open to the public from dawn to dusk. It shall be unlawful to enter or remain within such lands between one hour after sunset and one hour before sunrise of the following day without approval from the director (emphasis added). The Pilot Program, therefore, was implemented under the Parks and Recreation Director’s existing authority to approve additional hours of use pursuant to 12.22.050(B). All other provisions of the City of San Luis Obispo’s Open Space Regulations remained in effect. Packet Page 138 Item 11 During the course of the Pilot Program, Ranger Service personnel provided oversight and additional patrol of the Reserve during the published timeframes. Ranger Service and Natural Resources Program staff also deployed an EcoCounterTM device to track frequency of human use and hours of use at the Reserve, as well as a new reservation permitting system in order to ensure that use during expanded hours remained commensurate with existing average daily baseline use of 65 individuals. Four wildlife game cameras were installed, and field surveys were conducted by Terra Verde Environmental to monitor and track nocturnal wildlife species composition and any observable and notable wildlife activity and behavior. A website-based application, or “App” was developed specifically for the Pilot Program by the firm iiiDesign and implemented for interested parties to secure the necessary permit for evening hours of use. A total of 3,160 permits were issued during the 2018-19 season and 2,770 permits were issued during the 2019-20 season. During both seasons, in general, less than the full amount of permits available were reserved during the months of November and January through March. During the holiday season in December, permits were typically fully subscribed, and Ranger Service had to turn away numerous parties interested in accessing the Reserve at the trailhead. The Council Agenda Report from January 16, 2018 stated, “at the conclusion of the pilot program, staff will prepare a summary report of the pilot program for Council’s consideration, and at that time would seek further guidance based on the levels of use during the pilot program and evaluation of the data collected.” Staff have not yet had time or the opportunity to prioritize the preparation of a concluding two year summary report due to the onset of the COVID-19 pandemic and associated resource impacts while staff continue to serve in their capacity as Disaster Service Workers; this notably includes the Sustainability & Natural Resources Official’s role as Liaison Officer within the City’s Emergency Operations Center (EOC). In consideration of the foregoing, an Addendum to the existing Mitigated Negative Declaration (MND) has been prepared to allow for a temporary extension of the Pilot Program through Sunday, March 14, 2021 should the City Council wish to continue the Pilot Program. This will allow for additional monitoring and experience within the construct of a Pilot Program, while allowing adequate time to return to the City Council with the summary report and provide an opportunity to seek further guidance. Policy Context The City’s policy framework for open space management expresses a clear preference for natural resource protection as a primary management goal while allowing passive recreation and other uses as secondary or tertiary priorities when compatible. The following programs, policies, and goals from the Conservation and Open Space Element of the City’s General Plan (2006) are pertinent to the evaluation of the Open Space hours of use issue: 7.0 - Background; 7.2 - Sustainable natural populations; 7.3.3 - Wildlife habitat and corridors, 8.4.2 - Open Space access and restoration; 8.5.1 - Public access; 8.5.5 - Passive Recreation; 8.5.6 - Determination of appropriate uses for City-owned open space; and, Appendix C - Management of Open Space Lands. Packet Page 139 Item 11 Further discussion of this policy framework can be found in the staff-prepared policy analysis, An Evaluation of Hours of Use for City of San Luis Obispo Open Space that was included with the March 21, 2017 City Council Agenda Packet on this item, as well as in the Biological Resources section of the Mitigated Negative Declaration that was adopted by the City Council on January 18, 2018. Public Engagement Staff conducted public engagement activities in accordance with the project plan and the City’s Public Engagement and Noticing Manual during the initial process of preparing and designing the Pilot Program. To better understand stakeholder concerns and preferences, informal interviews and communications were conducted in February 2017 with the Environmental Center of San Luis Obispo (ECOSLO), the Santa Lucia Chapter of the Sierra Club, the Land Conservancy of San Luis Obispo County, Central Coast Concerned Mountain Bikers, SLO Trail Runners, as well as various individuals. This topic generated considerable public interest during the course of 2017 as demonstrated by significant levels of written and verbal comments at the City Council meetings, in print and social media outlets, and with an online petition was submitted to the City Council. Staff has undertaken recent outreach with the same stakeholder groups and interested parties in advance of this City Council agenda item. CONCURRENCE The Parks and Recreation Department, whose Ranger Service staff would provide continued monitoring, education, and enforcement as necessary, concur with the recommendations contained herein. ENVIRONMENTAL REVIEW Existing Environmental Review An Initial Study and Environmental Review was prepared for the proposed pilot program that concluded that significant impacts on the environment could occur, but those impacts would be reduced to less than significant with mitigation measures incorporated. Potentially significant impacts were identified in the area of Biological Resources. Written public comments received into the record in advance of the October 24, 2017 hearing included concerns that it is problematic to conclude that potentially significant impacts in the area of Biological Resources could be mitigated to less than significant levels when our review of pertinent scientific literature found that the “extent and severity of those impacts is unknown.” To address this concern, a new mitigation measure, BIO- 4, was introduced to limit visits to the Reserve to existing average daily baseline levels of 65 individuals during the expanded hours of use under the Pilot Program through the use of an online permitting system. With the inclusion of the additional measure, BIO-4, it was concluded that the Pilot Program would not result in new impacts to biological resources beyond that which is already occurring, even though that long-standing use had been in violation of the City’s existing regulations [see Fat v. County of Sacramento (2002) 97 Cal. App. 4th 1270]. Therefore, potentially significant impacts were characterized as being reduced to less than significant with implementation of a suite of four mitigation measures that included the new permit system. Packet Page 140 Item 11 Next Steps and Current Environmental Review Process Daylight savings time ends this year on November 1st and will resume on March 14, 2021. In the immediate near-term, the City is not in a position to continue the Pilot Program without subsequent environmental review steps because the project description in the City Council’s adopted Mitigated Negative Declaration (MND) was specific that this would be a two-year pilot program with exact dates of implementation indicated. However, an addendum to the existing MND that simply extends the Pilot Program temporarily, for one year only, with no other changes, is permissible without recirculating for a 30-day public review period. The City Council is required to consider and adopt the addendum. An agency may prepare an addendum to an adopted Negative Declaration if only minor technical changes or additions are necessary or if none of the conditions triggering a subsequent Negative Declaration are present. An addendum need not be circulated for public review but can be included in or attached to the adopted Negative Declaration. The decision-making body shall consider the addendum with the Negative Declaration before making a decision on the project. A brief explanation supported by substantial evidence justifying the decision not to prepare subsequent Negative Declaration or EIR should be included in the addendum or elsewhere in the record. (CEQA Deskbook; CEQA Guidelines, Section 15164). In summary, circumstances that would trigger a subsequent review include: substantial changes to the project description; new circumstances or evidence in the record that indicate the severity of impacts would substantially increase; new information of substantial importance, including new identified impacts or mitigation measures are found to not be feasible; or, new mitigation measures are identified that would substantially reduce impacts (CEQA Guidelines, Section 15162). It does not appear that any of the conditions that would trigger a subsequent review are present and an addendum is appropriate. FISCAL IMPACT Budgeted: No Budget Year: 2020-21 Funding Identified: No Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund $6,000 $6,000 State Federal Fees Other: Total $6,000 $6,000 Packet Page 141 Item 11 Direct fiscal impacts associated with the Pilot Program have been relatively minor consisting of expenditures and purchasing of new field equipment, printing costs for the new educational materials and signs, biological surveys, and implementation of reservation-based permit system. To continue the Pilot Program, no further equipment purchases are necessary, and the annualized costs shown in the table, above, consist of contracting for biological surveys and hosting of the website for the reservation-based permit program. These costs are supported by the operating budgets for Ranger Service and Natural Resources Program. It should also be noted that Ranger Service staff resources would continue to be burdened by the additional oversight, patrol, and monitoring efforts necessary to conduct the Pilot Program. As a result, available Ranger Service staff hours and availability for other purposes will be limited. ALTERNATIVES Alternatives that the City Council may wish to consider include, but are not limited to: 1.Request that staff provide additional information, analysis, or changes to the recommended actions herein. 2.Direct staff to take no further action on the Pilot Program this season due to COVID-19 related staffing resource impacts and return to City Council to seek further direction in early 2021.This would allow staff time to fully prepare for a more robust conversation with the City Council, although this may result in uncertainty among the public and Ranger Service would likely still need to provide some level of presence at the trailhead to provide education and enforcement, if necessary. 3.Direct staff to take no further action on the Pilot Program and discontinue future work efforts. Attachments: a - Draft Resolution b - Open Space Hours of Use Pilot Program - Addendum to MND 2020-21 Packet Page 142 Item 11 R _____ RESOLUTION NO. ________ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ADOPTING AN ADDENDUM TO THE MITIGATED NEGATIVE DECLARATION FOR THE TEMPORARY EXTENSION OF A PILOT PROGRAM FOR WINTER OPEN SPACE HOURS OF USE WHEREAS,the City of San Luis Obispo has adopted policies for protection, management, and public use of open space lands and cultural resources acquired by the City; and WHEREAS,the City of San Luis Obispo manages a suite of Open Space properties totaling approximately 4,000 acres for the primary purpose of protecting natural resources, while allowing for passive recreation uses where compatible; and WHEREAS,members of the public provided testimony to the City Council requesting expanded hours of use in City open space during the winter, and a two-year pilot program for winter open space hours of use at the City’s Cerro San Luis Natural Reserve was identified following a Council-directed process; and WHEREAS,on January 18, 2018, the City Council passed Resolution No. 10858 (2018 Series) approving the pilot program and adopting a Mitigated Negative Declaration of environmental impact pursuant to the California Environmental Quality Act; and WHEREAS,an Addendum to the Mitigated Negative Declaration has been prepared to allow for a temporary extension of the pilot program for one season only with no other changes and all programmatic elements and mitigation measures to continue. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of San Luis Obispo as follows: The City Council hereby adopts a Mitigated Negative Declaration of environmental impact for a pilot program for winter open space hours of use at Cerro San Luis Natural Reserve based on the following findings: 1.The pilot program is considered a Project under the California Environmental Quality Act (CEQA) as defined in Public Resources Code §21065 because it represents an activity which may cause either a direct physical change in the environment, or a reasonably foreseeable indirect physical change in the environment, and because it is an activity directly undertaken by a public agency. 2.An Initial Study and Environmental Review was prepared for the pilot program that concludes that significant impacts on the environment could occur, but these impacts will be reduced to less than significant with mitigation measures incorporated. Potentially significant impacts were identified in the area of Biological Resources. These potentially significant impacts are reduced to less than significant with the incorporation of mitigation measures and, therefore, the City Council adopted a Mitigated Negative Declaration on January 18, 2018 by Resolution No. 10858 (2018 Series). Packet Page 143 Item 11 Resolution No. _____ (2020 Series) Page 2 R ______ 3.An Addendum to the Mitigated Negative Declaration has been prepared in order to allow for a temporary extension of the pilot program for one season only with no other changes and all programmatic elements and mitigation measures to continue. An Addendum is the appropriate document under CEQA Guidelines §15164(b) because “only minor technical changes or additions are necessary”and none of the conditions described in §15162 calling for the preparation of a subsequent environmental review have occurred. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of _____________________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on _______________________. ____________________________________ Teresa Purrington City Clerk Packet Page 144 Item 11 1 ADDENDUM TO THE MITIGATED NEGATIVE DECLARATION FOR THE CITY OF SAN LUIS OBISPO’S OPEN SPACE WINTER HOURS OF USE PILOT PROGRAM NOVEMBER 2020 A. INTRODUCTION This document is an Addendum to the Mitigated Negative Declaration (“MND”) for the City of San Luis Obispo’s Open Space Winter Hours of Use Pilot Program (“Pilot Program”). The MND was adopted by the City of San Luis Obispo on January 18, 2018, pursuant to City Council Resolution No. 10858 (2018 Series). The Addendum evaluates a minor change in the project description, which consists of a temporary extension of the Pilot Program for one season only with no other changes and with all programmatic elements and mitigation measures to continue. Because there are no new significant impacts or mitigation measures as a result of this updated analysis, an Addendum is the appropriate CEQA document, as further described herein. B. UPDATED PROJECT INFORMATION In accordance with City Council direction and approval, staff implemented a Pilot Program at the 118-acre Cerro San Luis Natural Reserve (the “Reserve”) that included a detailed and specific project description allowing extended evening hours of use for passive recreational purposes along approximately 4.9 miles of trails during the winter months when daylight savings time is not in effect. The Pilot Program took place during the winter season with the change of daylight savings time for 2018-19 (Sunday, November 4 to Sunday, March 10) and 2019-20 (Sunday November 3 to Sunday March 8). During these time periods, public use was allowed between one hour before sunrise until 8:30 PM. At the conclusion of each year of the pilot program, the hours of use for the public returned back to one hour before sunrise through one hour after sunset. No change to the City’s existing Open Space Regulations [Municipal Code 12.22, adopted by Ordinance 1332 § 1 (1998)] was required to implement this limited-duration pilot program over the course of two winter seasons: 12.22.050(B.):Presence in Open Space Lands Restricted to Certain Hours—No Overnight Usage. Open space lands where public access is permitted shall be open to the public from dawn to dusk. It shall be unlawful to enter or remain within such lands between one hour after sunset and one hour before sunrise of the following day without approval from the director (emphasis added). The Pilot Program, therefore, was implemented under the Parks and Recreation Director’s existing authority to approve additional hours of use pursuant to 12.22.050(B). All other provisions of the City of San Luis Obispo’s Open Space Regulations remained in effect. During the course of the Pilot Program, Ranger Service personnel provided oversight and additional patrol of the Reserve during the published timeframes. Ranger Service and Natural Resources Program staff also deployed an EcoCounterTM device to track frequency of human use and hours of use at the Reserve, as well as a new reservation permitting system in order to ensure Packet Page 145 Item 11 2 that use during expanded hours remained commensurate with existing average daily baseline use of 65 individuals. Four wildlife game cameras were installed, and field surveys were conducted by Terra Verde Environmental to monitor and track nocturnal wildlife species composition and any observable and notable wildlife activity and behavior. C. PREVIOUS CEQA DOCUMENTATION The City Council adopted the MND and approved the Pilot Program on January 18, 2018, pursuant to City Council Resolution No. 10858 (2018 Series). A Notice of Determination (NOD) was prepared and filed, and there were no legal challenges to the adequacy of the MND during the 30- day statute of limitations associated with the NOD, pursuant to CEQA (PRC Section 21167 and CEQA Guidelines Section 15094). The MND concluded that potentially significant impacts to Biological Resources could occur but would be less than significant with mitigation measures incorporated. These measures are as follows: BIO-1 Wildlife Monitoring and Adaptive Management.City staff and biological consultants shall conduct regular, weekly monitoring and evaluation of both human use and wildlife use of the Reserve. This will be done by deploying an EcoCounterTM device to track frequency of human use and hours of use at the Reserve, as well as four wildlife game cameras (Bushnell or similar model), cover boards, detection equipment such as a bat detector (Petterson D500x), and field surveys to monitor and track nocturnal wildlife composition, activity, and behavior. Regular evening patrols of the trails within the Reserve by Ranger Service staff will also provide anecdotal observations. BIO-2 Wildlife Water Sources.The Reserve features a developed spring proximate to the historic Lemon Grove. This spring will be used to gravity feed water to two wildlife- friendly “guzzlers,” or troughs, while still returning flow to the natural drainage path of the spring. This will provide additional watering sources that will benefit wildlife by decreasing the level of energy required to find water and decreasing competition among different species for water. BIO-3 Public Information and Education Materials.City staff shall develop additional information and educational materials for the public that is specific to this pilot program. These materials will re-iterate the City’s rules and regulations in effect, as well as highlight the sensitivity of evening use and potential for wildlife interactions and impacts. These informational materials will be available on the City’s website, on the main kiosk at the entrance of the Reserve, and on pamphlets that can be handed out or placed in a rack on the kiosk. BIO-4 Evening Use Permitting System.City staff shall develop an online internet-based permitting system in order to ensure that evening use (from one hour after sunset until 8:30 PM) during the pilot program period is kept at or below existing average daily baseline use of 65 individuals. Individuals will be required to have evidence that they have the required permit in their possession. Individuals that are stopped by Ranger personnel and do not possess a permit will be subject to citation under municipal code section 12.22.050(B). The status of implementation of these mitigation measures is as follows: Packet Page 146 Item 11 3 1. Wildlife surveys were conducted by qualified biologists with the firm Terra Verde Environmental on October 29, 2018, December 5, 2018, January 24, 2019, and February 28, 2019 during the course of the first season of the Pilot Program, and ongoing monitoring and patrol by Ranger Service staff continued throughout the Pilot Program. Wildlife game cameras were deployed and monitored by Ranger Service staff and regularly checked for data collection. Observed wildlife species included barn owl, great-horned owl, sharp- shinned hawk, deer, coyote, woodrats, and mice. An EcoCounterTM device that uses infrared technology to capture use data was installed at the Marsh Street trailhead in a location chosen to capture single users at a time (as opposed to multiple hikers or bikers together). 2. Two wildlife watering stations, or guzzlers, were installed by Ranger Service staff proximate to the Lemon Grove and the eucalyptus grove, together with remote-sensing wildlife game cameras. Wildlife species observations captured on the City’s cameras have been similar in composition to that observed by Terra Verde Environmental during their field work. 3. Public information and educational materials were prepared and installed at the Marsh Street trailhead kiosk by Ranger Service staff, including a new “Winter Evening Access” panel, as well as clear postings for allowable hours of use and the need to use the permit system. 4. A website-based application, or “App” was developed specifically for the Pilot Program by the firm iiiDesign and implemented for interested parties to secure the necessary permit for evening hours of use. A total of 3,160 permits were issued during the 2018-19 season and 2,770 permits were issued during the 2019-20 season. During both seasons, in general, less than the full amount of permits available were reserved during the months of November and January through March. During the holiday season in December, permits were typically fully subscribed and Ranger Service had to turn away numerous parties interested in accessing the Reserve at the trailhead. D. ADDENDUM REQUIREMENTS The Addendum has been prepared in accordance with the relevant provisions of the California Environmental Quality Act (CEQA) of 1970 (as amended) and the State CEQA Guidelines as implemented by the City of San Luis Obispo. According to §15164(b) of the State CEQA Guidelines, an Addendum to an adopted negative declaration is the appropriate environmental document in instances when “only minor technical changes or additions are necessary or none of the conditions described in Section 15162 calling for the preparation of a subsequent negative declaration have occurred”. Section 15162(a) of the State CEQA Guidelines states that no subsequent Negative Declaration shall be prepared for a project unless the lead agency determines, on the basis of substantial evidence in the light of the whole record, one or more of the following: (1) Substantial changes are proposed in the project which will require major revisions of the previous EIR or Negative Declaration due to the involvement of Packet Page 147 Item 11 4 new significant environmental effects or a substantial increase in the severity of previously identified significant effects; (2) Substantial changes occur with respect to the circumstances under which the project is undertaken which will require major revisions of the previous EIR or Negative Declaration due to the involvement of new significant environmental effects or a substantial increase in the severity of previously identified significant effects; or (3) New information of substantial importance, which was not known and could not have been known with the exercise of reasonable diligence at the time the previous EIR or Negative Declaration was adopted, shows any of the following: (A) The project will have one or more significant effects not discussed in the previous EIR or Negative Declaration; (B) Significant effects previously examined will be substantially more severe than shown in the previous EIR or Negative Declaration; (C) Mitigation measures or alternatives previously found not to be feasible would in fact be feasible, and would substantially reduce one or more significant effects of the project, but the project proponents decline to adopt the mitigation measure or alternative; or (D) Mitigation measures or alternatives which are considerably different from those analyzed in the previous EIR or Negative Declaration would substantially reduce one or more significant effects on the environment, but the project proponents decline to adopt the mitigation measure or alternative. This Addendum does not require circulation because it does not provide significant new information that changes the adopted MND in a way that deprives the public of a meaningful opportunity to comment upon a substantial adverse environmental effect of the project or a feasible way to mitigate or avoid such an effect. This Addendum includes this introduction and a description of the proposed actions addressed in the Addendum as they related to the previously approved project. The CEQA documentation for this project, including this Addendum and the adopted MND, are available for review on the City’s website at www.slocity.org. E. REASONS WHY AN ADDENDUM IS APPROPRIATE Subsequent to the approval of the Pilot Project and the adoption of the MND, the City of San Luis Obispo proceeded to implement the Pilot Program over the course of two winter seasons when daylight savings time was not in effect. In considering the temporary extension of the Pilot Program for one additional season, with no other changes and with all programmatic elements and mitigation measures to continue, it does not appear that any of the conditions described in CEQA Packet Page 148 Item 11 5 Guidelines 15162 are present. No substantial changes to the project resulting in new significant impacts are proposed; no substantial changes with respect to the circumstances under which the project is undertaken have occurred that would result new significant environmental effects or increase the severity of previously identified significant effects; no new information of substantial importance has been brought forward and mitigation measures have been feasibly implemented; and, no new mitigation measures that reduce significant effects have been identified. The temporary extension of the Pilot Program does not materially change the findings and conclusions of the MND, making a supplemental environmental review unnecessary pursuant to Section 15162 of the CEQA Guidelines. F. DETERMINATION In accordance with Section 15164 of the CEQA Guidelines, the City of San Luis Obispo (City) has determined that this Addendum to the adopted MND is necessary to temporarily extend the Pilot Program for one additional season because the project description contained in the adopted MND was specific as to the date ranges for implementation. The City has reviewed and considered the information contained in this Addendum and finds that the preparation of subsequent CEQA analysis that would require public circulation is not necessary or required. Packet Page 149 Item 11 Page intentionally left blank. Packet Page 150 Item 11 Department Name: Community Development Cost Center:4008 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:NA FROM: Michael Codron, Community Development Director Prepared By:Rachel Cohen, Associate Planner SUBJECT:AUTHORIZATION TO SUBMIT AN APPLICATION FOR REGIONAL EARLY ACTION PLANNING (REAP) GRANTS PROGRAM RECOMMENDATION Approve a Resolution (Attachment A) authorizing an application for and entering into agreements regarding Regional Early Action Planning (REAP) grant funds (Attachment B). DISCUSSION Background On February 27, 2020, the California Department of Housing and Community Development (Department) released a Notice of Funding Availability (NOFA) for approximately $118,750,000 as part of the Regional Early Action Planning Grant Program (REAP). REAP is made available as a portion of the Local Government Planning Support Grants Program pursuant to Chapter 3.1 of Health and Safety Code (Sections 50515 to 50515.05) (Chapter 159, Statutes of 2019). The principal goal of REAP is to make funding available to Councils of Governments (COGs) and other regional entities for the preparation, adoption, and implementation of plans and processes that accelerate housing production and facilitate compliance in implementing the sixth cycle of the Regional Housing Needs Allocation (RHNA). REAP is part of the broader Program formerly known as the Local Government Planning Support Grants Program, which was established as part of the 2019-20 Budget Act. The 2019-20 Budget Act provides a spectrum of support, incentives, resources and accountability to meet California’s housing goals. Some specific elements include: •Planning Support (local and regional planning grants) •Incentives (Pro-housing preference and infill incentive grants) •Funding Resources •Accountability (penalties for noncompliant housing plans) •Reform (collaborative processes to reform regional housing needs) The Local Government Planning Support Grants Program provides one-time grant funding to regions and jurisdictions for technical assistance, preparation and adoption of planning documents, and process improvements. The over-arching goals of the Program are to (1) accelerate housing production; and (2) facilitate compliance to implement the sixth cycle of the regional housing need assessment (RHNA). Packet Page 151 Item 12 The program provides grants through a non-competitive, over-the-counter process to eligible local governments that have met specific requirements. The City of San Luis Obispo is eligible for funding as it has met these specific requirements. One of the required attachments in the REAP Application (Attachment A) is to provide a signed resolution (Attachment B) authorizing application for, and receipt of funds. Unlike another recent Local Government Planning Support Grant that the City has applied for (LEAP), REAP funding is provided through California Central Coast’s Council of Government. California Central Coast’s Council of Governments includes: Association of Monterey Bay Area Governments (AMBAG), Council of San Benito County Governments (SBCOG), Santa Barbara County Association of Governments (SBCAG) and San Luis Obispo Council of Governments (SLOCOG).A multiagency group comprising of representatives from each of these region’s five counties were chosen to administer approximately $8 million in housing planning funds dedicated to the Central Coast region. AMBAG was selected to serve as the fiscal agent of the group and will allocate the housing planning funds to SLOCOG to be distributed within San Luis Obispo County. As such, representatives from both AMBAG and SLOCOG must also sign the attached resolution (Attachment B) and will do so after Council has approved and signed. Policy Context Seeking alternative funding sources and applying to available grant opportunities is a theme commonly referenced throughout the City’s Housing Element. HE Goal 6 is Housing Production, which specifically states “Plan for new housing to meet the full range of community housing needs.” HE Program 6.20 states, “Continue to financially assist in the development of housing affordable to extremely-low, very-low, low or moderate income households during the planning period using State, Federal and local funding sources, with funding priority given to projects that result in the maximum housing benefits for the lowest household income levels.” Housing Element Goal 6 and Program 6.20 align with the purpose of the REAP grant, as it is intended to help local governments accelerate housing production. City staff is currently reviewing ways in which the funding can be used for infrastructure planning necessary to support new housing and new residents or implementing new programs outlined in the Housing Element Update, such as updating the Subdivision Regulations or development of the Missing Middle Housing program. Additionally, the Financial Management Manual, Section 740, Grant Management Policy, discusses the importance of grant programs in accomplishing City goals and objectives. It also outlines that Council is to approve all grant applications in excess of $5,000 and delegate receipt and contract execution to the City Manager if delegation is allowed by the grantor agency. Public Engagement As this is authorization to apply for grant funding, no public engagement is required. However, if the City is awarded funds for program(s) to support future housing production, public engagement may be required. Packet Page 152 Item 12 ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: No Budget Year: 20220-21 Funding Identified: Yes Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Grant Funding General Fund State $283,003 Federal Fees Other: Total $283,003 The California Central Coast’s Council of Governments determined available funding allocations for public jurisdictions based on population size. The City of San Luis Obispo is eligible to receive $283,003. City staff intends on applying for all $283,003. If awarded, this grant will have a positive fiscal impact, as it will reduce the fiscal burden on the General Fund to fund infrastructure planning or implementation of Housing Element programs. ALTERNATIVES 1.Continue the recommendation to a later meeting.This alternative is not recommended as the funding will be available early 2021, which would allow City staff to begin reimbursement for infrastructure planning or implementation of Housing Element update programs. 2.Deny the recommendation.The Council may deny staff’s recommendation to apply for grant funding, based on findings of inconsistency with City policies and other applicable City regulations. Attachments: a - Draft Resolution b - Regional Early Action Planning Grant Application Packet Page 153 Item 12 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, AUTHORIZING AN APPLICATION FOR AND ENTERING INTO AGREEMENTS REGARDING REGIONAL EARLY ACTION PLANNING (REAP) GRANT FUNDS WHEREAS, Governor Gavin Newsom signed Assembly Bill 101 in September 2019, which established the Local Government Planning Support Grants Program that allocates $125 million in housing planning funds to regional entities throughout the state; and WHEREAS, the California Department of Housing and Community Development (HCD) has been assigned as the state agency overseeing this program; and WHEREAS,the provisions of AB 101 require the California Central Coast’s Councils of Government form a multiagency group comprising of three representatives from each of the region’s five counties to administer approximately $8 million in housing planning funds dedicated to the Central Coast region (the “Housing Planning Funds”); and WHEREAS, the Central Coast Housing Working Group has been established as the multiagency working group to administer a portion of the Housing Planning Funds pursuant to AB 101; and WHEREAS, the Association of Monterey Bay Area Governments (AMBAG) will serve as the fiscal agent of the Central Coast Housing Working Group; and WHEREAS, AMBAG will use three percent of the AB 101 Central Coast Regional Funding to administer the mega regional grant program, staff the Central Coast Housing Working Group, and provide required reporting and oversight of the grant program from 2020 to 2024; and WHEREAS, AMBAG will allocate a portion of AB 101 Housing Planning Funds to the four COGs in the Central Coast area: AMBAG, the San Luis Obispo Council of Governments (SLOCOG), the Santa Barbara County Association of Governments (SBCAG), and the Council of San Benito County Governments (SBCOG); and WHEREAS, the City of San Luis Obispo is eligible to submit a request for allocation of a portion of the Housing Planning Funds from AMBAG; and WHEREAS, the amount allocated to AMBAG is based on the allocation method approved by the Central Coast Housing Working Group; and WHEREAS, the amounts allocated to City of San Luis Obispo will be based on the allocation method approved by AMBAG; and Packet Page 154 Item 12 Resolution No. _____ (2020 Series) Page 2 R ______ WHEREAS, AMBAG shall approve allocation requests subject to the terms and conditions of eligibility, guidelines, Notices of Funding Availability, and program requirements. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1.The City of San Luis Obispo is hereby authorized to request an allocation not to exceed $283,003 from the Association of Monterey Bay Area Governments which acts on behalf of the Central Coast Housing Working Group to administer the AB 101 Central Coast Regional Early Action Planning (REAP) Grant Funding. Packet Page 155 Item 12 Resolution No. _____ (2020 Series) Page 3 R ______ SECTION 2.The City of San Luis Obispo is hereby authorized to enter into necessary agreements, and take further actions as may be necessary to give effect to this resolution, such as executing amendments to the grant application or grant agreements and approving the funding application with AMBAG and SLOCOG for REAP grant funding. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this ____ day of _____________ 2020. ____________________________________ Mayor Heidi Harmon ASSOCIATION OF MONTEREY BAY CITY OF SAN LUIS OBISPO: AREA GOVERNMENTS: ________________________________ ____________________________________ Derek Johnson, City Manager Maura F. Twomey, Executive Director Association of Monterey Bay Area Governments ATTEST: SAN LUIS OBISPO COUNCIL OF GOVERNMENTS: _________________________________ ____________________________________ Teresa Purrington, City Clerk Pete Rodgers, Executive Director San Luis Obispo Council of Governments APPROVED AS TO FORM: _________________________________ J. Christine Dietrick, City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on _____________________________. ____________________________________ Teresa Purrington, City Clerk Packet Page 156 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application Deadline: December 9th, 2020 The applicant is applying to the Association of Monterey Bay Area Governments (AMBAG) for a grant authorized under the Regional Early Action Planning Grants (REAP) provisions pursuant to Health and Safety Code Sections 50515 to 50515.05. The grant is to be used for technical assistance, preparation, and adoption of planning documents and process improvements to accelerate housing production and facilitate compliance to implement the sixth cycle of the regional housing needs allocation. In order to be considered for funding, all sections of this application, including attachments, must be complete and accurate. All applicants must submit the following to AMBAG by December 9, 2020 in order to be considered for the award: 1. A completed application 2. A fully executed resolution authorizing application for, and receipt of funds (see Attachment 1 for template resolution). 3. A fully executed Government Agency Taxpayer ID Form (see Attachment 2). All applications must be submitted electronically to AMBAG by email to phierling@ambag.org and copied to Sara Sanders at ssanders@slocog.org. No hard copies will be accepted. Contact: If you have questions regarding this application or REAP, contact Paul Hierling at phierling@ambag.org or 831- 264-5092. Packet Page 157 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application 1 San Luis Obispo Council of Governments (SLOCOG) Jurisdiction Funding: On June 3rd, 2020, the SLOCOG Board of Directors directed staff to allocate REAP funds to jurisdictions throughout the SLOCOG region based on the jurisdiction’s proportion of the most recent Regional Housing Needs Allocation (RHNA) allocation. Jurisdictions are eligible for the following amounts: Jurisdiction Grant Amount Available Arroyo Grande $ 104,053 Atascadero $ 104,053 Paso Robles $ 152,003 Grover Beach $ 78,643 Morro Bay $ 78,643 Pismo Beach $ 78,643 San Luis Obispo $ 283,003 County of San Luis Obispo $ 283,003 A. Applicant Information Complete the following Applicant information Agency Name Agency Type Applicant’s Mailing Address City State California Zip Code County Website Authorized Representative Name Authorized Representative Title Phone Fax Email Contact Person Name Contact Person Title Phone Fax Email Grant Amount $ Packet Page 158 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application 2 B. Threshold Requirements All applicants must meet all of the following threshold criteria to be eligible for an award. 1. Does the application demonstrate a nexus to accelerating housing production? Yes No 2. Does the application include a completed and signed resolution See attachment 1, “Template Resolution” Yes No 3. Does the address on the Government Agency Taxpayer ID Form exactly match the address listed above? See attachment 2, “Government Agency Taxpayer ID Form” Yes No As the official designated by the governing body, I hereby certify that if approved by AMBAG for a suballocation of funding through the Regional Early Planning Program (REAP), the [Insert Agency Name Here] assumes the responsibilities specified in this application and certifies that the information statements and other content contained in this application are true and correct. Signature: ________________________________ Name: ___________________________________________ Date: _____________________Title: ___________________________________________________________ Packet Page 159 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application 3 C. Eligible Activities Checklist Check at least one or more eligible project activity. Accommodating development of housing and infrastructure that accelerates housing production that aligns with state planning priorities, housing, transportation, equity, and climate goals Implementing sustainable communities strategies related to housing planning and accelerating housing production Establishing Prohousing Policies pursuant to Government Code section 65589.9 Providing technical assistance in improving housing permitting processes, tracking systems, and planning tools Establishing regional or countywide housing trust funds for affordable housing (e.g. planning activities and processes, guidelines, charters) Performing infrastructure planning, including sewers, water systems, transit, roads, or other public facilities necessary to support new housing and new residents Performing feasibility studies to determine the most efficient locations to site housing consistent with Government Code sections 65040.1 (State Planning Priorities) and 65080 (Regional Transportation Plans) Covering the costs of temporary staffing or consultant needs associated with eligible activities Covering the cost of technical assistance, planning, temporary staffing, or consultant needs associated with updating local planning and zoning documents, expediting application processing, and other actions to accelerate additional housing production Reimbursing the cost of approved and eligible costs incurred for work after October 1, 2019 Packet Page 160 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application 4 D. Project Description Provide a description of the project scope and tasks including a description of the project’s impact on accelerating housing production. Indicate how your project addresses regional housing issues that affect the Central Coast. Include whether plans will be adopted. If consultants will be used, identify what tasks they will be responsible for. Use Appendix A if additional space is needed. Packet Page 161 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application 5 E. Project Timeline and Budget Include tasks, budget amounts, dates and deliverables. Indicate what tasks will be completed by consultant, and include dates for draft and final deliverables if applicable. Budget must account for full amount the jurisdiction is eligible to apply for. Include project location if different from applicant’s mailing address. All tasks and spending must be completed by November 1, 2023. Project Title: Task Budget Start Date End Date Description and Deliverables Total: Packet Page 162 Item 12 Attachment 1: Template Resolution A RESOLUTION OF THE BOARD OF DIRECTORS OF THE [INSERT APPLICANT AGENCY NAME HERE] TO APPROVE APPLYING FOR AND ENTERING INTO AGREEMENTS FOR THE REGIONAL EARLY ACTION PLANNING GRANT RECITALS WHEREAS, Governor Gavin Newsom signed Assembly Bill 101 in September 2019, which established the Local Government Planning Support Grants Program which allocates $125 million in housing planning funds to regional entities throughout the state; and WHEREAS, the California Department of Housing and Community Development (HCD) has been assigned as the state agency overseeing this program; and WHEREAS, the provisions of AB 101 require the California Central Coast’s Councils of Government form a multiagency group comprising three representatives from each of the region’s five counties to administer approximately $8 million in housing planning funds dedicated to the Central Coast region; and WHEREAS, the Central Coast Housing Working Group has been established as the multiagency working group to administer these funds pursuant to AB 101; and WHEREAS, the Association of Monterey Bay Area Governments (AMBAG) will serve as the fiscal agent of the Central Coast Housing Working Group and will staff the group; and WHEREAS, AMBAG will use three percent of the AB 101 Central Coast regional funding to administer the mega regional grant program, staff the Central Coast Housing Working Group, provide required reporting, and provide oversight of the grant program from 2020 to 2024; and WHEREAS, AMBAG will allocate AB 101 housing planning funds to the four COGs in the Central Coast area: AMBAG, the San Luis Obispo Council of Governments, the Santa Barbara County Association of Governments, and the Council of San Benito County Governments; and WHEREAS, the [insert Grantee Agency name here] is eligible to submit a request for allocation for a portion of Central California AB 101 housing planning funds from AMBAG; and Packet Page 163 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application WHEREAS, the amounts allocated to the Association of Monterey Bay Area Governments (AMBAG) are based on the allocation method approved by the Central Coast Housing Working Group; and WHEREAS, the amounts allocated to [insert Grantee Agency name here] will be based on the allocation method approved by AMBAG; and WHEREAS, AMBAG shall approve allocation requests subject to the terms and conditions of eligibility, guidelines, Notices of Funding Availability, and program requirements. THEREFORE, BE IT RESOLVED: 1. The [insert Grantee Agency name here] is hereby authorized to request an allocation not to exceed $ [Amount] from the Association of Monterey Bay Area Governments which acts on behalf of the Central Coast Housing Working Group, and 2.The [insert Grantee Agency name here] is hereby authorized to enter into agreements, and take further actions as may be necessary to give effect to this resolution, such as executing amendments and approving funding applications with the Association of Monterey Bay Area Governments and [insert local Council of Governments name here] for REAP grant funding. __________________________________ Maura F. Twomey Executive Director Association of Monterey Bay Area Governments __________________________________ Pete Rodgers Executive Director The San Luis Obispo Council of Governments __________________________________ Name [Insert title of Council/Board Chair/Supervisor] Grantee Agency __________________________________ Name [Insert title of Executive Director/City Manager/CAO of Applicant Grantee Agency] Grantee Agency Packet Page 164 Item 12 Financial Information System for California (FI$Cal) GOVERNMENT AGENCY TAXPAYER ID FORM 2000 Evergreen Street, Suite 215 Sacramento, CA 95815 www.fiscal.ca.gov 1-855-347-2250 The principal purpose of the information provided is to establish the unique identification of the government entity. Instructions: You may submit one form for the principal government agency and all subsidiaries sharing the same TIN. Subsidiaries with a different TIN must submit a separate form. Fields bordered in red are required. Hover over fields to view help information. Please print the form to sign prior to submittal. You may email the form to: vendors@fiscal.ca.gov, or fax it to (916) 576-5200, or mail it to the address above. Principal Government Agency Name Remit-To Address (Street or PO Box) City State Zip Code+4 Government Type:City County Federal Employer Identification Number (FEIN) List other subsidiary Departments, Divisions or Units under your principal agency's jurisdiction who share the same FEIN and receives payment from the State of California. Dept/Division/Unit Name Complete Address Dept/Division/Unit Name Complete Address Dept/Division/Unit Name Complete Address Dept/Division/Unit Name Complete Address Contact Person Phone number Signature Special District Other (Specify) Federal Title Email Address Date Attachment 2: Government Agency Taxpayer ID Form Packet Page 165 Item 12 Regional Early Action Planning (REAP) Suballocation Grant Application Appendix A Use this area for additional information if necessary. Packet Page 166 Item 12 Department Name: Administration Cost Center:1001 For Agenda of:November 17, 2020 Placement:Business Estimated Time:30 Minutes FROM: Derek Johnson, City Manager Prepared By:Victoria Tonikian, Interim Executive Assistant to the City Manager / Fiscal Officer SUBJECT:CONSIDERATION OF THE DIVERSITY, EQUITY AND INCLUSION TASK FORCE RECOMMENDATIONS OF GRANT FUNDING TO HIGH-IMPACT DE&I PROGRAMS RECOMMENDATION 1. As recommended by the Diversity, Equity and Inclusion Task Force approve the 2020-21 Notice of Funding Availability for High-Impact DE&I programs grant funding allocations in the amount of $109,800 (Attachment A); and 2.Authorize the City Manager to execute agreements with each grant recipient. DISCUSSION Background At the July 7, 2020 City Council meeting, Council approved the creation of a Diversity, Equity, and Inclusion Task Force (DEI-TF) as part of a wider effort to help make the City an inclusive and safe community for everyone. The DEI-TF is comprised of 11 SLO County residents and Council Member Erica A. Stewart with staff support from City Manager Derek Johnson and consultants Dale Magee and Beya Makekau. The objectives of the DEI-TF are to (Full Objectives and Scope): 1. Support the work of DE&I Providers that support marginalized communities with direct funding for proven or promising impactful, sustainable projects; and 2. Build a framework / potential scope for a 2021-23 DE&I-focused Major City Goal; and 3. Provide recommendations on the role and function of the Human Relations Commission in relation to DE& I efforts. Notice of Funding Availability for High-Impact DE&I Programs (DEI NOFA) As highlighted above, one of the main objectives of the DEI-TF is to support the work of DE&I Providers with direct funding for proven or promising projects. The purpose of the DE&I funding is to enhance the sense of belonging for all people in our community and support local projects, programs, or initiatives that contribute in creating a San Luis Obispo that is welcoming, inclusive, equitable, and safe. Packet Page 167 Item 13 This funding is focused on narrowing equity gaps that have disproportionately impacted marginalized communities. These gaps include, but are not limited to: 1.Physical and mental health services 2.Education 3.Housing 4.Criminalization 5.Food security 6.Community representation DEI NOFA Process In September of 2020, the DEI-TF formally launched the DEI NOFA process by advertising the availability of $120,000 in grant funds and information regarding timeline and available funds for application submittals. DEI NOFA applications were due to the City on October 22, 2020. The City received grant funding requests from 20 agencies requesting funding totaling $640,719, which amounted to $520,719 more than the available funding. Attachment B includes a summary of the applications submitted to the City. DEI-TF Subcommittee Review Process Due to conflicts of interest, of the 12 DEI-TF members, seven members were eligible to review request for funding applications. Six members participated on two review subcommittees. Each subcommittee reviewed a different set of 10 applications. The DEI-TF convened two subcommittees, each with 3 members, to review grant applications and made preliminary funding recommendations in the amount of $120,000. The subcommittees met individually on October 28th and 29th and November 3rd and 4th. The subcommittee members utilized funding priorities outlined in the DEI NOFA, including serving a significant population of City residents, to guide their funding recommendations. Funding Recommendations On November 5, 2020, the DEI NOFA subcommittees presented preliminary grant recommendations to the full, eligible DEI-TF at a public hearing. Taskforce Members Campbell, Kolkailah, Kozler, Velasco-Vargas and Vice Chair Boyer were recused due to conflicts regarding one or more of the applications. On a vote of 7-0-5 (with five Members recused) the DEI-TF voted to forward funding recommendations on XX applications for a total amount of 109,800. (Attachment A. Grant Contracts Upon Council approval of DEI NOFA funding allocations, the City will enter into a contract with each organization that has been awarded grant funding. City staff will monitor the contracts throughout the year. Previous Council Action At the July 7, 2020 City Council meeting, the Council approved the creation of a Diversity, Equity, and Inclusion Task Force as part of a wider effort to help make the City an inclusive and safe community for everyone. The creation of the DEI-TF highlighted the priority of the City Packet Page 168 Item 13 Council to commit resources to advancing diversity, equity and inclusion throughout the City of San Luis Obispo. Public Engagement Public outreach was conducted via e-notifications, social media, print ad and direct contact during the application period which was open from September 18, 2020 through October 22, 2020. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: Yes Budget Year: 2020-2021 Funding Identified: Yes Fiscal Analysis: Funding Sources Total Budget Available Annual Ongoing Cost Total Project Cost General Fund $120,000 $0 $ State Federal Fees Other: Total $120,000 $0 $ During the adoption of the 2019-21 Financial Plan Supplement and 2020-21 Budget, the City Council allocated a total of $160,000 towards the advancement of Diversity, Equity, and Inclusion in the City of San Luis Obispo. Of the $160,000, $120,000 is available to award to the grant recipients as $40,000 was allocated for Project Management and Expertise related to Diversity, Equity, and Inclusion efforts at the August 18, 2020 City Council Meeting. ALTERNATIVES 1. The Council may modify the proposed grant funding amounts. 2. The Council may choose to fund eligible DEI NOFA applications not recommended by the DEI-TF. 3.The Council may continue consideration of funding for the 2020-21 Fiscal Year. Direction should be given to staff regarding additional information necessary to make a final funding decision. Packet Page 169 Item 13 Attachments: a - Final Funding Recommendations b - Applications at a Glance Packet Page 170 Item 13 Organization Program Requested Amount Recommende d Amount Recommendation Notes Literacy for Life General operating funds $10,000 $10,000 Central Coast Coalition for Undocumented Student Success Community Summit - in SLO $6,000 $10,200 Increase speaker stipends, marketing, impact assessment R.A.C.E. Matters "Belonging 2021" - multimedia arts experience centered on Black community, inclusion/action for all $27,600 $32,600 Fully fund marketing line item SLO International Film Festival The Change Makers. Film Festival spotlighting BIPOC filmmakers $7,500 $7,500 $51,100 $60,300 Diversity Coalition San Luis Obispo County Multicultural Center, planning, early operations Diversity Education & Training $100,000 $10,000 Fund SLOHS, Laguna MS, potential SLO City-based education programs. Fully fund line item One Cool Earth Garden/Health curriculum translated into Spanish -SLCUSD elementary Family Meal Program for English Learners $3,200 $3,200 SLO Noor Foundation Free Health & Support Services for Uninsured BIPOC Residents $13,100 $20,000 Fully fund public awareness campaign; add radio, increase marketing, outreach methods; increase lab, diagnostics SLO Repertory Theater Yr-long series of productions, ed programming, centered on increasing access, diversity, equity, justice $10,000 $16,300 Fully fund BIPOC inclusion initiatives, items #1-#5 Subcommittee #2 Total $126,300 $49,500 $109,800TOTAL of Preliminary Recommendations Subcommittee #1 Total Subcommittee #2 2020-21 DEI Requests for Funding Subcommittee Preliminary Recommendations to Task Force Total Budget = $120,000 Subcommittee #1 Packet Page 171 Item 13 DEI HIGH IMPACT GRANT FUNDING - APPLICATIONS AT A GLANCE – October 2020 $120,000 available APPLICANT PROJECT AMNT REQ Big Brothers Big Sisters of SLO County Bigs in Blue/ Bigs in Badges $50,681 Central Coast Coalition for Undocumented Student Success Undocumented Community Summit $6,000 Community Action Partnership SLO Co (CAPSLO) DEI / Wellness Training for Adult & Teen Staff – Adult & Teen-led $30,000 Diversity Coalition SLO County -Multicultural Center -Diversity Education & Training Program $100,000 French Hospital Medical Center Foundation Bilingual Lay Patient Navigator Program $25,000 Jewish Community Center Federation SLO Jewish Film Festival $4,000 Literacy for Life Literacy Program $10,000 Mozart Fest /Festival Mozaic Summer Festival: Family & Midday Concerts $5,000 One Cool Earth Inclusive Garden Education Family Meal Program $3,200 Peace Academy of the Sciences & Arts Enrichment Programs $35,000 R.A.C.E. Matters BELONGING 2021 – multimedia arts experience $27,600 Restorative Partners Restorative Conferencing $53,038 SLO Child Development Resource Center -Therapeutic education for ages 2-6 -Mental health services to families $10,000 SLO Climate Coalition Holistic Climate Justice Directory $12,600 SLO International Film Festival The Change Makers – film festival spotlighting BIPOC filmmakers $7,500 SLO Noor Foundation Free Health & Support Services for Uninsured BIPOC Residents $13,100 SLO Partners/SLOCOE STEM apprenticeships + scholarships for Women/ethnic Minorities $120,000 SLO Repertory Theater Bringing BIPOC Voices & Stories to SLO Rep & Community $10,000 Transitions-Mental Health Association -Scholarship/Ed Asst for Staff from Underserved Communities -Internal DEI Audit $18,000 United Way Equity, Diversity, Inclusion Initiative - Staffing $100,000 20 Applications Received TOTAL FUNDS REQUESTED $640,719 Packet Page 172 Item 13 Department Name: Finance Cost Center:2002 For Agenda of:November 17, 2020 Placement:Business Estimated Time:60 minutes FROM: Brigitte Elke, Finance Director Prepared By:Natalie Harnett, Principal Budget Analyst SUBJECT:SETTING THE STAGE: RECEIVE A STATUS UPDATE FOR THE 2019-21 GOAL SETTING AND FINANCIAL PLAN PROCESS RECOMMENDATION Receive and discuss the following background information in preparation for the 2021-23 goal- setting and Financial Plan process: 1. FY 2020-21 1 st quarter report (Attachment A); and 2. Status of the 2020-21 Adopted Meta Goal and the original Major City Goal components (Attachment B - Will be provided as Agenda Correspondence); and 3. General Plan and Climate Action Plan Update (Attachments C & D);and 4. Setting the stage framework including core services and a scan of strategic indicators for all major funds. REPORT-IN-BRIEF The City of San Luis Obispo utilizes a two-year financial planning process to create its budgets. This process includes extensive public outreach to assist the City Council in establishing Major City Goals. The benefits of this process are two-fold: 1) it ensures that resources are provided in the budget to accomplish the community’s priorities and 2) it provides a method to assemble a common understanding and framework for residents, decision makers, and City staff about what can be achieved for the good of the community by working together. This report also includes an update on FY 2020-21 first quarter results, the current Meta City Goal, the General Plan, Climate Action Plan, and an overview of core services and strategic indicators. All these elements provide important information to set the stage for the goal setting and Financial Plan process. As adopted in the 2019-21 financial plan, staff is committed to providing quarterly budget updates to Council. This is especially important during the pandemic as the economy continues to face uncertainty and volatility and thus has impacts on the City’s budget. The City’s overall first quarter actual revenue and expenditure were as projected. Additional updates and budget recommendations will be presented to Council at mid-year in February 2021 as we continue to monitor and evaluate the ongoing and dynamic impacts of COVID-19 on the City’s budget and local economy. Packet Page 173 Item 14 Significant progress has been made on the City Meta Goal and economic recovery efforts can be seen throughout the City. The City adopted ten economic recovery strategies with actions that span from developing new childcare options to modifying zoning requirements. Thousands of staff hours have been spent helping businesses and community members adapt and thrive in the new pandemic environment. The report also highlights the progress made on the twenty-year time frame of the City’s General Plan. Of the 412 individual planning and implementation programs in the General Plan, 98% are completed or have been integrated into the City’s ongoing operations. The recently adopted Climate Action Plan has also made significant headway with 59% of the climate action tasks initiated, completed, or nearing completion. In addition, the Council will be considering a recommendation on November 17, 2020, to adopt an update to the City’s Housing Element Many of the new programs in the Housing Element indicate an implementation timeframe of one year. As a result, resources to accomplish these programs will need to be considered as part of the Financial Plan process as some of the Housing Element actions are immediately require implementation to maintain certification with the State of California. Lastly, the report includes General and Enterprise Funds’information that will help set the stage for goal setting. The City is faced with balancing rising costs, limited resources, and providing excellent levels of service to its citizens. Covid-19 has exacerbated many of these challenges. The information provided in the report and in the presentation are geared towards providing Council and the community an overview of the available resources and the cost of providing services to the community at current levels. DISCUSSION Background The fundamental purpose of the City’s budget process is to allocate resources to support core City services and capital projects and to accomplish adopted Major City Goals over a two-year period. This process is informed by the City’s current service levels and adopted long-term plans and policies that assist the development of the two-year Financial Plan. One of the important factors that the Council and Community need to take into consideration is that many past Major City Goals once completed as tasks become ongoing programs that impact core service capacity. For example, enhancement of neighborhood services, support of community choice energy policy and operations, 40 Prado homeless support and many others that become base obligations for the City to continue efforts and honor ongoing commitments. This report is intended to “set the stage” by providing a status update on the current MetaCity Goal and the original Major City Goal (MCG) components, an update on the 2020-21 first quarter financial results, and a status report on the General Plan programs. The General and Enterprise Funds’ five-year fiscal forecast will be presented to the Council on February 2, 2020 alongside the 2020-21 Mid-Year report and will be based on audited 2019-20 financial results. Packet Page 174 Item 14 2020-21 1st Quarter Financial Review The City’s overall first quarter revenue and expenditure pictures look as expected when compared to budget. When compared to FY 19-20, revenues are reduced across most funds 1 due to the economic downturn. It is important to note that the FY 2019-20 started out very strong with revenues reaching all-time highs. July 2019 marked ten years of continuous economic growth which was the largest period of US economic expansion on record. Revenues last year were also high because of one-time funding from SB1090 ($1.9 million) and elevated development activity. The Covid-19 health emergency and resulting measures have altered this picture and the City adjusted its budget for 2020-21 accordingly at adoption in June 2020. 2019-20 Fund Q1 Actual (unaudited) Revenue Forecast Q1 Actual % Received Variance from prior year General Fund * 18,044,325.00$ 76,571,144$ 16,494,956$ 22% -9% Water Fund 4,753,395.00$ 23,387,885$ 4,638,278$ 20% -2% Sewer Fund 3,387,804.00$ 16,895,606$ 3,162,523$ 19% -7% Parking Fund 1,495,994.00$ 2,798,191$ 749,244$ 27% -50% Transit Fund 214,461.00$ 4,808,075$ 438,180$ 9%104% Grand Total 27,895,979.00$ 124,460,901$ 25,483,181$ 20% -9% *Includes special revenue funds 2020-21 Overall expenditures are also tracking as expected. Staffing expenses are the best indicator of budget consumption because they track in a linear fashion while non-staffing costs are often obligated (via purchase orders) at the beginning of the year and do not trend the same way. First quarter actuals show that staffing budgets for all major funds were between 21-23% consumed as of September 30, 2020. This number is slightly below the quarter threshold and is attributed to the City’s continued activation of the Fiscal Health Contingency Plan and related hiring chill. The 2020-21 First Quarter Financial Review (Attachment A) contains a more detailed update for all major funds. META Goal / MCGs As part of the Supplemental Budget adoption, the Council concluded that the City’s top priority for 2020-21 is to protect the public health of San Luis Obispo, provide essential services, and assist the community in economic recovery via a Meta City Goal. To provide Council with meaningful updates on the goal, staff implemented a detailed tracking mechanism to monitor Meta Goal activities. Attachment B provides a detailed update on all actions thus far. The table below shows a status overview of each of the ten strategies: 1 Transit revenue is primarily comprised of State and Federal grand funding. These revenues are typically received at the end of the fiscal year. The increase in FY 20-21 is simply due to the timing of receipts. Packet Page 175 Item 14 Table 7: Meta Goal Update by Strategy Strategy Staff Hours Spent Operating Dollars Spent Customers Retained Businesses Supported* Local Business Support 741 $ 36,740 0 820 Cal Poly 327 $ 7,500 0 150 City Organization 2,613 $ - 0 193 Community 10,698 $ 39,903 283 1,751 Community Partners 34 $ - 0 - Downtown 960 $ 333,643 0 380 Impacted Industries and Businesses 1,264 $ 173,531 0 82 Infrastructure and Capital Projects 1,594 $ 113,611 100 1 Quality of Life 3,291 $ 11,850 20 14 Resiliency 598 $ 7,500 0 450 TOTAL 22,119 724,278$ 403 3,841 * A business can be supported multiple times through different efforts. This number refers to the total times a business was supported. General Plan Update Why Report on the Status of General Plan Programs? The City’s General Plan is composed of a “building block” hierarchy of goals, objectives, policies, and programs. Goals and objectives are direction-setters that describe desirable conditions and preferred outcomes as they are applied to specific situations. Policies are typically more specific statements that guide decision-making while the defined programs are actions that implement goals, objectives, and policies. As such, monitoring the City’s progress in implementing General Plan programs assists with decision making in pursuit of the adopted plan and implementation of the City’s vision. Attachment C provides a summary of the status of all General Plan Implementation programs by element as well as key “area” plans. As presented in greater detail in Attachment C, of the 412 individual implementation planning programs in the General Plan, 98% or 405 are completed or have been integrated into the City’s ongoing operations. This is a 5% increase since the last update provided as part of the 2019-21 Financial Plan. In addition, the Council will be considering a recommendation on November 17, 2020, to adopt an update to the City’s Housing Element. Staff has been working with the State’s Department of Housing and Community Development (HCD) to ensure that once adopted, the Housing Element will be certified, ensuring access to a wide variety of State grants and programs. This year, the State is requiring jurisdictions to establish timeframes for implementation of programs that are needed to comply with State goals for low income housing and to “affirmatively further fair housing.” Many of the new programs in the Housing Element indicate an implementation timeframe of one year. As a result, resources to accomplish these programs will need to be considered as part of the Financial Plan process. Packet Page 176 Item 14 Climate Action and Community Resilience In August 2020, Council unanimously adopted one of the most ambitious local climate action plans in the nation with the goal of achieving carbon neutrality in municipal operations by 2030 and in the community by 2035. In adopting the plan and associated targets, Council affirmed that although a rapidly changing climate will be increasingly disruptive to all aspects of municipal services, proactively addressing the issue is an opportunity for innovation and economic development. The Climate Action Plan focuses on leveraging the considerable efforts required to achieve emissions goals to also drive economic recovery and address issues of environmental justice and equity. The realized co-benefits of climate action and Green House Gas (GHG) emissions reduction, including efficiency, cost-savings, safety, and comfort, have the potential to enhance San Luis Obispo while inspiring community action and action from other communities that look to the City for leadership. Given the magnitude and importance of the work, climate change is on the forefront of the City’s priorities and will need to be woven into the City’s decision making and goal setting process. For the City to be successful, alignment with the goals adopted in the Climate Action Plan will need to be given consideration in nearly all Financial Plan decisions. As of November 2020, 59% of the climate action tasks were initiated, completed or near completion and some significant achievements have been made in the last 12 months as detailed in Attachment D. In addition, the City has initiated Resilient SLO, a grant funded project to comprehensively assess the community’s vulnerabilities to the impacts of climate change and to update the Safety Element of the General Plan to further focus the City’s policy framework on adaptation and resilience. The City continues to identify and pursue external funding opportunities and engage other agencies and community partners to ensure the implementation outcome of each GHG reduction measure is maximized to support public health, economic development and COVID-19 recovery, and other key objectives. Diversity, Equity, and Inclusivity (DEI) On July 7, 2020, the Council approved the creation of a diversity, equity, and inclusion task force (DEI-TF). The Council also added a guiding principal2 to support DEI efforts as part of the adoption of the 2020-21 Meta Goal. These decisions are only steppingstones in a commitment to making San Luis Obispo a welcoming, inclusive, and safe community for everyone. The 2021-23 Financial Plan will be developed through a lens of diversity, equity, and inclusivity in mind. 2 The eight principle reads: “The city recognizes that social and economic inequality is embedded in our systems and culture, and that recovery must integrate deep structural transition to support the well-being and empowerment of marginalized communities” Packet Page 177 Item 14 Setting the Stage Framework Like most municipalities, the City is faced with balancing rising costs with limited resources while continuing to provide excellent levels of service to its citizens. Over the past three years the City undertook a thorough re-analysis of budget needs and found opportunities to increase efficiencies throughout the City’s operations focusing on providing core services to the community. This has undoubtedly helped the City remain in good fiscal standing through the initial stage of this drastic economic and health crisis. The City’s annual operating budget for the General Fund totals about $65 million and includes 54 programs spanning from Building and Safety, Development Review, Emergency Response, Aquatics, Youth and Services, Police Patrol, Traffic Safety, Streets & Sidewalk Maintenance, Transportation Planning and the Urban Forest to Accounting, Purchasing and City Administration. Many of these work programs are multifaceted –they provide core services to the community, execute General Plan programs, and also contribute to Major City Goals that are determined by the City with each financial plan. The “Setting the Stage” phase of goal setting is meant to provide Council with an update on the available resources and the cost of providing services to the community at current levels. This will help prepare Council and the community in its decision-making process for potential trade- offs from current core services to adjust for new programs and services with the new Financial Plan. Enterprise Fund Review Water Fund -Setting the Stage The Water Fund provides essential services that support the community’s health, well-being, and quality of life. It delivers about $1.8 billion gallons of potable water each year to the community and about 70% of the total budget goes towards securing water supply. The remainder is spent on water treatment, distribution, and water resources. Packet Page 178 Item 14 As an enterprise fund, the Water division finances its operation mainly with rates charged for water services. According to its mandate, rates must be sufficient to cover operation, capital asset maintenance and improvements, debt obligations, and appropriate reserve levels to keep the fund healthy and prepared for unforeseen funding needs. The department had an approved rate increase for FY 20-21 to meet this mandate but postponed the increase to assist the community with the effects from the ongoing COVID-19 pandemic. The Water Fund is currently undertaking several significant capital projects as detailed below: Water Treatment Plant Energy Efficiency Project –Construction of the Water Treatment Plant Energy Efficiency Project began in May 2020. This project will result in approximately 30% reduction in energy usage by replacing aged and inefficient equipment and improving system automation. The project is in partnership with PG&E and is funded by an Infrastructure Bank loan. The expected completion date is July 2021. Pipeline Replacement - Water Distribution and Public Works Engineering have recently completed the Casa/Stenner/Murray/Chorro pipeline replacement project which increased fire flow capacity, improved resiliency to Sierra Vista Hospital, and improved water quality through portions of the Foothill pressure zone. Currently, the Terrace Hill pipeline and pressure reducing valve rehabilitation project is advertised for bid. Water pipeline replacement projects are nearing the 90% design milestone for Beebee, Cuesta, and Loomis, as well as Jefferey. Jefferey Street will be a combined water/sewer pipeline replacement project. Sustainable Groundwater Management Act (SGMA)–In order to meet emerging regulatory requirements and to ensure the long-term sustainable management of local groundwater supplies, the City and County have each formed a Groundwater Sustainability Agency (GSA). These GSAs oversee basin-wide groundwater sustainability efforts within their respective portions of the groundwater basin and are working together to produce a Groundwater Sustainability Plan (GSP) which will outline a path to long-term basin sustainability. To-date, the first six chapters of the GSP have been drafted and cover areas such as administrative information about the SGMA process, a description of the GSP plan area and basin characteristics, information on local groundwater conditions, and the establishment of a groundwater budget. The GSP is scheduled to be completed and adopted by both GSAs before January 2022. A midpoint process update about the SGMA Groundwater Sustainability Plan is scheduled for December 8, 2020. What lies ahead: Water revenue is on trend with previous years. It was originally assumed that 20-21 revenue would be down by 6% because of the Covid-19 economic downturn and deferral of rate increases. So far, consumption is close to what it has been in previous years. While business and Cal Poly consumption is down due to Covid-19, residential consumption increased. Impact fees are currently exceeding original 20-21 projections as strong development activity continues. However, based on current trends, previously deferred rate increases will need to be addressed as the year progresses. Without rate increases, the water fund will be unable to continue providing its existing level of service. Packet Page 179 Item 14 The water fund has a bond issuance that requires the fund to be evaluated and given a credit rating each year. The credit rating is an indicator of the fund’s overall health and its ability to meet its debt obligations. The credit rating is important because it allows the City to borrow money more easily and at lower interest rates. The Fitch rating considers, among other things, whether the fund is consistently increasing rates, whether it is maintaining its capital improvements, and capital reserve levels. Due to the unprecedented times, during its 2020 credit evaluation, Fitch understood the City’s decision to defer the adopted rate increase temporarily. This is not, however, sustainable if the water fund is to maintain its AA credit rating. Based upon aging infrastructure and the need to maintain pipelines that carry water to the City from reservoirs as far as 50 miles away, inadequate revenue challenges the ability of the City to fund the maintenance and improvements needed to provide safe and reliable water to the City. Sewer Fund -Setting the Stage The Sewer division treats over one billion gallons of water a year and delivers about 80 million gallons of recycled water. Its core services include wastewater collection, environmental compliance, utility billing, operation, and maintenance of the Water Resource Recovery Facility (WRRF) and operation of a water quality lab. Its current work program is driven by environmental regulation, construction of major projects and infrastructure renewal. Like the Water division, the Sewer division finances its operation mainly with rates charged for sewer services and must ensure that those rates are sufficient to cover costs and maintain a prudent fund balance. The Sewer Fund also had an approved rate increase for FY 20-21 to meet this mandate. Like the Water Fund, the rate increase was postponed in consideration of the community’s ongoing struggles with Covid-19. The Sewer Fund is also undergoing several significant capital projects as detailed below: Water Resource Recovery Facility (WRRF) Upgrade project -The WRRF upgrade, also known as Water Plus, is currently in construction and scheduled for completion in the summer of 2023. The main driver for the project is to meet regulatory discharge requirements, address aging infrastructure, and provide a community asset in the fields of resiliency, water quality, protection of our environment, and local workforce agreement. Additionally, this project is being financed by State Revolving Fund (SRF) loan in an amount up to $ 140 million, at an interest rate that is half the State’ s General Obligation Bond interest rate and was recently approved to receive $ 4 million of principal forgiveness from Green Project Reserve funding. Calle Joaquin Lift Station, Gravity Sewer, and Siphon Replacement –The Calle Joaquin lift station was put into service in 1967 and serves properties in the southern portion of the City on both the east and west sides of Highway 101. The project’s design, easement acquisition, and environmental permitting process has been challenging due to the existing siphon’s location under San Luis Obispo Creek and crossing of Highway 101. The project is planned to begin construction in early 2021. Packet Page 180 Item 14 Foothill Lift Station Replacement -The Foothill lift station was installed in its present location in 1986. The equipment had been used elsewhere in the City where it was installed in 1962. The station serves approximately 20 acres with 43 parcels on the west end of Foothill Boulevard near the City limits. The project is planned to begin construction in late 2021. What lies ahead: Residential sewer consumption is up due to residents spending more time at home, but overall revenue is still below original assumptions due to deferred rate increases and much lower wastewater flows at Cal Poly. Impact fee revenue is on track and has exceed Q1 anticipated numbers. The sewer fund is also facing some costly unknowns in the near future. The Prado Road overpass may require the Wastewater Collections division to relocate and operating the upgraded WRRF will be more expensive. In addition, the $6 million annual debt payment for the WRRF upgrade will begin in fiscal year 2023-24. Based upon aging infrastructure, the sewer fund needs to continue replacement and maintenance of sewer mainlines to avoid or reduce excessive maintenance, provide capacity, and reduce wastewater overflows. Parking Fund -Setting the Stage The City’s parking and access management program is designed to provide critical access to parking facilities throughout the City, as it relates to neighborhood parking districts and the downtown area. The Parking Fund was heavily stressed by the pandemic and does not expect full recovery for several years. The division plays a vital role in economic recovery and has relaxed its parking enforcements to encourage economic activity in the downtown area. As the economy continues to bounce back from the initial shutdown, Parking has increased enforcement which will slowly increase revenue. In preparation for the construction of the one of its largest and most anticipated infrastructure projects, the Palm Nipomo Parking Structure, the Parking fund has been building up working capital and intended to continue doing so as part of the 2019-21 Financial Plan. Due to budget shortfalls related to the pandemic, the fund utilized unreserved working capital in FY 2019-20 and will likely need to use it in FY 2020-21 as well. Palm Nipomo Parking Structure –Due to the unexpected use of working capital, the fund postponed the construction of this infrastructure project. Staff is currently analyzing the health of the fund to determine the most prudent way to bond for the cost of the structure. Based on the final design review, the earliest that construction would be able to begin on the project is Spring 2023. The construction will occur in two phases: site preparation and construction. What lies ahead: Despite setbacks, the division continues to make smaller scale improvements to services and infrastructure. In calendar year 2021 it plans to install on-street multi-pay stations and implement mobile app payment technology. These projects will add customer convenience and the “touchless” alternatives for payment will help protect the health of the community.Structural repairs and waterproofing in the parking structures will also be needed next year. Packet Page 181 Item 14 Beyond this, the division plans to develop, test, and implement a gateless parking structure in the 2021 calendar year and launch virtual permits in the residential districts by September 2021. Both improvements will increase customer service and provide additional options for customers to choose how they access the community. Transit Fund -Setting the Stage SLO Transit is the local fixed-route public transit operation for the City of San Luis Obispo. It operates 14 vehicles at peak period, along eight routes within the City limits and Cal Poly. Transit services are matched to revenue forecasts. Bus replacement schedules are based on federally approved “useful-life” criteria and best-case scenarios for aging vehicles; however, the availability of funds is highly dependent on discretionary grants from the State or Federal government. The Transit Fund was uniquely affected by the pandemic. While it caused a significant loss in ridership, revenues will remain as projected with budgeted State and Federal allocations and the CARES Act securing funding to counteract any revenue losses or unanticipated costs. Additionally, the City’s largest customer, Cal Poly, has an approved annual agreement that has already provided most of the fund’s fare revenue. In light of this, the program has a healthy fund balance to meet cash flow needs. Expenditures will continue to be mitigated as anticipated. Transit service have been right sized to account for the lower ridership volumes and the transit operation will continue to be monitored and adjusted as needed through the ongoing pandemic. What lies ahead: Moving forward, the transit program will need to focus on its long-term needs. First, several vehicles are reaching the end of their useful life and will need to be replaced. Second, a new transit service agreement with Cal Poly University will need to be reached. Lastly, the City will need to decide if it will exercise a second contract extension with First Transit or pursue Requests for Proposal. Policy Context The fundamental purpose of the City’s budget process is to link, through public engagement and strategic deliberation, the interest of the community to the available financial resources to achieve the desired outcome. The process allows the City Council to engage the community in identifying Major City Goals for the City while also providing information regarding the City’s core services, including the day-to-day work and responsibilities carried out by City employees to support residents’ quality of life. Public Engagement Public comment on this item can be provided to the City Council through written correspondence prior to the meeting and through public testimony at the meeting. Packet Page 182 Item 14 CONCURRENCE The City’s internal Financial Plan Steering Committee concurs with the recommendations included in this report. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACT Budgeted: Yes Budget Year: 2020-21 Funding Identified: Yes Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund N/A N/A N/A State Federal Fees Other: Total N/A N/A N/A There is no direct fiscal impact as a result of reviewing the status update accompanying this Council Agenda Report. This report aims at providing context for the upcoming goals setting process for the 2021-23 Financial Plan. ALTERNATIVES Not receive an update on the background information in preparation for the 2021-23 goal-setting and Financial Plan process. Attachments: a - First Quarter Financial Report for FY 2020-21 c - COUNCIL READING FILE - General Plan & Specific Plan Update d - Climate Action Plan Update Packet Page 183 Item 14 First Quarter Financial Report Fiscal Year 2020-21 Introduction This financial report provides an overview of the City’s financial position through the first quarter of fiscal year 2020-21 ( July 1 - September 30, 2020) for the General Fund and major enterprise operating funds. It also provides an update on the status of the City’s Capital Improvement Program Projects (CIP) and City Meta Goal. Notable milestones or trends within the first quarter are addressed and detailed throughout the document. The report is broken down into the following sections (linked): General Fund Update As of September 30, 2020, operating expenditures trend on target with past years’ first quarters. Revenues have been negatively impacted by COVID19, but they are tracking close to0 what was adopted in the 2020-21 Supplemental Budget. Below are the highlights from the third quarter: Adjusted Budgets and Revenue Estimates: The City’s overall revenue and expenditure picture was updated in May 2020 and the 2020-21 Supplemental Budget was adopted on June 2, 2020. Revenue forecasts were based on assumptions at the time, many of which have held true and some of which have changed. The overall economic bounce back from the initial COVID19 shutdown has been stronger than anticipated with the partial reopening of the economy, but many uncertainties remain. The City planned to return to Council in October 2020 with a clearer economic forecast and determine if additional budget adjustments needed to be made. At this time, no general fund budget changes are being proposed. While some tax revenues are tracking more favorable than originally anticipated, many fee programs expect a less favorable forecast due to the extended program closure. Staff plans to return to Council in February with an update long term forecast once it has better analytics for the first 6 months of 2020-21. 1 General Fund Update 2 Enterprise Funds Update 3 Meta Goal Update 4 Capital Improvement Plan Update 5 Debt Schedule Update 6 Outlook and Conclusion 1 16 Million in Revenues (YTD) 19 Million in OpEx (YTD) 8 Meta City Goal actions Completed in Q1 10 CIP Projects Completed Packet Page 184 Item 14 2019-20 Year End Carryover: Because FY 2019-20 ended with revenues exceeding expenditures, The City Manager was authorization to allow specific carryover of budget for the continuation of active projects or mission critical needs. The expenditure tables in this report include adjustments for the carryover and encumbrances from the FY 2019-20. See the City’s full 2019-20 Year End Report here. COVID19: The COVID19 pandemic began in late February 2020. Along with the reduced revenues, the pandemic brought unfunded costs associated with supporting economic recovery and protecting the health of the community. When Audited Financials were presented to Council on March 17, 2020, there was approximately $6 million in one-time undesignated fund balance at FY 2018-19 Year end. I preparation for unfunded costs, Council adopted a resolution to keep these funds in undesignated fund balance and give City Manager the authority to allocate towards COVID expenses and economic recovery efforts as needed. The chart below shows the remaining amount in fund balance as of September 30, 2020. Table 1: 2018-19 Unassigned Fund Balance Update Original Balance Used to Date Remaining Balance (9/30/20) $5,991,692 $218,900 $5,772,792 The current 2020-21 COVID costs for the General Fund is $318,247. The City will submit to FEMA for reimbursement of these costs, but it is still unknown whether any will be received. Additionally, the required CARES Act report for Cycle 1 was submitted in September. As part of the adopted Meta City Goal, the City has been focusing efforts and funding to support the local economy and promote a safe environment during the health crisis. An overview of these actions can be found here. General Fund Revenue Table 2: General Fund Revenues Footnote Q1 Actual % Received Total Budget Q1 Actual % Received Variance from prior year Tax and Franchise Revenue 1 Sales and Use Tax (July & Aug only)1 5,031,744$ 20% 22,853,783$ 5,147,376$ 23% 2% 2 Property Tax 132,909$ 1% 18,418,903$ 734,794$ 4%453% 3 Transient Occupancy Tax 2,334,589$ 29% 6,267,000$ 1,800,251$ 29% -23% 4 Utility User Tax 1,187,531$ 20% 5,565,000$ 1,157,156$ 21% -3% 5 Business Tax 2 2,862,835$ 97% 2,853,740$ 2,890,955$ 101% 1% 6 Franchise Fees 77,798$ 5% 1,544,000$ 78,702$ 5% 1% 7 Gas Tax (Special Revenue Fund)225,826$ 22% 1,082,390$ 286,350$ 26% 27% 8 SB1 Gas Tax (Special Revenue Fund)156,038$ 19%795,548$ 147,044$ 18% -6% 9 Cannabis Tax -$ 0%400,000$ 114,859$ 29% Total Tax & Franchise Revenue 12,009,270$ 19% 59,780,364$ 12,357,488$ 21% 3% 10 Fees and Other Revenue**3 6,023,828$ 24% 16,790,780$ 4,137,468$ 31% -31% Grand Total 18,033,098$ 20% 76,571,144$ 16,494,956$ 22% -9% 2020-21 2 - Business license and tax certificate renewals are due before September 30th; therefore anticipated revenue for the year has been 3 - FY2019-20 includes a one-time funding of $2 m illion from SB1090 Diablo Closure 1 - Includes $146,000 in FY 20-21 actuals that are from FY 19-20 due to the sales tax deferral programs 2019-20 Packet Page 185 Item 14 Sales Tax: As of September 30, 2020, about 17% of the City’s forecasted sales tax revenue for this fiscal year had been collected due to the timing of disbursements from the California Department of Tax and Fee Administration (CDTFA. This accounts for revenue earned July 2020 through August 2020. As with most California cities, actual sales tax revenues for the last 4 months have been higher than initial projections. This was largely due to an increase in the state and county pool allocation which helped offset the decrease in tax revenue from general consumer goods and other negatively affected industries. Online sales are the largest contributor to the countywide pool allocation. The chart below shows a year over year comparison of sales tax revenue for the first quarter. The revised forecast, while better than initially projected, is still below 2018-19 levels. Property Tax: The majority of property tax is not collected until the 3rd and 4th quarter of the fiscal year; therefore, the year to date actual is on track. The latest property tax forecasts provided by the County confirm that the economic downturn has had little effect on the housing market and economists are predicting that this will remain stable through the recession. Transient Occupancy Tax (TOT): Tourism levels and TOT collection remain top concerns for the City. Hotel occupancy rates remain below normal levels and the CSU chancellor announcement of extended virtual learning will cancel many of the large university events that bring visitors to the City. Tourism did see a bounce back over the summer but there are too many unknowns to say that the revenue forecast will improve. First quarter TOT revenues were about 23% lower than last year. Cannabis Tax: The City’s first storefront retail cannabis shop opened mid-August; therefore, the City realized a bump in monthly cannabis tax revenues. It is too soon to say how demand will level out over the next nine months, but the current revenue projection seems accurate at this point. Fees and Other Revenue: Fees and other revenues typically track slightly above 25% in the first quarter because many annual permit and license fees are collected during that time. The two notable variances are that development services revenue is slightly higher than projected and parks and recreation revenue is slightly lower than projected. Both variances make sense because of several large active development projects going through planning and because of the extended closure of recreational programs. It is too soon to say if either of these trends will continue for the remainder of the fiscal year, but an updated forecast will be provided at mid-year. $4.20 $4.00 $4.77 $4.53 $4.52 $4.38 FY 16-17 FY 17-18 FY 18-19 FY 19-20 FY 20-21 (FORECAST) GRAPH 1: SALES TAX (MILLIONS) QTR 1 FIVE YEAR COMPARISON Revised Packet Page 186 Item 14 General Fund Expenditures Overall expenditure trends are on track with budget. The graphs below include first quarter consumption for FY 20-21 compared to budget. The “Total Expenditures & Obligations” column includes both costs that have been already been incurred and costs that are obligated on purchase orders. Expenditures by Type: There are no significant variances to point out in the general fund. It is expected that contract services and other operating expenses track above 25% because annual purchase orders are set up at the beginning of the year and the funds are considered “Obligated” from that point forward. Staffing should track at a consistent level and 22% is consistent with where the City should be given the Fiscal Health Contingency and the hiring chill. Expenditures by Department: All the General Fund departments are tracking in line with budget. The variance in the City Attorney budget is warranted because the budget is so small and over 20% of it is allocated for contract services. Many of these contracts are already under way and the funds have been allocated for the entire year. Table 3: General Fund Expenditures by Type Expenditure Type Initial Budget Budget Adjustments Total Budget Total Expenditures & Obligations % Consumed Staffing 53,729,036$ 1,001,770$ 54,730,806$ 12,297,700$ 22% Contract Services 6,586,662$ 2,712,644$ 9,299,306$ 3,935,293$ 42% Other Operating Expenses 3,708,123$ 1,432,904$ 5,141,027$ 1,753,349$ 34% Utilities 2,581,138$ 4,310$ 2,585,448$ 710,994$ 27% COVID Expenses * -$ 1,679$ 1,679$ 318,247$ 18955% Grand Total 66,604,959$ 5,153,307$ 71,758,266$ 19,015,583$ 26% * Total expenditures include $200,000 of small business grants that are being reimbursed through the CARES act Table 4: General Fund Expenditures by Department Department Initial Budget Budget Adjustments Total Budget Total Expenditures & Obligations % Consumed Admin & IT 8,102,779$ 727,263$ 8,830,042$ 2,595,435$ 29% City Attorney 778,167$ 212,069$ 990,236$ 376,555$ 38% Community Development 5,325,811$ 789,059$ 6,114,871$ 1,517,366$ 25% Finance 2,998,897$ 915,827$ 3,914,724$ 1,018,789$ 26% Fire 12,615,778$ 1,180,765$ 13,796,544$ 3,657,717$ 27% Human Resources 1,350,586$ 93,246$ 1,443,832$ 472,235$ 33% Parks & Recreation 4,274,301$ 172,599$ 4,446,900$ 976,983$ 22% Police 17,802,862$ 172,247$ 17,975,109$ 4,177,909$ 23% Public Works 13,196,459$ 820,880$ 14,017,339$ 4,217,753$ 30% Utilities - Solid Waste (AB939)* 159,318$ 69,351$ 228,669$ 4,842$ 2% Grand Total 66,604,959$ 5,153,307$ 71,758,266$ 19,015,583$ 26% *The singular staff position in this department is being filled on an interim basis by a Water Resources employee. Once filled permanently, all past and current costs associated with this role will be corrected and transferred to the Solid Waste division Packet Page 187 Item 14 Enterprise Fund Update Utilities: Water and Sewer Funds The tables below include first quarter actuals for FY 20-21 compared to the projection. The “Total Expenditures & Obligations” column includes both costs that have been already been incurred and costs that are obligated on purchase orders. Revenue: Revenues are on track. Because of the utility billing timing, the revenues above include only about 2.25 months of revenue. In accordance with an order from the Governor, water services are not being discontinued for non-payment. In addition, the City has chosen not to send past due closed accounts to a collection agency to accommodate customers who are having trouble paying their bills because of the Covid related economic downturn. Both moratoriums have resulted in higher than normal past due account balances. The Utilities department continues to monitor past due account balances and, at the recommendation of the City auditor, has created a “doubtful accounts” general ledger account to record those balances that are unlikely to ever be collected. This will result in a $34,000 reduction to sewer fund revenues and $34,000 reduction to water fund revenues. Water consumption overall in the first quarter of fiscal year 2021 was nearly the same as the same quarter last year. Residential and irrigation consumption increased but commercial consumption decreased as compared to the same quarter last year. Table 7: Water Consumption Year over Year Comparison 1 This table excludes Cal Poly consumption. 2019-20 Table 5: Water/Sewer Fund Revenue * Q1 Actual (unaudited) Total Budget Q1 Actual % Received Variance from prior year Water Fund 4,753,395$ 22,587,885$ 4,638,278$ 21% -2% Sewer Fund 3,387,804$ 16,295,606$ 3,150,284$ 19% -7% * Does not include debt financing or impact fees 2020-21 Table 6: Operating Expenses by Type Initial Budget Budget Adjustments Total Budget Total Expenditures & Obligations % Consumed Water Fund 16,928,253$ 1,105,134$ 18,033,387$ 10,872,038$ 60% Staffing 4,402,502$ 77,103$ 4,479,605$ 928,117$ 21% Contract Services 10,904,439$ 916,703$ 11,821,142$ 9,235,876$ 78% Other Operating Expenses 964,612$ 111,328$ 1,075,940$ 575,119$ 53% Utilities 656,700$ 656,700$ 132,926$ 20% Sewer Fund 7,841,135$ 532,111$ 8,373,246$ 3,253,947$ 39% Staffing 4,668,962$ 79,163$ 4,748,125$ 980,436$ 21% Contract Services 1,065,092$ 299,682$ 1,364,774$ 976,056$ 72% Other Operating Expenses 1,348,981$ 152,231$ 1,501,212$ 1,121,801$ 75% Utilities 758,100$ 758,100$ 157,772$ 21% COVID Expenses -$ 1,034$ 1,034$ 17,881$ 1729% Grand Total 24,769,389$ 1,637,245$ 26,406,633$ 14,125,986$ 53% Customer Class1 July – September 2019 July – September 2020 Difference Residential 337,561 units 366,194 units 28,633 units Commercial 140,215 units 115,696 units (24,519) units Irrigation 104,611 units 107,672 units 3,061 units 2 Packet Page 188 Item 14 1 unit = 100 ccf Expenditures: There are no significant variances to point out at this time. It is normal and expected that contract services and other operating expenses track above 25% because annual purchase orders are set up at the beginning of the year and the funds are considered “Obligated” from that point forward. Staffing should track at a consistent level and the actuals seen above are consistent with where the City should be given the Fiscal Health Contingency and the hiring chill. Parking Fund The tables below include first quarter actuals for FY 20-21 compared to the projection. The “Total Expenditures & Obligations” column includes both costs that have been already been incurred and costs that are obligated on purchase orders. Revenue: The parking fund significantly lowered its revenue forecast in the 2020-21 budget because of expected loses due to COVID19. The department revenues are tracking in line with the forecast but are significantly lower than prior years. The Parking Fund anticipates that parking meter and enforcement revenues will outperform projections made at Supplement because collection of fees across all parking programs have been re-established sooner than initially planned. Parking structure revenues are likely to align with projections due to offering an additional hour of free parking through the end of the calendar year. Expenditures: There are no significant variances to point out at this time. It is normal and expected that contract services and other operating expenses track above 25% because annual purchase orders are set up at the beginning of the year and the funds are considered “Obligated” from that point forward. Staffing should track at a consistent level and the actuals seen above are consistent with where the City should be given the Fiscal Health Contingency and the hiring chill. Transit Fund The tables below include first quarter actuals for FY 20-21 compared to the projection. The “Total Expenditures & Obligations” column includes both costs that have been already been incurred and costs that are obligated on purchase orders. 2019-20 Table 8: Parking Fund Revenue * Q1 Actual (unaudited) Total Budget Q1 Actual % Received Variance from prior year Parking Fund 1,495,994$ 2,798,191$ 749,244$ 27% -50% * Does not include debt financing or impact fees 2020-21 Table 9: Operating Expenses by Type - Parking Initial Budget Budget Adjustments Total Budget Total Expenditures & Obligations % Consumed Staffing 1,177,211$ 350$ 1,177,561$ 244,598$ 21% Contract Services 801,465$ 121,119$ 922,584$ 619,034$ 67% Other Operating Expenses 234,300$ 6,054$ 240,354$ 53,118$ 22% Utilities 201,178$ 201,178$ 28,889$ 14% Grand Total 2,414,155$ 127,523$ 2,541,678$ 945,639$ 37% Total 582,387 units 589,562 units 7,175 units Packet Page 189 Item 14 Revenue: Most of the Transit Fund revenue is from State and Federal grants that are received at the end of the fiscal year; therefore, having received only 9% of the forecasted revenue at this point is normal. Additionally the Transit program still has an unused balance of CARES Act funds that will be cover most, if not all, operating expenses incurred in FY20-21 that is accessible to the program at the end of the fiscal year. Expenditures: There are no significant variances to point out at this time. It is normal and expected that contract services and other operating expenses track above 25% because annual purchase orders are set up at the beginning of the year and the funds are considered “Obligated” from that point forward. In the case of the Transit fund, the majority of the Contract Services budget is for the annual transportation services contract with First Transit, Inc. Staffing should track at a consistent level and the actuals seen above are consistent with where the City should be given the Fiscal Health Contingency and the hiring chill. 2019-20 Table 10: Transit Fund Revenue * Q1 Actual (unaudited) Total Budget Q1 Actual % Received Variance from prior year Transit Fund 214,461$ 4,808,075$ 438,180$ 9%104% * Does not include debt financing or impact fees 2020-21 Table 11: Operating Expenses by Type - Transit Initial Budget Budget Adjustments Total Budget Total Expenditures & Obligations % Consumed Staffing 327,181$ 327,181$ 73,920$ 23% Contract Services 3,139,033$ 186,919$ 3,325,952$ 3,085,185$ 93% Other Operating Expenses 376,800$ 68,278$ 445,078$ 392,628$ 88% COVID Expenses -$ 16,000$ 16,000$ 28,554$ 178% Grand Total 3,843,015$ 271,197$ 4,114,211$ 3,580,287$ 87% Packet Page 190 Item 14 Meta City Goal Update As part of the Supplemental Budget adoption, the Council concluded that the City’s top priority for 2020- 21 is to protect the public health of San Luis Obispo, provide essential services, and assist the community in economic recovery via a Meta City Goal. To provide Council with meaningful updates on the goal, staff implemented a detailed tracking mechanism to monitor Meta Goal actions. Attachment B provides a detailed update on all actions thus far. The table below shows a status overview of each of the ten strategies: 2020-21 Q1 Highlights x Flexibility with sign regulations x Fitness in the Parks x Open SLO investment x Small Business Grants x Permit fast tracking (TIPP-FAST) x Deferral of licenses and permit fees x Tax deferrals x Relaxed Parking Enforcement Table 7: Meta Goal Update by Strategy Strategy Staff Hours Spent Operating Dollars Spent Customers Retained Businesses Supported* Business 741 $ 36,740 0 820 Cal Poly 327 $ 7,500 0 150 City Organization 2,613 $ - 0 193 Community 10,698 $ 39,903 283 1,751 Community Partners 34 $ - 0 - Downtown 960 $ 333,643 0 380 Impacted Industries and Business 1,264 $ 173,531 0 82 Infrastructure and Capital Projects 1,594 $ 113,611 100 1 Quality of Life 3,291 $ 11,850 20 14 Resiliency 598 $ 7,500 0 450 TOTAL 22,119 724,278$ 403 3,841 * A business can be supported multiple times through different efforts. This number refers to the total times a business was supported. 0 5 10 15 20 25 30 35 40 45 Not Started 10% complete 25% complete 75% complete Completed Ongoing Number of Actions Meta Goal Status Update 3 Packet Page 191 Item 14 CIP Update – Completed and Ongoing Public Works CIP Engineering and Management staff have delivered several projects within the first quarter of the fiscal year as listed in the below table, including the installation of new playground equipment at Islay Hill Park, new public safety communications tower and equipment on South Hills, and high efficient LED lighting installations in the 919 Palm Parking Structure. Notable ongoing work includes replacement of Marsh Street Bridge and City facilities maintenance work. Table 13: Completed and Ongoing CIP projects in Q1 Project Proponent Department Status LRM Funded Approx. Construction Budget Anholm Greenway Phase 2 Crack Sealing Public Works Completed in July Yes $35,000 Bridge Maintenance 2020 Public Works Completed in July Yes $75,000 South Hills Radio Site Upgrades Public Works Substantially Complete in September.Yes $770,000 Islay Hill Park Playground Equipment Replacement Public Works / Parks and Rec.Completed in September Yes $510,000 Swim Center Bath House Roof Repair Public Works Completed in September Yes $103,000 Creek Silt Removal 2020 Public Works Completed in September No $70,000 City Hall Fire Department Connection Public Works Completed in September Yes $60,500 919 Palm Garage LED Lighting Retrofits Public Works Completed in September No N/A City Facilities HVAC Replacements Public Works Completed in October Yes $140,000 Roadway Sealing 2020 Public Works Completed in October Yes $1,480,000 Storm Drain System Replacement - Bullock CMP Public Works Completed in October Yes $316,000 Marsh Street Bridge Replacement Public Works Ongoing. Yes (10%)$4,425,000 Fire Station 1 HVAC Replacement Public Works Ongoing. Yes $130,000 Railroad Safety Trail Taft to Pepper Public Works Awarded. Construction begins in Q2 Yes (13%)$3,775,000 Swim Center Shower Repair Public Works Awarded. Construction in Q2 Yes $25,000 Marsh Garage Elevator Repair Public Works Awarded. Construction in Q3 No $86,000 Terrace Hill PRV Replacement Public Works Advertising. Construction in Q3 No $550,000 Neighborhood Greenway Signage Installation Public works Final Design Phase. Yes $25,000 $12,575,500 Total Budget for Completed or Active Projects in FY 2020-21 Q1&Q2 4 Packet Page 192 Item 14 Debt Schedule Update The table below shows total debts and those that had maturity dates during the first quarter and the associated payments. Outlook and Conclusion The impact of COVID19 on the economic forecast has trended more favorably than originally anticipated but staff expects many of the COVID-19 related impacts to lag the initial shock of the pandemic. With Cal Poly teaching mostly online classes and major events being cancelled, the impact on two of the three major income streams (i.e. sales and transient occupancy tax) remains uncertain. As these tax payments lag, only two months had been fully collected at the time that this report was released. Staff continues to track remittances closely through the City’s Revenue division. The Fiscal Health Contingency Plan remains in full effect with hiring, purchasing, and travel chills and if staffing expenditures continue to track in a linear fashion, there may be slight savings in that category. It is also important to note that based on unaudited numbers, the City will be unable to follow through with its Fiscal Health Response Plan goals of paying a $3.0 million toward unfunded liability during FY 2020-21. The enterprise funds are also tracking in line with budget projections and will likely end the year as stated in the budget. 2 State of California - Employment Development Department. October 16, 2020. Labor Market Information Division. March 2019 Benchmark; http://www.labormarketinfo.edd.ca.gov (916) 262-2162 3 HdL Sales Tax forecast as of 10/13/20 4 Fitch Ratings: Fitch Global Economic Outlook for the U.S. – September 2020. General Fund Sewer Fund Total 2020-21 Debt Obligation 2,759,071$ Total 2020-21 Debt Obligation 1,387,400$ Q1 Payment: 2018 Lease Fire Truck 36,533$ No Q1 payments -$ Remaining 2,722,538$ Remaining 1,387,400$ Water Fund Parking Fund Total 2020-21 Debt Obligation 2,430,429$ Total 2020-21 Debt Obligation 855,500$ No Q1 payments -$ 2001 State Infrastructure Bank (CIEDB) Loan Marsh St 358,307$ Remaining 2,430,429$ Remaining 497,193$ Table 13: Debt Obligation Update Quick Economic Stats Unemployment Rate (San Luis Obispo City)2 – September 2020 7.0% Expected Sales Tax Growth for FY 20-21, 21-22, 22-133 1.9%, 6.6%, 3.8% U.S Consumer Spending 2021 Forecast (as of Sept 2020)4 4.1% U.S GDP 2021 Forecast (as of Sept 2020)3 4.0% 5 6 Packet Page 193 Item 14 Initiated 44% 2021-23 Fianancial Plan 22% Done or Near Complete 15% Pursuing outside resources 16% Uncertain Implementation path 3% ACTION STATUS UPDATE Climate Action Plan Update – November 2020 San Luis Obispo residents and businesses routinely rank climate change as an important issue and Climate Action has been a Major City Goal since 2017. In August of 2020, the City Council unanimously adopted one of the most ambitious local climate action plans in the nations and committed to achieving carbon neutrality in the community by 2035 and in municipal operations by 2030. The plan is comprised of seven main focuses: Importantly, although the plan’s primary focus is on greenhouse gas (GHG) emissions reductions, it is also focused on economic recovery, economic development, equity, and community health and vitality. A focus on climate action at the community and agency-wide scale presents a generational opportunity to reorient investments to clean, efficient, and equitable systems. Through the goals, measures, and actions identified in the Climate Action Plan, the City, in close partnership with the community, has identified a path to achieve its emissions reduction goals while improving affordability, health, and wellbeing. The realized co-benefits of climate action and GHG emissions reduction, including efficiency, cost- savings, safety, and comfort, have the potential to enhance San Luis Obispo while inspiring community action and action from other communities that look to the City for leadership. The City continues to engage other departments, agencies, and community partners to ensure the implementation outcome of each GHG reduction measure are maximized to support public health, economic development and COVID-19 recovery, and other key objectives. A short list of achievements and recent initiatives include: x Effective January 1, 2020, the City joined Central Coast Community Energy (formerly Monterey Bay Community Power). As a member of CCCE, the City and residents purchase cleaner and more affordable electricity. CCCE is on a path to have one-hundred percent renewable energy by 2030. x Effective September 1, 2020, the Clean Energy Choice Program for New Buildings provides technical support, financial incentives, regulatory flexibility, and information resources to developers that wish to build all-electric new projects. The program is expected to dramatically reduce GHG emissions in new buildings while promoting energy efficient, comfortable buildings, and reduced construction costs. x Staff has initiated a “Lead by Example” initiative to achieve the City’s internal climate goal of carbon neutral city operations by 2030. Staff has convened the Green Team to collaboratively identify new decarbonization measures while finding opportunities to support current projects across various departments. Administrative Action Buildings Circular Economy Connected Energy Lead by Example Natural Solutions Packet Page 194 Item 14 Continued next page.. Æ Foundational Action Action Description Responsible Department Projected Action Start Date (calendar year) Current Status Administrative Action 1 Implement Climate Action Plan with an Equity Lens All Departments Ongoing Initiated Administrative Action 2 Monitor and Report Plan Implementation Administration, All Departments 2021, Q2 Pursuing outside resources. Administrative Action 3 Regularly Update the Climate Action Plan Administration 2022, Q2 2021-23 Financial Plan Administrative Action 4 Ensure Transparency by Reporting Greenhouse Gas and Climate Action Information to Public Disclosure Programs Administration 2020, Q3 Initiated Administrative Action 5 Develop Mitigation Program for New Development to Illustrate Consistency with the Climate Action Plan Community Development, Administration 2021, Q2 Done or Nearly Complete Buildings 1.1 Adopt and implement the Clean Energy Choice Program for New Buildings and review opportunities for improvement in the 2022 code cycle Administration, Community Development 2020, Q3 Done or Nearly Complete Buildings 2.1 Conduct comprehensive retrofit program study and develop and implement a strategic and equity focused building retrofit program by 2021 Administration, Community Development 2020, Q3 Initiated Circular Economy 1.1 Adopt an ordinance requiring organic waste subscription for all residential and commercial customers by 2022 Utilities 2022, Q1 Initiated Circular Economy 1.2 Develop and implement program to increase edible food rescue by 20 percent Utilities 2021, Q2 Uncertain Implementation Path Circular Economy 1.3 Develop and implement a waste stream education program for HOA/Property Managers and the commercial sector Utilities 2021, Q2 2021-23 Financial Plan Circular Economy 2.1 Update the Municipal Code solid waste section and bin enclosure standards Utilities 2021, Q1 Initiated Circular Economy 2.2 Develop and expand funding for a Solid Waste section in the Utilities Department Utilities 2020, Q1 Done or Nearly Complete Connected 1.1 Establish a consistent method for tracking and reporting mode split metrics Public Works 2021, Q1 2021-23 Financial Plan Connected 1.2 Research and develop an approach to a “Mobility as a Service” platform for people to easily use all modes of low carbon mobility in the City Administration, Public Works 2021, Q1 Pursuing outside resources. Connected 2.1 Complete Active Transportation plan and begin implementation immediately Public Works 2020, Q1 Done or Nearly Complete Connected 2.2 Launch micro mobility program by 2021 Public Works 2020, Q3 Initiated Connected 3.1 Establish a policy and strategic approach to leveraging existing and new parking garages for downtown residential and visitor serving uses and to allow for further implementation of the Downtown Concept Plan Administration, Public Works 2020, Q3 Initiated Packet Page 195 Item 14 Foundational Action Action Description Responsible Department Projected Action Start Date (calendar year) Current Status Connected 4.1 Develop transit electrification strategic plan and begin implementing in 2020 Public Works, Administration 2020, Q3 Initiated Connected 4.2 Shorten transit headways through accelerated implementation of the existing Short-Range Transit Plan Public Works 2021, Q1 2021-23 Financial Plan Connected 4.3 Explore additional innovative transit options in the 2022 Short-Range Transit Plan (e.g., on-demand deviated routes, electric fleet expansion, micro transit, Bus Rapid Transit, Transit Signal Priority) Public Works 2021, Q1 2021-23 Financial Plan Connected 4.4 Assess feasibility of a “free to the user” transit ridership program Administration, Public Works 2020, Q3 2021-23 Financial Plan Connected 5.1 Complete the 2019-21 Housing Element of the General Plan Update and Flexible Zoning Requirements for Downtown Community Development 2020, Q3 Initiated Connected 6.1 Develop and begin implementing electric mobility plan to achieve a goal of 40 percent electric vehicle miles traveled (VMT) by 2035 Administration, Public Works 2020, Q3 Pursuing outside resources. Energy 1.1 Launch Monterey Bay Community Power and achieve a 98% participation rate while advocating for programs that support equity and achieve maximum local benefit Community Development 2020, Q1 Done or Nearly Complete Energy 2.1 Work with MBCP and PG&E to develop a regional grid reliability strategy Administration 2020, Q1 Initiated Energy 3.1 Partner with SoCal Gas to research options for reducing greenhouse gas emissions associated with the existing natural gas grid Administration 2021, Q1 Initiated Lead by Example 1.1 Adopt a municipal carbon neutrality plan in 2021 Administration 2020, Q4 Initiated Lead by Example 2.1 Include carbon neutrality, social equity, and a focus on developing a green local economy in the updated Economic Development Strategic Plan Administration 2021, Q1 2021-23 Financial Plan Lead by Example 3.1 Research methods to support local contractors and labor Administration 2021, Q3 Pursuing outside resources. Lead by Example 4.1 Create a formal approach to support and empower community collaboration for climate action Administration 2021, Q3 Pursuing outside resources. Natural Solutions 1.1 Conduct Carbon Farming Study and Pilot Project in 2021. If feasible, begin implementation by 2023 Administration 2021, Q4 Initiated Natural Solutions 2.1 Prepare the City’s first Urban Forest Master Plan by 2021 and plant and maintain 10,000 new trees by 2035 Administration, Public Works 2021, Q1 Initiated Packet Page 196 Item 14 Rate Setting Objectives 1. Easy to understand 2. Environmentally sound 3. Supportive of waste reduction goals Department Name: Utilities Cost Center:N/A For Agenda of:November 17, 2020 Placement:Public Hearing Estimated Time:20 minutes FROM: Aaron Floyd, Utilities Director Prepared By:Jennifer Thompson, Utilities Business Manager Jordan Lane, Interim Solid Waste & Recycling Coordinator SUBJECT:2020 INTERIM YEAR SOLID WASTE RATE ADOPTION RECOMMENDATION Adopt a Resolution (Attachment A) establishing Integrated Solid Waste Rates. DISCUSSION Background The City currently has three distinct contracts with San Luis Garbage Company (the Garbage Company) for hauling solid waste, recycling, and organic/green waste (Attachments B-D). These contracts outline the obligations of both parties in areas such as service delivery, record keeping, and regulatory compliance. In accordance with these contracts, the City’s solid waste, recycling, and organic/green waste is collected for processing by the Garbage Company each week for residential customers and up to seven days per week for commercial customers. The City has a longstanding relationship with San Luis Garbage Company that has resulted in a high level of service for many years. The City’s Rate Setting Process and Proposed Increases The City’s Solid Waste Rate Setting Manual (Attachment E) serves to guide the three-year rate setting process. As part of the rate request review and analysis, the Garbage Company outlines the revenues, expenditures, profits, and operational information that is necessary to measure compliance with the Solid Waste Rate Setting Manual and to document the need for the proposed rate increase. In addition to the financial documentation requirements, the Solid Waste Rate Setting Manual aims to have rates that are environmentally sound, easy to understand, and supportive of the City’s waste reduction goals. The Solid Waste Rate Setting Manual has been used as the region’s guiding document since 1994, and the City acknowledges that it should be updated to reflect current laws and regulations. The proposed Solid Waste Rate Setting Manual Update is one component of the proposed rate adjustment. Packet Page 197 Item 15 The three-year rate setting process entails a base year rate setting with newly established rates, followed by two interim years with more stringent criteria regarding the request of a rate change. Through the rate setting process, annual increases related to Consumer Price Index (CPI) and AB939 related fees are approved in the base years and applied to the interim years. The most recent base year rates were adopted by Council in June 2019. The Garbage Company initially submitted an Interim Year Rate Adjustment Application (Attachment F) to the City on November 6, 2019 requesting a 5.28 percent rate increase in addition to the approved annual CPI and AB939 related fee increases that were applied in January 2020 and will be applied again in January of 2021. The rate request came as a direct result of an increase in tipping fees at the Cold Canyon Processing Facility, the local recycling facility. Tipping fees are fees paid by a party disposing of waste at a facility and are based on the weight of the load. These fees are reviewed during every base year rate setting and should they increase or decrease, those changes would be reflected in the rate setting. In correlation to a decline in the recycling market, tipping fees at the Processing Facility rose from $67.50 per ton to $96.00 per ton creating a negative financial impact of over $300,000 annually to the Garbage Company. In addition to tipping fee related increases, the City proposes the financing of a third-party Solid Waste Rate Study and Solid Waste Rate Setting Manual Update in this rate adjustment period to guarantee just and equitable rates in the next base year of 2022. After review of the revenues, expenses, and operational data contained within the rate application, and assessment of the cost to perform a rate study and solid waste rate setting manual update, staff has found that the rate request meets the requirements of the City’s current Solid Waste Rate Setting Manual. Key Factors Contributing to Increased Solid Waste Collection/Disposal Costs Recycled Material Processing Costs Recycling tipping fee increases are largely attributed to global recycling market instability and the reality that many unexpected costs of recycling were unaccounted for. The rapid change in international markets resulted in a substantial decrease in the market value of recycled materials. Additionally, increased recycling contamination, caused by “wishful recycling,” combined with more strict contamination restrictions, has led to higher recycling processing costs. These issues have increased recycling tipping fees at the Processing Facility from $67.50 per ton to $96.00 per ton. The $96.00 per ton cost will impact recycling generated within the City of San Luis Obispo and also recyclable material hauled to the Cold Canyon Processing Facility from other local cities. Third-party Solid Waste Rate Study and Solid Waste Rate Setting Manual Update Every three years, the Garbage Company performs a solid waste rate audit as required by the Solid Waste Rate Setting Manual. Historically, the studies have been performed under contracts held by the Garbage Company. Prior to the next base year rate setting in 2022, the City will pursue third-party rate validation through a Request for Proposal and a contract managed by the City of San Luis Obispo. Packet Page 198 Item 15 The City acknowledges the benefits of having a third-party agency provide a thorough rate study to validate compliance with Proposition 218, which states that the cost to receive a property- related service may not exceed the cost of providing that service. Findings will be presented before City Council with the base year rate setting application in 2021-2022, along with a recommendation for rate setting. Concurrently, the third-party contract agency will be responsible for producing a Solid Waste Rate Setting Manual Update. The Solid Waste Rate Setting Manual was written in 1994 and is missing crucial legislative language that has been adopted since its establishment. A portion of the $150,000 budget will be used to update the Solid Waste Rate Setting Manual, and a portion will be use to perform the Solid Waste Rate Study. Upon completion of the Rate Study and Rate Setting Manual Update, during assessment of costs for the 2022 rate setting, the $150,000 funding will be removed from consideration as it is a one-time cost to be used prior to the 2022 base year. Table 1: Key Rate Increase Factors 1a: Residential 1b: Commercial San Luis Garbage Commitment to Service Like many agencies, San Luis Garbage Company has been faced with challenges during the pandemic. After occurrences of COVID-related staffing shortages, the Garbage Company had to adapt and rearrange their resources to maintain consistent service. While the Fall Clean Up Week was canceled as a result of these shortages, service of all three waste streams has remained consistent with little to no notable interruption. The proposed rate increase will enable the Garbage Company to continue serving the City of San Luis Obispo with high levels of solid waste, recycling, and organics service. Key Factor Proposed Rate Increase Recycled material processing costs 3.69% Third-party Solid Waste Rate Study and Rate Setting Manual Update 1.65% Total Proposed Residential Rate Increase 5.34% Key Factor Proposed Rate Increase Recycled material processing costs 3.87% Third-party Solid Waste Rate Study and Rate Setting Manual Update 1.73% Total Proposed Commercial Rate Increase 5.60% Packet Page 199 Item 15 Previous Council or Advisory Body Action On June 18, 2019, City Council approved a solid waste rate increase of 13.72%, which enabled San Luis Garbage to maintain recycling hauling service, provided support of an energy efficient fleet necessary to meet compliance with State emissions regulations, and enabled hauling and processing organic materials at the anaerobic digestion facility under a new organics program. Policy Context The recommendation to increase solid waste rates to maintain three-streams (solid waste, recycling, organic waste) of service to our community aligns not only with our current Solid Waste Rate Setting Manual, City’s Climate Action Plan1, and Municipal Code 2, but also with regulations of the State of California. To ensure all three-streams are available to all members of the community, we must account for the cost of each program when considering rate adjustments. The Climate Action Plan and state regulations like Assembly Bill 9393 and Senate Bill 13834 identify the impacts of a lack of service as being detrimental to diversion goals and to the environment. For example, organic waste hauled as solid waste and sent to the landfill contributes to the environmentally harmful generation of methane gas which is then exposed to our environment and community. In regards to recycling, as the market for recyclable materials becomes more competitive and wains in response to global policy, the tipping fees at the facility may rise or fall. Each of these examples contributes to an overall cost of operations that must be calculated and accounted for in rate setting. Public Engagement In compliance with the Proposition 218 (Prop 218) noticing schedule, San Luis Garbage mailed a notice to each property in the City on September 25 th, more than 45 days prior to the November 17th City Council meeting. The notice includes the proposed rate increase, a summary of the purpose of the increase, a fee schedule, and instructions on how to protest the proposed increase. The notices are also posted on the Garbage Company’s website and are attached to the November 17th City Council Agenda Packet. If the proposed rates are approved, the rate study results will also be shared with the public and City Council at a meeting prior to the 2022 rate setting base year. CONCURRENCE The City’s Finance Department concurs with the recommended action. ENVIRONMENTAL REVIEW The California Environmental Quality Act (CEQA) does not apply to the recommended action, 1 City of San Luis Obispo Climate Action Plan Update and CEQA GHG Emissions Thresholds. (2020, August 3). Retrieved from https://www.slocity.org/home/showdocument?id=27813 2 City of San Luis Obispo Municipal Code Section 8.04.040 "Collection Required at Least Once a Week.". Retrieved from https://sanluisobispo.municipal.codes/Code/8.04.040 3 H.R. AB-939 Solid waste management, source reduction, recycling, composting, and market development., Section 11553 of the Government Code (1989) (enacted). 4 S. SB-1383, Chapter 13.1 (commencing with Section 42652) to Part 3 of Division 30 of the Public Resources Code SB-1383 Short-lived climate pollutants: methane emissions: dairy and livestock: organic waste: landfills. (2016) (enacted). Packet Page 200 Item 15 because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. FISCAL IMPACTS Budgeted: NA Budget Year: NA Funding Identified: NA Fiscal Analysis: The proposed solid waste rate increases are to become effective on December 1, 2020. Proposed rates for residential customers can be found in Attachment G, while proposed rates for commercial customers can be found in Attachment H. Sample increases for standard residential and commercial customers are listed in Tables 2a and 2b below. The annual fiscal impact to the City accounts is shown in Tables 3a and 3b below. Table 2a: Standard Residential Service Rate Increases Table 2b: Standard Commercial Service Rate Increases Table 3a: Fiscal Impact to City Cost Centers The City pays solid waste bills for its facilities so it will also see an increase to its bills. The total increase across all funds is $3,447.14 per year. Operating Expenditures Funding Sources Current Cost (annual) Proposed Rate Change New Cost (annual) Difference (annual) General Fund $34,028.04 +5.6%$35,933.61 $1,905.57 Sewer Fund $23,344.50 +5.6%$24,651.79 $1,307.29 Water Fund $3,534.66 +5.6%$3,732.60 $197.94 Parking Fund $648.84 +5.6%$685.18 $36.34 Total $61,556.04 +5.6%$65,003.18 $3,447.14 Service Level (includes solid waste, recycling, and organics services)Current Rate Proposed Rate Monthly Difference Economy Rate (32 Gallon Container)$16.76 $17.65 +$0.89 Standard Rate (64 Gallon Container)$33.53 $35.32 +$1.79 Premium Rate (96 Gallon Container)$50.29 $52.98 +$2.69 Service Level (includes solid waste, recycling, and organics services)Current Rate Proposed Rate Monthly Difference 2 Yd Dumpster Service 1x Weekly $131.64 $139.02 +$7.38 2 Yd Dumpster Service 2x Weekly $197.45 $208.51 +$11.06 2 Yd Dumpster Service 3x Weekly $263.32 $278.07 +$14.75 Packet Page 201 Item 15 Table 3b: Fiscal Impact to City Franchise Fee The Franchise Fee is established in the Solid Waste Contract as ten percent of the Franchisee’s gross revenues for collection and disposal of solid waste within the City. Franchise fee payments are paid monthly from the Garbage Company to the City’s General Fund. The rate increase will result in an annual increase of $51,254.29 in general fund franchise fees. Franchise Fee Revenue Funding Sources Current Budget (annual) Proposed Rate Change New Budget (annual) Difference (annual) General Fund $943,909.56 +5.43%$995,163.85 $51,254.29 Total $943,909.56 +5.43%$995,163.85 $51,254.29 ALTERNATIVES Council may elect not to approve the proposed solid waste rates.The proposed solid waste rates are necessary to continue providing environmentally sound solid waste, recycling, and organic waste collection, and processing services to the community. Staff believes that the level of service provided to the community by San Luis Garbage meets the community’s needs and expectations, despite current global challenges. Without approval of the proposed rate increase, the outdated version of the Solid Waste Rate Setting Manual will remain as the guiding document for the City’s rate setting process, the City will not have oversight over the next solid waste rate study for base year 2022, and the Garbage Company will be operating at a revenue shortfall of over $300,000 per year. Consequences of the aforementioned outcomes include operating under an ineffective and noncompliant rate setting manual until City and Garbage Company staff can successfully update the rate setting manual internally, making major rate setting decisions based only on a final report released by the Garbage Company, and expecting potential changes to service due to cost cutting measures the Garbage Company may take as a result of decreased funding. Additionally, the rates offered by San Luis Garbage are competitive and reasonably priced as compared to other jurisdictions in the region and state. Therefore, this alternative is not recommended. Packet Page 202 Item 15 Attachments: a - Draft Resolution b - COUNCIL READING FILE - Solid Waste Contract dated August 20, 2010 c - COUNCIL READING FILE - Recycling Contract dated August 20, 2010 d - COUNCIL READING FILE - Green Waste Contract dated November 19, 2015 e - COUNCIL READING FILE - Solid Waste Rate Setting Manual f - Interim Year Rate Application g - Residential Prop 218 h - Commercial Prop 218 Packet Page 203 Item 15 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, ESTABLISHING INTEGRATED SOLID WASTE RATES WHEREAS,on June 21, 1994, the City Council of the City of San Luis Obispo approved the Rate Setting Manual Process and Methodology Manual for Integrated Solid Waste Management Rates; and WHEREAS,an accurate and final rate application was received from San Luis Garbage Company on August 6, 2020 requesting an increase of residential solid waste rates by 5.34 percent and an increase of commercial solid waste rates by 5.60 percent; and WHEREAS,notices regarding the requested rate increase were mailed to all property owners and customers 45 days prior to the November 17, 2020 public hearing; and WHEREAS,sufficient protests were not received to prevent the rate increase; and WHEREAS,a review of San Luis Garbage Company’s 2020 Interim Year Solid Waste Rate Application has been completed in accordance with the adopted solid waste rate setting policies. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: SECTION 1.Resolution No. 11025 (2019 series) is hereby rescinded as of 11:59 p.m., November 17, 2020. Packet Page 204 Item 15 Resolution No. _____ (2020 Series) Page 2 R ______ SECTION 2.Rate increase outlined in Exhibit F shall become effective at 12:00 a.m. December 1, 2020, as outlined in the Proposition 218 notification. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of _____________________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on ____________________________. ____________________________________ Teresa Purrington City Clerk Packet Page 205 Item 15 Resolution No. _____ (2020 Series) Page 3 R ______ EXHIBIT A SINGLE FAMILY AND MULTI-UNIT RESIDENTIAL (4 UNITS OR LESS) SAN LUIS GARBAGE COMPANY, INC. APPROVED BASE RATE INCREASE CITY OF SAN LUIS OBISPO SERVICE DESCRIPTION PICK APPROVED RATE ADJUSTMENT % NEW MONTHLY UPS CURRENT RATE PER RATE EFFECTIVE WEEK 12/01/2020 Price per month for specified waste-wheeler container collected once each week. One Greenwaste container (green lid) and one recycling container (blue lid) service is included at no additional charge. MINI-CAN SERVICE One 19 gallon waste wheeler container 1 $10.51 5.34%$11.07 ECONOMY RATE One 32 gallon waste wheeler container 1 $16.76 5.34%$17.65 STANDARD RATE One 64 gallon waste wheeler container 1 $33.53 5.34%$35.32 PREMIUM RATE One 96 gallon waste wheeler container 1 $50.29 5.34%$52.98 PREMIUM PLUS RATE One 96 gallon waste wheeler at the premium rate plus an additional charge of: One 32 gallon waste wheeler container 1 $15.28 5.34%$16.09 One 64 gallon waste wheeler container 1 $30.59 5.34%$32.22 One 96 gallon waste wheeler container 1 $45.85 5.34%$48.29 DESIGNED MANUAL SERVICE (determined by city staff) MINI-CAN SERVICE 1 $17.06 5.34%$17.97 ECONOMY RATE 1 $27.28 5.34%$28.74 STANDARD RATE 1 $54.60 5.34%$57.52 PREMIUM RATE 1 $81.85 5.34%$86.22 LONG TERM VACANT RATE (UNFURNISHED)1 $8.62 5.34%$9.08 SERVICE AWAY FROM THE STREET CURB Additional per month per can or container charge $11.43 5.34%$12.04 Packet Page 206 Item 15 Resolution No. _____ (2020 Series) Page 4 R ______ USED OIL COLLECTION - no charge (Call for details and pick up information). LATE MAKEUP COLLECTIONS WITH GARBAGE TRUCK (Phone call required) Per trip charge plus charges identified below for any extra containers or equivalent volume.$16.92 5.34%$17.82 Additional charge per 32 gallon can or equivalent volume per collection.$8.39 5.34%$8.84 RESIDENTIAL - OTHER CHARGES: TAX LIEN CERT. MAIL FEE $4.05 5.34%$4.27 SPECIAL TRIP FEE $50.73 5.34%$53.44 LOOSE CARDBOARD $8.99 5.34%$9.47 RESTART FEE-RESIDENTIAL $25.36 5.34%$26.71 WHITE GOODS $31.69 5.34%$33.38 XTRA RECYCLE 64 OR 96 GAL CART $1.76 5.34%$1.85 XTRA GREENWASTE 64 OR 96 GAL CART $6.52 5.34%$6.87 EXTRA COLLECTIONS WITH PICKUP OR FLATBED TRUCK (Phone call required) Per trip, plus applicable amount below:$25.51 5.34%$26.87 Per garbage can or equivalent volume. (Over 6 cans by quotation)$8.39 5.34%$8.84 Per recycling can or equivalent volume. (Over 6 cans by quotation)$4.20 5.34%$4.42 Per white good article/ appliance. (Once a month only)$18.74 5.34%$19.74 Per piece of furniture.$18.74 5.34%$19.74 Per mattress or boxspring.$18.74 5.34%$19.74 x Customers requesting Temporary Bins or Rolloff boxes service can call the office for current rates. x Polystyrene (Styrofoam, Plastic #6) is no longer collected for recycling and should be thrown away as trash. x Once a week pick-up of one Greenwaste container (green) and one recycling container (blue) are included in the solid waste service fee. x Recycling and greenwaste containers should be placed near/next to your garbage container for collection 3 feet apart. x Late Fees are imposed for residential customers over 30 days delinquent and commercial customers over 30 days delinquent. The fee is 1.5% per month of the outstanding charge, with a minimum fee of $5.00. No prior notice is required, as this late fee policy is stated at the bottom of every bill. Packet Page 207 Item 15 Resolution No. _____ (2020 Series) Page 5 R ______ COMMERCIAL AND MULTI-UNIT RESIDENTIAL (5 UNITS OR MORE) LATE MAKEUP COLLECTIONS WITH GARBAGE TRUCK (Phone call required) Description Frequency Current Rate Increase %New Rate Per trip charge plus charges identified below for any extra containers or equivalent volume.Per Trip $17.02 5.60%$17.97 Additional charge per 32 gallon can or equivalent volume per collection.Unit $9.12 5.60%$9.63 Additional charge per 64 gallon can or equivalent volume per collection.Unit $18.24 5.60%$19.26 Additional charge per 96 gallon can or equivalent volume per collection.Unit $27.36 5.60%$28.89 EXTRA COLLECTIONS WITH PICKUP OR FLATBED TRUCK (Phone call required) Per trip, plus applicable amount below:$25.51 5.60%$26.94 Per garbage can or equivalent volume. (Over 6 cans by quotation)$9.12 5.60%$9.63 Per recycling can or equivalent volume. (Over 6 cans by quotation)$4.22 5.60%$4.46 Per white good article/ appliance. (Once a month only)$18.74 5.60%$19.79 Per piece of furniture.$18.74 5.60%$19.79 Per mattress or boxspring.$18.74 5.60%$19.79 Delivery Charge Per Trip $27.60 5.60%$29.15 Commercial maintenance fee (per dumpster/can)Per Trip $25.51 5.60%$26.94 COMMERCIAL GARBAGE CANS SERVICE PER MONTH Description Frequency Current Rate Increase %New Rate One 32 Gallon Can 1 $29.74 5.60%$31.41 One 32 Gallon Can 2 $46.68 5.60%$49.29 One 32 Gallon Can 3 $63.72 5.60%$67.29 One 32 Gallon Can 4 $80.66 5.60%$85.18 One 32 Gallon Can 5 $97.63 5.60%$103.10 One 32 Gallon Can 6 $114.62 5.60%$121.04 One 32 Gallon Can 7 $131.57 5.60%$138.94 Two 32 Gallon Cans 1 $38.22 5.60%$40.36 Two 32 Gallon Cans 2 $59.48 5.60%$62.81 Two 32 Gallon Cans 3 $80.68 5.60%$85.20 Two 32 Gallon Cans 4 $101.91 5.60%$107.62 Two 32 Gallon Cans 5 $123.19 5.60%$130.09 Two 32 Gallon Cans 6 $144.40 5.60%$152.49 Packet Page 208 Item 15 Resolution No. _____ (2020 Series) Page 6 R ______ Two 32 Gallon Cans 7 $165.63 5.60%$174.91 Three 32 Gallon Cans 1 $46.70 5.60%$49.32 Three 32 Gallon Cans 2 $72.25 5.60%$76.30 Three 32 Gallon Cans 3 $97.70 5.60%$103.17 Three 32 Gallon Cans 4 $123.25 5.60%$130.15 Three 32 Gallon Cans 5 $148.68 5.60%$157.01 Three 32 Gallon Cans 6 $174.17 5.60%$183.92 Three 32 Gallon Cans 7 $199.68 5.60%$210.86 Four 32 Gallon Cans 1 $55.22 5.60%$58.31 Four 32 Gallon Cans 2 $84.96 5.60%$89.72 Four 32 Gallon Cans 3 $114.66 5.60%$121.08 Four 32 Gallon Cans 4 $144.41 5.60%$152.50 Four 32 Gallon Cans 5 $174.14 5.60%$183.89 Four 32 Gallon Cans 6 $203.90 5.60%$215.32 Four 32 Gallon Cans 7 $233.58 5.60%$246.66 Five 32 Gallon Cans 1 $63.74 5.60%$67.31 Five 32 Gallon Cans 2 $97.67 5.60%$103.14 Five 32 Gallon Cans 3 $131.65 5.60%$139.02 Five 32 Gallon Cans 4 $165.61 5.60%$174.88 Five 32 Gallon Cans 5 $199.63 5.60%$210.81 Five 32 Gallon Cans 6 $233.56 5.60%$246.64 Five 32 Gallon Cans 7 $267.53 5.60%$282.51 Six 32 Gallon Cans 1 $72.25 5.60%$76.30 Six 32 Gallon Cans 2 $110.42 5.60%$116.60 Six 32 Gallon Cans 3 $148.62 5.60%$156.94 Six 32 Gallon Cans 4 $186.86 5.60%$197.33 Six 32 Gallon Cans 5 $225.04 5.60%$237.64 Six 32 Gallon Cans 6 $263.27 5.60%$278.01 Six 32 Gallon Cans 7 $301.46 5.60%$318.34 *Rates for all Gallon Can customers include recycling pickup once per week. Additional service frequencies can be provided at 25% of the service rate for the specified level of service required above. COMMERCIAL WASTE WHEELER CONTAINER SERVICE PER MONTH Description Frequency Current Rate Increase %New Rate One 96 Gallon Waste Wheeler 1 $53.01 5.60%$55.98 One 96 Gallon Waste Wheeler 2 $84.87 5.60%$89.62 One 96 Gallon Waste Wheeler 3 $116.73 5.60%$123.27 One 96 Gallon Waste Wheeler 4 $148.56 5.60%$156.88 One 96 Gallon Waste Wheeler 5 $180.46 5.60%$190.57 Packet Page 209 Item 15 Resolution No. _____ (2020 Series) Page 7 R ______ One 96 Gallon Waste Wheeler 6 $212.27 5.60%$224.16 One 96 Gallon Waste Wheeler 7 $244.14 5.60%$257.81 Two 96 Gallon Waste Wheelers 1 $86.88 5.60%$91.75 Two 96 Gallon Waste Wheelers 2 $133.55 5.60%$141.03 Two 96 Gallon Waste Wheelers 3 $180.27 5.60%$190.37 Two 96 Gallon Waste Wheelers 4 $226.95 5.60%$239.66 Two 96 Gallon Waste Wheelers 5 $273.68 5.60%$289.01 Two 96 Gallon Waste Wheelers 6 $320.34 5.60%$338.28 Two 96 Gallon Waste Wheelers 7 $367.12 5.60%$387.68 Three 96 Gallon Waste Wheelers 1 $120.76 5.60%$127.52 Three 96 Gallon Waste Wheelers 2 $182.31 5.60%$192.52 Three 96 Gallon Waste Wheelers 3 $243.89 5.60%$257.55 Three 96 Gallon Waste Wheelers 4 $0.00 5.60%$0.00 Three 96 Gallon Waste Wheelers 5 $367.05 5.60%$387.60 Three 96 Gallon Waste Wheelers 6 $428.58 5.60%$452.58 Three 96 Gallon Waste Wheelers 7 $490.16 5.60%$517.61 Four 96 Gallon Waste Wheelers 1 $154.61 5.60%$163.27 Four 96 Gallon Waste Wheelers 2 $231.05 5.60%$243.99 Four 96 Gallon Waste Wheelers 3 $308.18 5.60%$325.44 Four 96 Gallon Waste Wheelers 4 $383.91 5.60%$405.41 Four 96 Gallon Waste Wheelers 5 $460.37 5.60%$486.15 Four 96 Gallon Waste Wheelers 6 $536.75 5.60%$566.81 Four 96 Gallon Waste Wheelers 7 $613.26 5.60%$647.60 Five 96 Gallon Waste Wheelers 1 $188.49 5.60%$199.05 Five 96 Gallon Waste Wheelers 2 $279.85 5.60%$295.52 Five 96 Gallon Waste Wheelers 3 $371.10 5.60%$391.88 Five 96 Gallon Waste Wheelers 4 $462.41 5.60%$488.30 Five 96 Gallon Waste Wheelers 5 $553.70 5.60%$584.70 Five 96 Gallon Waste Wheelers 6 $645.01 5.60%$681.13 Five 96 Gallon Waste Wheelers 7 $736.30 5.60%$777.53 Six 96 Gallon Waste Wheelers 1 $222.39 5.60%$234.84 Six 96 Gallon Waste Wheelers 2 $328.55 5.60%$346.95 Six 96 Gallon Waste Wheelers 3 $434.72 5.60%$459.06 Seven 96 Gallon Waste Wheelers 1 $256.25 5.60%$270.60 Eight 96 Gallon Waste Wheelers 1 $290.13 5.60%$306.38 Eight 96 Gallon Waste Wheelers 7 $1,105.52 5.60%$1,167.43 Packet Page 210 Item 15 Resolution No. _____ (2020 Series) Page 8 R ______ * Rates for all Gallon Can customers include recycling pickup once per week. Additional service frequencies can be provided at 25% of the service rate for the specified level of service required above. MULTI-UNIT RESIDENTIAL DUMPSTER CONTAINERS (PER MONTH) Description Frequency Current Rate Increase %New Rate 1 Yd Dumpster 1 $121.04 5.60%$127.82 1 Yd Dumpster 2 $176.29 5.60%$186.16 1 Yd Dumpster 3 $231.44 5.60%$244.40 1 Yd Dumpster 4 $286.64 5.60%$302.69 1 Yd Dumpster 5 $341.88 5.60%$361.03 1 Yd Dumpster 6 $397.04 5.60%$419.27 1 Yd Dumpster 7 $452.25 5.60%$477.58 1.5 Yd Dumpster 1 $140.13 5.60%$147.98 1.5 Yd Dumpster 2 $216.56 5.60%$228.69 1.5 Yd Dumpster 3 $293.02 5.60%$309.43 1.5 Yd Dumpster 4 $369.44 5.60%$390.13 1.5 Yd Dumpster 5 $445.86 5.60%$470.83 1.5 Yd Dumpster 6 $522.29 5.60%$551.54 1.5 Yd Dumpster 7 $598.70 5.60%$632.23 2 Yd Dumpster 1 $159.23 5.60%$168.15 2 Yd Dumpster 2 $254.80 5.60%$269.07 2 Yd Dumpster 3 $350.32 5.60%$369.94 2 Yd Dumpster 4 $445.86 5.60%$470.83 2 Yd Dumpster 5 $541.40 5.60%$571.72 2 Yd Dumpster 6 $636.94 5.60%$672.61 2 Yd Dumpster 7 $732.46 5.60%$773.48 3 Yd Dumpster 1 $197.43 5.60%$208.49 3 Yd Dumpster 2 $331.23 5.60%$349.78 3 Yd Dumpster 3 $464.98 5.60%$491.02 3 Yd Dumpster 4 $598.77 5.60%$632.30 3 Yd Dumpster 5 $732.50 5.60%$773.52 3 Yd Dumpster 6 $866.30 5.60%$914.81 3 Yd Dumpster 7 $1,000.07 5.60%$1,056.07 4 Yd Dumpster 1 $235.68 5.60%$248.88 4 Yd Dumpster 2 $409.77 5.60%$432.72 4 Yd Dumpster 3 $583.92 5.60%$616.62 4 Yd Dumpster 4 $758.05 5.60%$800.50 4 Yd Dumpster 5 $932.13 5.60%$984.33 Packet Page 211 Item 15 Resolution No. _____ (2020 Series) Page 9 R ______ 4 Yd Dumpster 6 $1,106.28 5.60%$1,168.23 4 Yd Dumpster 7 $1,280.44 5.60%$1,352.14 6 Yd Dumpster 1 $312.08 5.60%$329.56 6 Yd Dumpster 2 $564.76 5.60%$596.39 6 Yd Dumpster 3 $817.46 5.60%$863.24 6 Yd Dumpster 4 $1,070.14 5.60%$1,130.07 6 Yd Dumpster 5 $1,322.84 5.60%$1,396.92 6 Yd Dumpster 6 $1,625.07 5.60%$1,716.08 6 Yd Dumpster 7 $1,845.18 5.60%$1,948.51 COMMERCIAL DUMPSTER CONTAINER SERVICE - In cubic yards Description Frequency Current Rate Increase %New Rate 1 Yd Dumpster 1 $106.16 5.60%$112.10 1 Yd Dumpster 2 $148.62 5.60%$156.94 1 Yd Dumpster 3 $191.11 5.60%$201.81 1 Yd Dumpster 4 $233.56 5.60%$246.64 1 Yd Dumpster 5 $276.01 5.60%$291.47 1 Yd Dumpster 6 $318.50 5.60%$336.34 1 Yd Dumpster 7 $360.97 5.60%$381.18 1.5 Yd Dumpster 1 $118.91 5.60%$125.57 1.5 Yd Dumpster 2 $174.09 5.60%$183.84 1.5 Yd Dumpster 3 $229.28 5.60%$242.12 1.5 Yd Dumpster 4 $284.51 5.60%$300.44 1.5 Yd Dumpster 5 $339.70 5.60%$358.72 1.5 Yd Dumpster 6 $394.92 5.60%$417.04 1.5 Yd Dumpster 7 $450.12 5.60%$475.33 2 Yd Dumpster 1 $131.64 5.60%$139.01 2 Yd Dumpster 2 $197.45 5.60%$208.51 2 Yd Dumpster 3 $263.32 5.60%$278.07 2 Yd Dumpster 4 $329.12 5.60%$347.55 2 Yd Dumpster 5 $394.95 5.60%$417.07 2 Yd Dumpster 6 $460.77 5.60%$486.58 2 Yd Dumpster 7 $526.60 5.60%$556.09 3 Yd Dumpster 1 $157.12 5.60%$165.92 3 Yd Dumpster 2 $248.39 5.60%$262.30 3 Yd Dumpster 3 $339.70 5.60%$358.72 3 Yd Dumpster 4 $431.00 5.60%$455.14 3 Yd Dumpster 5 $522.29 5.60%$551.54 3 Yd Dumpster 6 $613.60 5.60%$647.96 3 Yd Dumpster 7 $704.93 5.60%$744.41 Packet Page 212 Item 15 Resolution No. _____ (2020 Series) Page 10 R ______ 4 Yd Dumpster 1 $182.57 5.60%$192.79 4 Yd Dumpster 2 $301.49 5.60%$318.37 4 Yd Dumpster 3 $420.36 5.60%$443.90 4 Yd Dumpster 4 $539.29 5.60%$569.49 4 Yd Dumpster 5 $658.17 5.60%$695.03 4 Yd Dumpster 6 $777.07 5.60%$820.59 4 Yd Dumpster 7 $896.01 5.60%$946.19 6 Yd Dumpster 1 $233.51 5.60%$246.59 6 Yd Dumpster 2 $401.27 5.60%$423.74 6 Yd Dumpster 3 $569.04 5.60%$600.91 6 Yd Dumpster 4 $736.80 5.60%$778.06 6 Yd Dumpster 5 $904.56 5.60%$955.22 6 Yd Dumpster 6 $1,072.30 5.60%$1,132.35 6 Yd Dumpster 7 $1,240.09 5.60%$1,309.54 8 Yd Dumpster 1 $284.48 5.60%$300.41 8 Yd Dumpster 2 $501.04 5.60%$529.09 8 Yd Dumpster 3 $717.64 5.60%$757.83 8 Yd Dumpster 4 $934.24 5.60%$986.56 8 Yd Dumpster 5 $1,150.84 5.60%$1,215.29 8 Yd Dumpster 6 $1,367.38 5.60%$1,443.95 8 Yd Dumpster 7 $1,583.99 5.60%$1,672.69 Sunday Service *$74.33 5.60%$78.49 The rates shown above include the monthly container rental fee and are the same for bins and garwoods, when volume is identical. (Bins and garwoods are types of containers) UNSCHEDULED EXTRA COLLECTIONS FOR COMMERCIAL CUSTOMERS & MULTI-UNIT 1 CUBIC YARD Per Lift $48.86 5.60%$51.60 1.5 CUBIC YARD Per Lift $54.19 5.60%$57.22 2 CUBIC YARDS Per Lift $63.73 5.60%$67.30 3 CUBIC YARDS Per Lift $78.56 5.60%$82.96 4 CUBIC YARDS Per Lift $93.42 5.60%$98.65 COMMERCIAL - OTHER CHARGES: Description Frequency Current Rate Increase %New Rate LOOSE CARDBOARD Per Yard $9.03 5.60%$9.54 LOOSE YARDAGE (SOLID WASTE)Per Yard $36.09 5.60%$38.11 Packet Page 213 Item 15 Resolution No. _____ (2020 Series) Page 11 R ______ REPLACEMENT COST FOR BINS/CONTAINERS Per Quote RENTAL Per Month $42.51 5.60%$44.89 TEMPORARY RENTAL CHARGE Per Day $1.42 5.60%$1.50 WHITE GOODS Per Unit $31.86 5.60%$33.65 TAX LIEN CERT. MAIL FEE Per Mailing $4.05 5.60%$4.28 LOCK CHARGE-FRONT Per Month $79.71 5.60%$84.18 LOCK CHARGE-REAR Per Month $59.76 5.60%$63.11 STAND BY TIME Per Minute $1.18 5.60%$1.25 STATIONARY ROLL-OFF COMPACTORS (PER TON)Per Ton $52.46 5.60%$55.39 STATIONARY ROLL-OFF COMPACTORS (HAUL RATE)Per Hour $163.00 5.60%$172.13 FRONTLOAD COMPACTORS (2X NORMAL RATE)Per Unit 2X rate of matching sized dumpster rate above XTRA 32 64 OR 96 GAL GREENWASTE Per Unit $1.77 5.60%$1.87 XTRA 32 OR 64 OR 96 GAL RECYCLE Per Unit $1.77 5.60%$1.87 RECYCLING SERVICES CARDBOARD & COMMINGLED RECYCLING COLLECTION OF COMMERCIAL DUMPSTER CONTAINERS Description Frequency Current Rate Increase %New Rate 1 Yd Dumpster 1 INCLUDE D * INCLUDED * 1 Yd Dumpster 2 INCLUDE D * INCLUDED * 1 Yd Dumpster 3 $47.78 5.60%$50.46 1 Yd Dumpster 4 $58.40 5.60%$61.67 1 Yd Dumpster 5 $69.00 5.60%$72.86 1 Yd Dumpster 6 $79.65 5.60%$84.11 1 Yd Dumpster 7 $90.23 5.60%$95.28 1.5 Yd Dumpster 1 INCLUDE D * INCLUDED * 1.5 Yd Dumpster 2 INCLUDE D * INCLUDED * 1.5 Yd Dumpster 3 $57.33 5.60%$60.54 1.5 Yd Dumpster 4 $71.11 5.60%$75.09 1.5 Yd Dumpster 5 $84.91 5.60%$89.66 1.5 Yd Dumpster 6 $98.70 5.60%$104.23 1.5 Yd Dumpster 7 $112.53 5.60%$118.83 2 Yd Dumpster 1 INCLUDE D * INCLUDED * 2 Yd Dumpster 2 INCLUDE D * INCLUDED * Packet Page 214 Item 15 Resolution No. _____ (2020 Series) Page 12 R ______ 2 Yd Dumpster 3 $65.81 5.60%$69.50 2 Yd Dumpster 4 $82.27 5.60%$86.88 2 Yd Dumpster 5 $98.71 5.60%$104.24 2 Yd Dumpster 6 $115.22 5.60%$121.67 2 Yd Dumpster 7 $131.65 5.60%$139.02 3 Yd Dumpster 1 INCLUDE D * INCLUDED * 3 Yd Dumpster 2 INCLUDE D * INCLUDED * 3 Yd Dumpster 3 $84.91 5.60%$89.66 3 Yd Dumpster 4 $107.78 5.60%$113.82 3 Yd Dumpster 5 $130.58 5.60%$137.89 3 Yd Dumpster 6 $153.41 5.60%$162.00 3 Yd Dumpster 7 $176.23 5.60%$186.09 4 Yd Dumpster 1 INCLUDE D * INCLUDED * 4 Yd Dumpster 2 INCLUDE D * INCLUDED * 4 Yd Dumpster 3 $105.12 5.60%$111.01 4 Yd Dumpster 4 $134.82 5.60%$142.37 4 Yd Dumpster 5 $164.56 5.60%$173.78 4 Yd Dumpster 6 $194.31 5.60%$205.19 4 Yd Dumpster 7 $223.96 5.60%$236.51 6 Yd Dumpster 1 INCLUDE D * INCLUDED * 6 Yd Dumpster 2 INCLUDE D * INCLUDED * 6 Yd Dumpster 3 $142.28 5.60%$150.25 6 Yd Dumpster 4 $184.21 5.60%$194.53 6 Yd Dumpster 5 $226.16 5.60%$238.82 6 Yd Dumpster 6 $268.07 5.60%$283.08 6 Yd Dumpster 7 $310.03 5.60%$327.39 8 Yd Dumpster 1 INCLUDE D * INCLUDED * 8 Yd Dumpster 2 INCLUDE D * INCLUDED * 8 Yd Dumpster 3 $170.37 5.60%$179.91 8 Yd Dumpster 4 $221.79 5.60%$234.21 8 Yd Dumpster 5 $273.21 5.60%$288.51 8 Yd Dumpster 6 $332.15 5.60%$350.75 8 Yd Dumpster 7 $384.72 5.60%$406.27 Packet Page 215 Item 15 Resolution No. _____ (2020 Series) Page 13 R ______ The rates shown above include the monthly container rental fee and are the same for bins and garwoods, when volume is identical. (Bins and garwoods are types of containers used for recycling) All commercial customers are eligible for one standard waste wheeler recycling at no additional charge. Commercial customers can choose from a 64 or 96 gallon blue waste wheeler once per week for commingled recycling. White office paper can be commingled with the other recyclables in the blue waste wheeler. Polystyrene (Styrofoam, Plastic #6) is no longer collected for recycling and should be thrown away as trash. Late Fees are imposed for commercial customers over 30 days delinquent. The fee is 1.5% per month of the outstanding charge, with a minimum fee of $5.00. No prior notice is required, as this late fee policy is stated at the bottom of every bill. Effective date for rates in Current Rate column was: 6/19/19 This increase is approximately :5.60% Effective Date:12/01/2020 Packet Page 216 Item 15 Resolution No. _____ (2020 Series) Page 14 R ______ EXHIBIT B 1. For residential customers, increases of 3.69 percent on December 1, 2020 for increases in the cost of recycling disposal. 2. For commercial customers, increases of 1.65 percent on December 1, 2020 for proposed solid waste rate study and Rate Setting Manual update performed by a 3 rd party consultant. 3. For commercial customers, increases of 3.87 percent on December 1, 2020 for increases in the cost of recycling disposal. 4. For commercial customers, increases of 1.73 percent on December 1, 2020 for proposed Solid Waste Rate Study and Rate Setting Manual Update performed by a 3 rd party consultant. Packet Page 217 Item 15 Packet Page 218 Item 15 Attachment 1 Financial Information Section I-Base Year Costs Base Year Controllable Costs 6. Total Allowable Costs $7,671,940 7. Plus Allowable Operating Profit $577,458 8. Plus Lease Payments to Affiliated Companies $94,926 9. Equals Total Controllable costs $8,344,324 78.2% Base Year Pass Through Costs 10. Tipping Fees $2,151,960 11. Plus AB 939 and Regulatory Fees $171,224 12. Equals Total Pass Through Costs $2,323,184 21.8% 13.Base Year Revenue Requirements (Before Franchise Fee)$10,667,507 100% Section II-Changes in Costs Change in Controllable Cost 14. Historical Percentage Change in Consumer Price Index 0.0% Change in Pass Through Cost 15. Base Year 2019 Tipping Fees $2,151,960 16. Plus Base Year 2019 AB939 Fees $171,224 17. Equals Total Base Year Pass Through Costs $2,323,184 18 Projected Interim Year 2020 Tipping Fees $2,512,088 19. Projected Interim Year 2020 AB939 Fees and Rate Study and Fee $332,514 20. Equals Total Projected Interim Year Pass Through costs $2,844,602 21. Projected Percentage Change in Pass Through Costs 22.44% Section III-Calculation of Percent Change in Rates Weighted Change in Controllable Costs 22. Controllable Costs as a Percent of Base Year Revenue Requirements 78.2% 23. Multiplied by Percent change in CPI 0.0% 24. Equals Weighted Percent Change in Controllable Costs 0.00% Weighted Change in Pass Through Costs 25. Pass Through Costs as a Percent of Base Yr Revenue Requirements 21.8% 26. Multiplied by Percent Change in Pass Through Costs 22.44% 27. Equals Weighted Percent Change in Pass Through Costs 4.89% Total Change 28. Total Percent Change in Cost (Line 24+ Line 27+ Line 28) 4.89% 29. Divided by Adjustment for Franchise Fee 90% 90.0% 30. Equals Percent change in Existing Rates 5.43% Page 2 of 3 San Luis Garbage Company 2020 Interim Year Rate Adjustment Application Packet Page 219 Item 15 Tipping Fee Change Calculations Tons (1) Rate (2) Extended Per Base Year: 1. Solid Waste Tipping Fees (3) 33,648 41.07$ 1,382,058$ 2. Recyclable Tipping Fees 11,406 67.50$ 769,902 3. Consolidated Tipping Fees 2019 45,054 2,151,960$ Per Interim Year: 4. Solid Waste Tipping Fees 33,648 41.04$ 1,380,824$ 5. Recyclable Tipping Fees 11,784 96.00$ 1,131,264 6. Consolidated Tipping Fees 2020 45,432 2,512,088$ 7. Change in Tipping Fees and Tons 378 360,128$ (1) Tonnage Estimates from Approved Base Year Application for 2019 (2) Rate for Base Year is extended cost/tons. Rate for 2020 interim year replaces the 2019 base year tip fee with the commingle tip fee increase effective October 1, 2019 of $96.00/ton. (3) Includes $1,234 of green waste trucking expense that will not be repeated in the interim year. Page 3 of 3 2020 Interim Year Rate Adjustment Application San Luis Garbage Company (4) Requesting $360,128 above to cover the tipping fee increase to $96/ton and $161,291 ($150,000/.93) to cover the rate manual study cost. The total request is $521,418 not including passthrough fees related to franchise fees. Packet Page 220 Item 15 tŽƌŬƐŚĞĞƚ WĂƐƐƚŚŽƵŐŚĐŽƐƚĂůůŽĐĂƚŝŽŶďLJĐƵƐƚŽŵĞƌĐůĂƐƐ ZĞǀĞŶƵĞZĞƋƵŝƌĞŵĞŶƚďLJĐƵƐƚŽŵĞƌĐůĂƐƐĨƌŽŵϮϬϮϬďĂƐĞLJĞĂƌ ϭ WƌŽũĞĐƚĞĚϮϬϮϬĐŽŵŵĞƌĐŝĂůƌĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚĨƌŽŵďĂƐĞ LJĞĂƌ;ůŝŶĞϰϬĂƐĞzĞĂƌĂƉƉůŝĐĂƚŝŽŶͿ ϱ͕ϵϯϲ͕ϭϵϵ͘ϬϬΨ Ϯ WƌŽũĞĐƚĞĚϮϬϮϬƌĞƐŝĚĞŶƚŝĂůƌĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚĨƌŽŵďĂƐĞLJĞĂƌ ;ůŝŶĞϯϮĂƐĞzĞĂƌĂƉƉůŝĐĂƚŝŽŶͿ ϰ͕ϲϯϬ͕ϱϵϵ͘ϬϬΨ ϯ WƌŽũĞĐƚĞĚZĞǀĞŶƵĞ^ŚŽƌƚĨĂůůĨƌŽŵ/ŶƚĞƌŝŵLJĞĂƌĂƉƉůŝĐĂƚŝŽŶ ;ůŝŶĞϮϬŵŝŶƵƐůŝŶĞϭϳŽŶϮϬϮϬ/ŶƚĞƌŝŵLJĞĂƌĂƉƉůŝĐĂƚŝŽŶͿ ϱϮϭ͕ϰϭϴ͘ϬϬΨ ϰ ŽŵŵĞƌĐŝĂůƌĞĐLJĐůŝŶŐƉĞƌĐĞŶƚĂŐĞŽĨƚŽƚĂů;ϲϰϳϯƚŽŶƐͿ ϱϳ͘ϯϱй ϱ ZĞƐŝĚĞŶƚŝĂůƌĞĐLJĐůŝŶŐƉĞƌĐĞŶƚĂŐĞŽĨƚŽƚĂů;ϰϴϭϯƚŽŶƐͿ ϰϮ͘ϲϱй ϲ ZĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚĨƌŽŵŽŵŵĞƌĐŝĂů;ůŝŶĞϰyůŝŶĞϯͿ Ϯϵϵ͕Ϭϯϯ͘ϮϮΨ ϳ ZĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚĨƌŽŵƌĞƐŝĚĞŶƚŝĂů;ůŝŶĞϱyůŝŶĞϯͿ ϮϮϮ͕ϯϴϰ͘ϳϴΨ ZĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚ ϴ EĞǁƉƌŽũĞĐƚĞĚĐŽŵŵĞƌĐŝĂůƌĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚ;ůŝŶĞ ϭнůŝŶĞϲͿ ϲ͕Ϯϯϱ͕ϮϯϮ͘ϮϮΨ ϵ EĞǁƉƌŽũĞĐƚĞĚĐŽŵŵĞƌĐŝĂůƌĞǀĞŶƵĞƌĞƋƵŝƌĞŵĞŶƚ ;ůŝŶĞϮнůŝŶĞϳͿ ϰ͕ϴϱϮ͕ϵϴϯ͘ϳϴΨ tĞŝŐŚƚĞĚŚĂŶŐĞŝŶƉĂƐƐƚŚƌŽƵŐŚ ϭϬ ŽŵŵĞƌĐŝĂůƉĞƌĐĞŶƚĂŐĞ ϱ͘Ϭϰй ϭϭ ZĞƐŝĚĞŶƚŝĂůƉĞƌĐĞŶƚĂŐĞ ϰ͘ϴϬй dŽƚĂůŚĂŶŐĞǁŝƚŚ&ƌĂŶĐŚŝƐĞĨĞĞ ϵϬй ϭϮ ŽŵŵĞƌĐŝĂůƉĞƌĐĞŶƚĂŐĞ ϱ͘ϲϬй ϭϯ ZĞƐŝĚĞŶƚŝĂůƉĞƌĐĞŶƚĂŐĞ ϱ͘ϯϰй ZĞǀĞŶƵĞĨƌŽŵƌĂƚĞŝŶĐƌĞĂƐĞ;ŝŶĐůƵĚŝŶŐϭϬйĨƌĂŶĐŚŝƐĞĨĞĞͿ ϭϰ ŽŵŵĞƌĐŝĂů ϯϯϮ͕Ϯϱϵ͘ϭϰΨ ϭϱ ZĞƐŝĚĞŶƚŝĂů Ϯϰϳ͕Ϭϵϰ͘ϮϬΨ ϭϲ dŽƚĂůƌĞǀĞŶƵĞĨƌŽŵƌĂƚĞŝŶĐƌĞĂƐĞ ϱϳϵ͕ϯϱϯ͘ϯϯΨ Packet Page 221 Item 15Attachment 2 Residential Rate Increase Requested 5.34% Rate Schedule Current Increased Adjustment New Rate Schedule Rate Rate (a) Rate Single Family Residential Mini-Can Service $10.51 5.34% $0.56 $11.07 Economy Service $16.76 5.34% $0.89 $17.65 Standard Service $33.53 5.34% $1.79 $35.32 Premium Service $50.29 5.34% $2.68 $52.97 Commercial Rate Increase Requested 5.60% Rate Schedule Current Increased Adjustment New Rate Schedule Rate Rate (a) Rate Commercial Customers 1 Yard Dumpster once a week $106.16 5.60% $5.94 $112.10 2 Yard Dumpster once a week $131.64 5.60% $7.37 $139.01 3 Yard Dumpster once a week $157.12 5.60% $8.79 $165.91 4 Yard Dumpster once a week $182.57 5.60% $10.22 $192.79 1 Yard Dumpster once a week Apt. $121.04 5.60% $6.77 $127.81 2 Yard Dumpster once a week Apt. $159.23 5.60% $8.91 $168.14 3 Yard Dumpster once a week Apt. $197.43 5.60% $11.05 $208.48 4 Yard Dumpster once a week Apt. $235.68 5.60% $13.19 $248.87 Packet Page 222 Item 15 =;<75.:;:.9=.;<260$.587:*:A26;7:"7447//7@;.:>2,.,*6,*44<1.7//2,./7:,=::.6<:*<.; !74A;<A:.6.#<A:7/7*5!4*;<2,2;67<,744.,<.-/7::.,A,4260*6-;17=4-+.<1:7?6*?*A*;<:*;1  6,.*?..382,3=87/76.0:..6?*;<.,76<*26.:0:..6*6-76.:.,A,4260,76<*26.:+4=.2;26,4=-.-26<1.;742-?*;<.;.:>2,./.. ".,A,4260*6-0:..6?*;<.,76<*26.:;;17=4-+.84*,.-6.*: 6.@<<7A7=:0*:+*0.,76<*26.:/7:,744.,<276/..<*8*:< *<...;*:.2587;.-/7::.;2-.6<2*4,=;<75.:;7>.: -*A;-.4269=.6<*6-,755.:,2*4,=;<75.:;7>.: -*A;-.4269=.6< $1./..2; 8.:576<17/<1.7=<;<*6-260,1*:0.?2<1*52625=5/..7/ 78:27:67<2,.2;:.9=2:.-*;<12;4*<./..8742,A2;;<*<.-*<<1.+7<<757/.>.:A+244 //.,<2>.-*<./7::*<.;26=::.6<"*<.,74=56?*; &7<,48:787;0/:,<036.:0,;03;  110.<3>0,<0 The Garbage Company4388 Old Santa Fe RoadSan Luis Obispo, CA 93401'"#('"("(#"#&!-#)((((-#" )' '$#8(4(-59+ # $) &"&&" &( "&'' 8( 4 &#$#' ( "&'59 $&#$#' - " )' & #!$"- 8(4&#!$"-59#&$&#$&('")'(#!&'&*"'# +'(/&- "/"&"+'('&*'+("((-2 &#$#'("&'+ #"'&-(" )' '$#(-#)" (((/(!/" #(#"'$ #+2#"''("(+((&%)&!"('# &#$#'(#">=C/('"#( '#$&#*'-#)+((# #+""#&!(#"1E (/!/" #( ) &"0E  #&(- &#('( &#)&'0E '#"#&( &#$#'("&'0"E ''#&( &#$#'("&'2B1<<$! ("(# *( #"&"2 ''"#&( '#"#+(#$&#*$) #!!"(2 )&')"((#(#"B#&( #( #&"#"'(()(#"/(# #+"$&'#"'!-')!(+&(("$&#('("'(( &#$#'("&'(#((- &#&( #'#( ) &"&&"#*2"#+"&8'9#$&#$&(-8$& 8'99&*"'# +'(/&- "/"&"+'('&*'+("((- !('2($&'#"8'9'""($&#('(/'"#+"&/'"#('#+"#"( '(%) .''''!"(&# '(#+"&#($& 8'9("($&#('(!)'(#"("#&#!$"-+&((" *" (( ') $&'#" '"" ( $&#('( ' ( #+"& # ( $& 8'9 &*"'&*'0#&(""(8'9+#'"!$$&'#"(&#!$"-3'&#&''()'(#!&#&#&#&(#&&'$#""$& &*"'# +'(/&- "/"&"+'('&*'+("((- !('8(""(7)'(#!&92* +&(("$&#('(!)'(#"("'((!"(((-#)$&#('(( &#$#'("&'/(&''#&''''#&3' &  )!&8 9#($& #&$& '+&*'# +'(/&- "/"&"+'('&*'/"'"()&-(&(#+"&#&((""(7)'(#!&#($& #&$& '2 "+&(("$&#('($&$& ' #)"(" ) ("!#&(-$&#('((#( &#$#'("&'')((#(&%)&!"('#(#"B#&( #( #&"#"'(()(#"2&(("$&#('('+ "#($(-7! #&-'! 2& $&#('('+ "#(#)"("(&!""(,'("#^ƚĂŶĚĂƌĚh^WŽƐƚĂŐĞW/^ĂŶƚĂĂƌďĂƌĂ͕WĞƌŵŝƚEŽ͘ϴϬϬPacket Page 223Item 15 !#&(-$&#('(2##)"(/$&#('(!)'(&*"+&("-((- &#&( #'#( ) &"&&"#*2&(("$&#('('&&"('# +'(&("&'!-! (#1* $&#('('&$&'"(-!#&(-##+"&'"6#&(""('7)'(#!&'#$& '&*"'# +'(/&- "/"&"+'('&*'+("((- !('/("((-+ "#()'(6"&'(&('#&('&*'2 &#$#'("&'8!#)"("(#""&'#A2?@$&"(#&'# +'('&*'/+" )'&/&- "/"&"+'('&*'9'"''&-#&(&#!$"-(##"(")(#$&#* '/ "*&#"!"( - '#)"/ " &   '#  +'(/&- "/ " &" +'( # (#"/(&"'$#&((#""'$#' #&$&#''"'&*'(#((."'#((-2'""((#&#"(&)("(#('"&'#'('/'(&'"#'(''#(+(($&#''"#&- "!(& /)(#(')'("( '("( # &- "!&(2(#" -/(&$&(-'# +'(&('()-'")("($&#$#'&("&'(#"')&(!#'()&("%)( '(&)(#"#&('2(#(  &#$#'("&'#A2?@$&"(''#"(# #+"#'("&''")&&-(&#!$"-1=2?2BD$&"(#( &#$#'("&''& ((#(#'((#$&#''&-  !(& '2>2=2BA$&"(#( &#$#'("&''& ((#(#'(#&('()-$&#&!-?$&(-#"') ("(2%!'%$" #!+!!&$ !$% &+"%!'%"%#"  %$(%$#&"!#     !) "!&+'#%'$$!&$&#$$&&() %! +! '&'!&$%!&'!&%"$%%!:2,.8.:576<1/7:;8.,2/2.-?*;<.?1..4.:,76<*26.:,744.,<.-76,..*,1?..3  6.0:..6?*;<.,76<*26.:0:..642-*6-76.:.,A,4260,76<*26.:+4=.42-;.:>2,.2;26,4=-.-*<67*--2<276*4,1*:0.  !!%$(    6. 0*4476?*;<.?1..4.:,76<*26.:          "!" +$&    6. 0*4476?*;<.?1..4.:,76<*26.:    %&!$$&    6.0*4476?*;<.?1..4.:,76<*26.:          #$ ' $&    6.0*4476?*;<.?1..4.:,76<*26.:         #$ ' #'%$&    6.0*4476?*;<.?1..4.:*<<1.8:.52=5:*<.84=;*6*--2<276*4,1*:0.7/    6. 0*4476?*;<.?1..4.:,76<*26.:       6.0*4476?*;<.?1..4.:,76<*26.:      6.0*4476?*;<.?1..4.:,76<*26.:       %! !'%$(/0<0:5360/-?.3<?;<,11   #"&       )"$     #$""$    !"%"$        "!&$ (!&$&'!'$!%        %$()+$" &%&$&'$   --2<276*48.:576<18.:,*67:,76<*26.:,1*:0.          '%""&"!67,1*:0.*44/7:-.<*24;*6-82,3=826/7:5*<276     & '#"&"!%)&$&$'#2760.,44:09=3:0/!.:<:28,1*:0.84=;,1*:0.;2-.6<2/2.-+.47?/7:*6A.@<:*,76<*26.:;7:.9=2>*4.6<>74=5.      --2<276*4,1*:0.8.: 0*4476,*67:.9=2>*4.6<>74=5.8.:,744.,<276    $%!&"&$$%$("$    #!$"!     #" " "#$"$"#$     '$ #    ($"") ""$   ($""'#$ ""$  *&$"&"!%)&#'#"$&&$'#2760.,44:09=3:0/!.:<:2884=;*8842,*+4.*57=6<+.47?     !.:0*:+*0.,*67:.9=2>*4.6<>74=5.  >.:,*6;+A9=7<*<276  !.::.,A,4260,*67:.9=2>*4.6<>74=5.  >.:,*6;+A9=7<*<276   !.:?12<.077-*:<2,4. *8842*6,.  6,.*576<1764A   !.:82.,.7//=:62<=:.     !.:5*<<:.;;7:+7@;8:260     Packet Page 224Item 15  #'#(  %"%" %#$#&# &'' "%&  #!!% %#$%',*"%&"""'&1(&'#!%&/  '"#('"("(#"#&!-#)((((-#" )' '$#8(4(-59+ # $) &" &&" &( "&'' 8( 4 &#$#' ( "&'59 $&#$#' - " )' & #!$"- 8( 4&#!$"-59#&$&#$&('")'(#!&'&*"'# +'(/&- "/"&"+'('&*' +("((-2 &#$#'("&'+ #"'&-(" )' '$#(-#)" (((/ (!/" #(#"'$ #+2#"''("(+((&%)&!"(' # &#$#'(#">=C/(' "#( '# $&#*'-#)+((# #+""#&!(#"1  D(/!/" #( ) &"0    D  #&(- &#('( &#)&'0    D '#"#&( &#$#'("&'0" D''#&( &#$#'("&'2        (  %"#%'%#$#&' "%&*'"'', !'&*  #"/  '/ #*!&=B/><>< !/A1<<$!  / ("(# *( #"&"2 ''"#&( '#"#+(#$&#*$)  #!!"(2  ''(  %".'',#(" * #"&% $( #!!"'"&($$#%'#""#$$#&'#"'# ' %#$#& ' "%& " *'% #% "#'  #%', %#'&' +&'& $(%&("' '# '  #%" #"&''('#"2&&% #*30 $$%#).'%#$#&' "%&*#( #!')#" !%5.64640      -  )&')"((#(#" A #&( #( #&"#"'(()(#"/(# #+"$&'#"'!-')!( +&(("$&#('("'(( &#$#'("&'(#((- &#&( #'#( ) &" &&"#*2  "#+"&8'9#$&#$&(-8$& 8'99&*"'# +'(/&- "/"&"+'('&*'+(" ((- !('2($&'#"8'9'""($&#('(/'"#+"&/'"#('#+"#"( '(%) . ''''!"(&# '(#+"&#($& 8'9("($&#('(!)'(#"("#&#!$"- +&((" *" (( ') $&'#" '"" ( $&#('( ' ( #+"&#($& 8'9&*" '&*'0 #& (""(8'9+#'"!$$&'#"(&#!$"-3'&#&''()'(#!&#&#&#& (#&&'$#""$& &*"'# +'(/&- "/"&"+'('&*'+("((- !('8(""(7)'(#!&92  * +&(("$&#('(!)'(#"("'((!"(((-#)$&#('(( &#$#'("&'/(&''#& ''''#&3' &  )!&8 9#($& #&$& '+&*'# +'(/&- "/"&"+'( '&*'/"'"()&-(&(#+"&#&((""(7)'(#!&#($& #&$& '2 "+&((" $&#('($&$& ' #)"(" ) ("!#&(-$&#('((#( &#$#'("&'')((# (&%)&!"('#(#"A#&( #( #&"#"'(()(#"2&(("$&#('('+ "#( $(-7! #&-'! 2& $&#('('+ "#(#)"("(&!""(,'("# !#&(-$&#('(2##)"(/$&#('(!)'(&*"+&("-((- &#&( #'#( ) &"&&"#*2 &(("$&#('('&&"('# +'(&("&'!-! (#1  ',#" (&&$# ''"/', % 994 !'%' " (&&$#.9784517689   * $&#('('&$&'"(-!#&(-##+"&'"6#&(""('7)'(#!&'#$& '&*"'#  +'(/&- "/"&"+'('&*'+("((- !('/("((-+ "#()'(6"&'( &('#&('&*'2  Packet Page 225 Item 15 &#"#%'%#$#&' "%&  &#$#'("&'8!#)"("(#""&'#@2A<$&"(#&'# +'('&*'/+ " )'&/&- "/"&"+'('&*'9'"''&-#&(&#!$"-(##"(")(# $&#* '/ "*&#"!"( - '#)"/ " &   '#  +'(/&- "/"&"+'(# (#"/ (&"'$#&((#""'$#' #&$&#''"'&*'(#((."'#((-2'""((#&#"(&)(" (#('"&'#'('/'(&'"#'(''#(+(($&#''"#&- "!(& /)(#( ')'("( '("( # &- "!&(2(#" -/(&$&(-'# +'(&('()-'" )("($&#$#'&("&'(#"')&)&("%)( '(&)(#"#&('2  &&#'%#$#&' "%& (#(  &#$#'("&'#@2A<$&"(''#"(# #+"#'("&''")&&-( &#!$"-1  =2?2CB$&"(#( &#$#'("&''& ((#(#'((#$&#''&-   !(& '2 >2=2B?$&"(#( &#$#'("&''& ((#(#'(#&('()-$&#&! -?&$&(-#"') ("(2  Commercial Rate Information       '!($# '#"&*' %'%($3761/-55:19=4:10 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1  %2>@>6<05.>42<8A?05.>42?612:@63621/28;C 3;>.:E2D@>.0;:@.6:2>?;>2=A6B.82:@B;8A92  %2>)>6<       116@6;:.805.>42<2>4.88;:0.:;> 2=A6B.82:@B;8A92<2>0;8820@6;:  *:6@     116@6;:.805.>42<2>4.88;:0.:;> 2=A6B.82:@B;8A92<2>0;8820@6;:  *:6@       116@6;:.805.>42<2>4.88;:0.:;> 2=A6B.82:@B;8A92<2>0;8820@6;:  *:6@       +'%# '#"&*'$($#%  ''%($3761/-55:19=4:10 %2>@>6<<8A?.<<860./82.9;A:@/28;C         %2>4.>/.420.:;>2=A6B.82:@B;8A92  $B2>0.:?/E=A;@.@6;:      %2>>20E086:40.:;>2=A6B.82:@B;8A92  $B2>0.:?/E=A;@.@6;:      %2>C56@24;;1.>@6082 .<<86.:02 $:02. 9;:@5;:8E        %2><6202;33A>:6@A>2        < %2>9.@@>2??;>/;D?<>6:4         286B2>E5.>42 %2>)>6<        ;992>06.89.6:@2:.:02322<2> 1A9<?@2> 0.: %2>)>6<             #!!% %"&&%) $%!#"' 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1  $:2.88;:.:        $:2.88;:.:      $:2.88;:.:       $:2.88;:.:      $:2.88;:.:       $:2.88;:.:        $:2.88;:.:       Packet Page 226 Item 15 )C;.88;:.:?      )C;.88;:.:?       )C;.88;:.:?      )C;.88;:.:?         )C;.88;:.:?        )C;.88;:.:?         )C;.88;:.:?         )5>22.88;:.:?        )5>22.88;:.:?       )5>22.88;:.:?        )5>22.88;:.:?        )5>22.88;:.:?        )5>22.88;:.:?         )5>22.88;:.:?            ;A>.88;:.:?       ;A>.88;:.:?       ;A>.88;:.:?       ;A>.88;:.:?          ;A>.88;:.:?        ;A>.88;:.:?          ;A>.88;:.:?             6B2.88;:.:?       6B2.88;:.:?       6B2.88;:.:?        6B2.88;:.:?         6B2.88;:.:?        6B2.88;:.:?        6B2.88;:.:?              (6D.88;:.:?       (6D.88;:.:?         (6D.88;:.:?         (6D.88;:.:?        (6D.88;:.:?        (6D.88;:.:?        (6D.88;:.:?       '.@2?3;>.88.88;:.:0A?@;92>?6:08A12>20E086:4<607A<;:02<2>C227 116@6;:.8?2>B6023>2=A2:062?/-6 .18:7>4010-< 72<31;1:>4/1:-<127:<31;81/4241051>1572;1:>4/1:19=4:10-.7>1       #!!% *&'* % #"'"%&%)$%!#"' 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1  $:2.88;:+.?@2+52282>      $:2.88;:+.?@2+52282>       $:2.88;:+.?@2+52282>        $:2.88;:+.?@2+52282>        $:2.88;:+.?@2+52282>        $:2.88;:+.?@2+52282>       $:2.88;:+.?@2+52282>             )C;.88;:+.?@2+52282>?      )C;.88;:+.?@2+52282>?        )C;.88;:+.?@2+52282>?        )C;.88;:+.?@2+52282>?        )C;.88;:+.?@2+52282>?        )C;.88;:+.?@2+52282>?      )C;.88;:+.?@2+52282>?           )5>22.88;:+.?@2+52282>?       Packet Page 227 Item 15 )5>22.88;:+.?@2+52282>?          )5>22.88;:+.?@2+52282>?        )5>22.88;:+.?@2+52282>?      )5>22.88;:+.?@2+52282>?       )5>22.88;:+.?@2+52282>?       )5>22.88;:+.?@2+52282>?             ;A>.88;:+.?@2+52282>?         ;A>.88;:+.?@2+52282>?        ;A>.88;:+.?@2+52282>?        ;A>.88;:+.?@2+52282>?         ;A>.88;:+.?@2+52282>?      ;A>.88;:+.?@2+52282>?       ;A>.88;:+.?@2+52282>?             6B2.88;:+.?@2+52282>?        6B2.88;:+.?@2+52282>?         6B2.88;:+.?@2+52282>?      6B2.88;:+.?@2+52282>?        6B2.88;:+.?@2+52282>?        6B2.88;:+.?@2+52282>?      6B2.88;:+.?@2+52282>?         (6D.88;:+.?@2+52282>?       (6D.88;:+.?@2+52282>?       (6D.88;:+.?@2+52282>?         (2B2:.88;:+.?@2+52282>?           645@.88;:+.?@2+52282>?        645@.88;:+.?@2+52282>?           '.@2?3;>.88.88;:.:0A?@;92>?6:08A12>20E086:4<607A<;:02<2>C227 116@6;:.8?2>B6023>2=A2:062?/-6 .18:7>4010-< 72<31;1:>4/1:-<127:<31;81/4241051>1572;1:>4/1:19=4:10-.7>1       !( '("'%&"' (!$&'% #"'"%&$%!#"' 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1   -1A9<?@2>         -1A9<?@2>         -1A9<?@2>          -1A9<?@2>        -1A9<?@2>       -1A9<?@2>        -1A9<?@2>            -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>       -1A9<?@2>       -1A9<?@2>       -1A9<?@2>            -1A9<?@2>        -1A9<?@2>         -1A9<?@2>       -1A9<?@2>      -1A9<?@2>        -1A9<?@2>       -1A9<?@2>      Packet Page 228 Item 15 -1A9<?@2>        -1A9<?@2>      -1A9<?@2>      -1A9<?@2>       -1A9<?@2>        -1A9<?@2>         -1A9<?@2>              -1A9<?@2>        -1A9<?@2>        -1A9<?@2>         -1A9<?@2>       -1A9<?@2>      -1A9<?@2>          -1A9<?@2>              -1A9<?@2>       -1A9<?@2>      -1A9<?@2>       -1A9<?@2>          -1A9<?@2>         -1A9<?@2>          -1A9<?@2>         #!!% (!$&'%#"'"% &%)6/=.4/@-:0; 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1   -1A9<?@2>        -1A9<?@2>          -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>            -1A9<?@2>          -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>         -1A9<?@2>           -1A9<?@2>        -1A9<?@2>         -1A9<?@2>         -1A9<?@2>       -1A9<?@2>       -1A9<?@2>      -1A9<?@2>            -1A9<?@2>         -1A9<?@2>         -1A9<?@2>        -1A9<?@2>      -1A9<?@2>      -1A9<?@2>        -1A9<?@2>             -1A9<?@2>        -1A9<?@2>       -1A9<?@2>       -1A9<?@2>      -1A9<?@2>      -1A9<?@2>     Packet Page 229 Item 15 < -1A9<?@2>           -1A9<?@2>         -1A9<?@2>       -1A9<?@2>       -1A9<?@2>       -1A9<?@2>       -1A9<?@2>           -1A9<?@2>               -1A9<?@2>        -1A9<?@2>       -1A9<?@2>       -1A9<?@2>      -1A9<?@2>          -1A9<?@2>        -1A9<?@2>        -1A9<?@2>           (A:1.E(2>B602           )52>.@2??5;C:./;B26:08A12@529;:@58E0;:@.6:2>>2:@.8322.:1.>2@52?.923;>/6:?.:14.>C;;1?C52: B;8A926?612:@60.8 6:?.:14.>C;;1?.>2@E<2?;30;:@.6:2>?      ("&( +'%# '#"&   #%#!!% (&'#!%&!( ' ("'    *-' %2>!63@      *-' %2>!63@     *-'( %2>!63@      *-'( %2>!63@     *-'( %2>!63@       #!!% #'%%& 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1  !$$('$' %2>-.>1     !$$(-'($!+() %2>-.>1     '%!"#)$()$' #( $#)#'(%2>&A;@2 '#)! %2>";:@5      )"%$''-'#)!' %2>.E       +)$$( %2>*:6@     ),!#') "! %2>".686:4     !$ ' '$#) %2>";:@5      !$ ' '' %2>";:@5     ()#-)" %2>"6:A@2     ())$#'-'$!! $$"%)$'(%' )$#%2>);:     ())$#'-'$!! $$"%)$'( *!')%2>;A>       '$#)!$$"%)$'(,#$'"! ')%2>*:6@ ,>.@2;39.@056:4?6F211A9<?@2>>.@2./;B2 ,)'$'!'#+() %2>*:6@     ,)'$'$'!'-! %2>*:6@     %, "&%)& %#%#!!" %, " # '#"##!!% (!$&'% #"'"%& 1;/:48<476:19=16/@=::16<%-<16/:1-;1 "1?%-<1 221/<4>1   -1A9<?@2>  #!*  #!*  -1A9<?@2>  #!*  #!* Packet Page 230 Item 15 <  -1A9<?@2>       -1A9<?@2>        -1A9<?@2>       -1A9<?@2>       -1A9<?@2>       -1A9<?@2>  #!*  #!*  -1A9<?@2>  #!*  #!*  -1A9<?@2>       -1A9<?@2>       -1A9<?@2>        -1A9<?@2>         -1A9<?@2>            -1A9<?@2>  #!*  #!* -1A9<?@2>  #!*  #!* -1A9<?@2>        -1A9<?@2>      -1A9<?@2>        -1A9<?@2>       -1A9<?@2>             -1A9<?@2>  #!*  #!* -1A9<?@2>  #!*  #!* -1A9<?@2>       -1A9<?@2>         -1A9<?@2>        -1A9<?@2>         -1A9<?@2>            -1A9<?@2>  #!*  #!* -1A9<?@2>  #!*  #!* -1A9<?@2>       -1A9<?@2>         -1A9<?@2>        -1A9<?@2>         -1A9<?@2>            -1A9<?@2>  #!*  #!* -1A9<?@2>  #!*  #!* -1A9<?@2>        -1A9<?@2>        -1A9<?@2>         -1A9<?@2>        -1A9<?@2>           -1A9<?@2>  #!*  #!* -1A9<?@2>  #!*  #!* -1A9<?@2>         -1A9<?@2>       -1A9<?@2>         -1A9<?@2>      -1A9<?@2>             )52>.@2??5;C:./;B26:08A12@529;:@58E0;:@.6:2>>2:@.8322.:1.>2@52?.923;>/6:?.:14.>C;;1?C52: B;8A926?612:@60.8 6:?.:14.>C;;1?.>2@E<2?;30;:@.6:2>?A?213;>>20E086:4 880;992>06.80A?@;92>?.>228646/823;>;:2?@.:1.>1C.?@2C52282>>20E086:4.@:;.116@6;:.805.>42  ;992>06.80A?@;92>?0.:05;;?23>;9.;>4.88;:/8A2C.?@2C52282>;:02<2>C2273;>0;996:4821 >20E086:4  +56@2;33602<.<2>0.:/20;996:4821C6@5@52;@52>>20E08./82?6:@52/8A2C.?@2C52282>  Packet Page 231 Item 15 %;8E?@E>2:2(@E>;3;.9%8.?@606?:;@0;8820@213;>>20E086:4.:1?5;A81/2@5>;C:.C.E.?@>.?5  !.@222?.>269<;?213;>0;992>06.80A?@;92>?;B2> 1.E?1286:=A2:@ )523226? <2>9;:@5;3@52 ;A@?@.:16:405.>42C6@5.96:69A9322;3 #;<>6;>:;@6026?>2=A6>21.?@56?8.@2322<;860E6??@.@21.@ @52/;@@;9;32B2>E/688       3320@6B21.@23;>>.@2?6:A>>2:@'.@20;8A9: C.?        '7<-58:787;10:-<146/:1-;1    221/<4>1 -<1        The Garbage Company 4388 Old Santa Fe Road San Luis Obispo, CA 93401 Packet Page 232 Item 15 Department Name: Community Development Cost Center:4003 For Agenda of: November 17, 2020 Placement:Public Hearing Estimated Time:45 minutes FROM: Michael Codron, Community Development Director Prepared By:Rachel Cohen, Associate Planner SUBJECT:REVIEW OF THE 6TH CYCLE HOUSING ELEMENT UPDATE AND A NEGATIVE DECLARATION OF ENVIRONMENTAL IMPACT RECOMMENDATION 1. As recommended by the Planning Commission, adopt a Resolution approving the Housing Element Update and a Negative Declaration of Environmental Impact (Attachment A). 2.Adopt a Resolution, entitled “A Resolution of the City Council of the City of San Luis Obispo, California, to Resolve that the City of San Luis Obispo Commits to being a Safe, Inclusive and Welcoming Community for Everyone and to Facilitate Voluntary Citizen Action to Redact or Repudiate Racist and Discriminatory Verbiage from Their Property Deeds” (Attachment G). REPORT-IN-BRIEF The Housing Element is a state required element of the General Plan that must be updated regularly as determined by State housing law. Updating the Housing Element is a key step in the City’s efforts to expand affordable housing opportunities and is required by California Government Code Sections 65580-65589.8. Once adopted, the Draft Housing Element will replace the current Housing Element adopted and certified by the State in 2015 and guide City housing actions through 2028. The update process is a tool to modify housing policies and programs to reflect the changing needs, resources, and conditions in the community, and to respond to changes in State and Federal housing law. Over the last year, the City of San Luis Obispo, as well as the County and other cities within the County have been in the process of updating their Housing Elements based on the new 6th Cycle Regional Housing Needs Allocation (RHNA) requirements administered by the State of California Department of Housing and Community Development (HCD). The Housing Element has been updated in response to input received through 12 presentations, meetings, online surveys, and a public workshop, as well as other correspondence over the past year. The City reached out to the community as well as specifically requested feedback from the following groups: x Transitions Mental Health Association x Home Builders Association x Housing Authority of San Luis Obispo (HASLO) x HEAL SLO –Healthy Community Working Group Packet Page 233 Item 16 x People's Self-Help Housing Corporation x SLO Chamber of Commerce x Local Realtors x Economic Vitality Corporation x Community Action Partnership of SLO (CAPSLO) x SLO Farm Bureau x Californian Rural Legal Assistance (CRLA) x The Coalition of Labor Agriculture and Business (COLAB) SLO x California Women for Agriculture (CWA) x United Way of San Luis Obispo County On July 22, 2020, the Planning Commission reviewed the Housing Element Update, proposed some modifications to Chapter 3, and ultimately recommended the City Council approve the Negative Declaration of Environmental Impact and adopt the proposed Housing Element update (Attachment B). On September 1, 2020, the City Council considered the Planning Commission recommendation, and provided the following direction: x Review and adjust Policy 7.9 and Programs 7.14 and 7.15. x Work with the City Attorney’s office to reword Policy 10.2. x Incorporate a program to update the historic resource inventory. x Consider adding programs to rezone for microbusinesses, reform CC&Rs (removing racist language and requirements) and support graywater systems as part of housing developments. Status of Housing Element Certification by the State of California Following the City Council’s review of the draft Housing Element on September 1, 2020, staff has continued to work with HCD to address Council’s direction as well as continued input from HCD. Once a jurisdiction has completed a draft update to its housing element, it is required to be submitted for review and certification by the State of California. The Housing Element is the only Element in the City’s General Plan that requires this review and certification process. HCD has been tasked to review Housing Elements for compliance with state law. On July 7, 2020, the City submitted a draft of the Housing Element Update to HCD for review. On August 6, 2020, City staff held a phone conference with staff from HCD to discuss its preliminary review of the Draft Housing Element Update and the revisions that needed to be made. On September 4, 2020, staff received a letter from HCD with the remaining items that needed to be modified for the Housing Element to be certified (Attachment D). Staff worked with HCD to address the items outlined in the letter, which are reflected in the redlined Housing Element Update (Attachment E, Revised Housing Element Update). The different colored redlines/revisions are not color coded and do not represent anything but a change to the original text that was presented to Council on September 1, 2020. Any yellow highlighted text are revisions that have been made since the Revised Housing Element Update was posted on the City’s website on October 28, 2020. Color coded revisions to the Goals, Packet Page 234 Item 16 Policies and Programs are provided in Attachment B. New programs that have been added to the Housing Element Update in response to HCD’s comments include the following: x Program 2.16: Create and make available to interested parties an informational packet that explains SB 35 streamlining provisions and eligibility within two years of Housing Element adoption. x Program 3.10: In order to mitigate the loss of affordable housing units, replacement housing units shall be provided for sites identified in the site inventory when any new development (residential, mixed-use or non-residential) occurs on a site that has been occupied by or restricted for the use of lower-income households at any time during the previous five years. This requirement applies to: non-vacant sites and vacant sites with previous residential uses that have been vacated or demolished (see Government Code, section 65583.2, subdivision (g)(3), and Government Code, section 65915, subdivision (c)(3)). x Program 4.7: The City shall support Affirmatively Further Fair Housing (AFFH) by: o Facilitating public education and outreach by providing informational flyers on fair housing and reasonable accommodation at public counters and on the City’s website. Information will be included with utility billing at least once per year. o Training staff, elected officials, and appointees on issues of disparity, structural racism, and inequality. o Implementing language standards and procedures for providing equal access to City services and programs to all residents, including persons with limited proficiency in English. o Deed-restricting units to provide affordability and reduce displacement. o Supporting new technologies and/or products such as modular housing construction to reduce costs and increase access to housing. o Distributing information regarding tenant rights and Fair Housing resources as part of Code Enforcement’s response to housing code enforcement issues. x Program 4.8: Continue to distribute information regarding Fair Housing by providing up to date information online and brochures at the front counter, providing educational materials to tenants, property owners and property managers, and making public service announcements (including but not limited to the City’s News page, social media sites, and newspaper ads) every year. x Program 5.5: Update the Zoning Regulations to allow mixed-use development within Service Commercial (C-S) and Manufacturing (M) zones without a use permit within one year of the adoption of the Housing Element. x Program 8.18: Review and amend the Zoning Regulations within one year of Housing Element adoption to ensure compliance with: 1) the Supportive Housing Streamlining Act (AB 2162) to allow supportive housing a use-by-right in zones where multi-family and mixed uses are permitted, including nonresidential zones permitting multifamily uses, if the proposed development meets specified criteria; and 2) AB 101, to allow Low Barrier Navigation Centers by-right in all residential zones, areas zoned for mixed-uses, and nonresidential zones permitting multifamily uses. x Program 8.23: Update Zoning Regulations, within two years of Housing Element Packet Page 235 Item 16 adoption, to be consistent with the Employee Housing Act; including: 1) an update of Table 2-1 to allow single-unit dwellings without a Conditional Use Permit within the Open Space and Conservation (C/OS) zone and employee housing consisting of no more than 36 beds in a group quarters, or 12 units or separate rooms or spaces designed for use by a single-family or household within the C/OS and AG zones, and 2) remove Chapter 17.148 - High-Occupancy Residential Use Regulations. Program 8.23 is necessary because the City allows agricultural uses within the Agricultural (AG) and Conservation and Open Space (C/OS) zones. Per State Law, employee housing (such as farmworker housing) must be allowed in these zones as well. Any project proposed would be required to comply with the City’s development standards and code requirements, including the ability of the project to be served by City services and be located within the urban reserve line (URL). HCD provided comments that the City has not successfully shown how affordable units will be developed on the sites identified in the inventory (see Attachment F, Appendix E). As such, the Housing Element must include programs that will incentivize, streamline, support, etc. the development of housing, especially affordable units. The following programs have been added to the Housing Element to address this requirement. One item to note is that in two of these programs it states, “allow [housing] developments…by right.” “By right,” under Government Code section 65583.2 (i)), means the City shall not require: a conditional use permit; a planned unit development permit; or other discretionary review or approval. x Program 2.17: In order to provide adequate sites for lower income households on non- vacant and vacant sites previously identified in the Housing Element (Table E-2), the City will, within one (1) year of the adoption of the Housing Element Update, allow developments (including mixed-use projects) that include at least 20 percent of the residential units as affordable to lower income households, by right (no discretionary review). x Program 2.18: Utilize objective design standards to allow residential uses by right (no discretionary review) for those developments (including mixed-use projects) that include at least 20 percent of the residential units as affordable to low income households. x Program 6.22:Update the City’s municipal code to expand objective design standards within one year of the adoption of the Housing Element Update. x Program 6.23: Update the development review process and expand the thresholds of each review level (minor, moderate, and major) to eliminate or reduce the number of public hearings required for housing projects within one year of adopting the Housing Element. The Goals, Policies and Programs of the Housing Element have been revised in response to input received from public outreach, HCD, Planning Commission, and City Council. A Redlined Matrix (Attachment B) provides a color coded, redlined version of the Goals, Policies and Programs and indicates who recommended the revision. Packet Page 236 Item 16 DISCUSSION Housing Element Update and Regional Housing Needs Allocation State law establishes a schedule for cities and counties to periodically update their Housing Elements of the General Plan. Under this schedule, the City’s Housing Element update is due in December 2020. As a part of this update, the City is required to develop programs designed to meet their share of the surrounding region’s housing needs for all income groups, as determined by the region’s council of governments. The Regional Housing Needs Allocation (RHNA) process ensures that each jurisdiction accepts responsibility, within its physical and financial capability to do so, for the housing needs of its residents and for those people who might reasonably be expected to move there. The City has been allotted a RHNA of 3,354 housing units to plan for in the new 6th Cycle Housing Element. Table 1: Regional Housing Needs Allocation (RHNA) for San Luis Obispo County, Jan. 2019 –Dec. 2028 Very Low Income 24.6%1 Low Income 15.5%1 Moderate Income 18.0%1 Above Moderate Income 41.9%1 Totals Percent City RHNA to Total RHNA Number of Units Arroyo Grande 170 107 124 291 692 6% Atascadero 207 131 151 354 843 8% Grover Beach 91 57 66 155 369 3% Morro Bay 97 60 70 164 391 4% Paso Robles 356 224 259 607 1,446 13% Pismo Beach 113 71 82 193 459 4% San Luis Obispo 825 520 603 1,406 3,354 31% Unincorporated County 801 505 585 1,365 3,256 30% Totals 2,660 1,675 1,940 4,535 10,810 100% Source: San Luis Obispo Council of Governments (SLOCOG), 2019 1Percent of total housing need in each jurisdiction. Residential Development Capacity As part of the Housing Element update process, jurisdictions must document their residential land capacity to show how their RHNA can be met. The City has completed this analysis and has approximately 387 acres of vacant, underutilized, or deteriorated property that can accommodate approximately 4,140 dwelling units (see Table 2). A substantial portion of the residential units identified in the inventory are located with the Avila Ranch planning area and San Luis Ranch Specific Plan and include residential units that are currently under review (in the “Pipeline”) for entitlement. The City has already issued building permits for 537 residential units within the 6th Cycle planning period. Additionally, 1,266 dwelling units have received entitlements, and 270 ADUs are projected to be developed in the City within the planning period. All these permitted and entitled units reduce the City’s remaining total RHNA to 1,818 units. Packet Page 237 Item 16 Table 2: Residential Capacity of San Luis Obispo Income Level (% of County Median Income) 6th Cycle RHNA Remaining RHNA Residential Capacity Specific Plan Capacity Total Residential Capacity Remaining RHNA Ext. Low & Very Low 825 778 497 803 1,300 0 Low 520 336 Moderate 603 576 403 400 803 0 Above Moderate 1,406 128 920 1,117 2,037 0 TOTAL UNITS 3,354 1,818 1,820 2,320 4,140 0 Source: City of San Luis Obispo, Community Development Department, 2019 The inventory above also shows capacity for 1,300 extremely low, very low, and low-income units, which satisfies and exceeds the remaining RHNA need of 1,114 units. Based on these numbers, the City’s residential capacity exceeds the 3,354 units needed for RHNA, and therefore, the Housing Element can be approved without including a property rezoning program. To receive support from HCD on the inventory outlined in the Housing Element Update (Attachment E, Appendix E), new programs were added to the Element that encourage low income housing projects through programs that will create “by-right” or non-discretionary housing project approval processes. Further discussion is provided under the HCD Section below. Previous Advisory Body and Council Review Kick-off of the 6th Cycle Housing Element update began in April 2019 with a Public Forum on Housing followed by a Study Session with the City Council. Below is a timeline of the advisory meetings that have occurred in regard to the Housing Element update: x City Council Meeting –September 1, 2020 x Planning Commission Meeting –July 22, 2020 x Planning Commission Meeting –June 10, 2020 x Human Relations Commission Meeting –June 3, 2020 x Planning Commission Meeting –April 24, 2019 x Public Forum and City Council Meeting –April 2, 2019 Comments and direction provided at these meetings, as well as through public engagement and the Housing Major City Goal, were important for informing proposed modifications to the Housing Element Update. Public Engagement In addition to discussing the Housing Element update at public meetings, the City facilitated several presentations, two online surveys, and a public workshop. Most recently, the City published the revised Housing Element Update on the City’s website for additional feedback from the community by notifying stakeholder groups, those on the interested parties list, posting on the City’s social media platforms, and posting a notice in the local New Times newspaper (in both Spanish and English). Packet Page 238 Item 16 x Association of Realtors Presentation –July 23, 2019 x Housing Element Workshop –December 10, 2020 x Online Survey –December 10, 2019 –January 10, 2020 x Chamber of Commerce (Economic Development Committee) Presentation –April 2, 2020 x Economic Vitality Corporation and the Home Builders Association Presentation –May 13, 2020 x Chamber of Commerce (Economic Development Committee) Presentation –June 4, 2020 x Online Survey –June 8, 2020 –June 24, 2020 x San Luis Obispo County Housing Summit (hosted by the Chamber of Commerce) Presentation –September 10, 2020 x Request for Additional Community Feedback - October 29, 2020 –November 17, 2020 (Council meeting) Goals, Policies and Programs –Chapter 3 The 6th Cycle Draft Housing Element and its appendices (Attachment D) include information such as updated demographic and residential capacity information, housing constraints and resources, and implementation. Chapter 3 of the Housing Element contains the Goals, Policies and Programs that provide direction and the plan for how the City will achieve the accommodation of 3,354 units within the City as required by HCD. The Goals, Policies and Programs of the Housing Element have been revised in response to input received from public outreach, HCD, Planning Commission, and City Council. A Redlined Matrix (Attachment B) provides a color coded, redlined version of the Goals, Policies and Programs and indicates who recommended the revision. City Council Direction On September 1, 2020, the City Council reviewed the Housing Element Update and provided the following direction to staff regarding Chapter 3: x Review and adjust Policy 7.9 and Programs 7.14 and 7.15. x Work with the City Attorney’s office to reword Policy 10.2. x Incorporate a program to update the historic resource inventory. x Consider adding programs to rezone for microbusinesses, reform CC&Rs (removing raciest language and requirements) and support graywater systems as part of housing developments. 1. Policy 7.9 and Programs 7.14 and 7.15 Policy 7.9 was added to the Chapter 3 as recommended by the Planning Commission to address public health and housing. Council supported the inclusion of the new policy but directed staff to review Program 7.14 and 7.15 and provide more clarity. Due to concerns about effective implementation, staff is not recommending inclusion of Program 7.14 but is suggesting modifications to Program 7.15 to address the intent of the Planning Commission recommendation. Packet Page 239 Item 16 Program 7.14 (not recommended for inclusion in the HE update): “Encourage new developments with 10 or more residential units be reviewed and scored by the Healthy Communities Work Group prior to submitting a planning application to the City.” The requirement to have a housing project be evaluated by an outside group poses several issues: 1) reduced predictability in the review process for developers and the public; 2) review timing and scoring is outside the control of the City and our development review process; 3) once a score is given to the project, the City does not have development standards or code requirements to interpret the score; and 4) this requirement could result in delaying the approval of housing projects (this could place the City in a situation that conflicts with state law). Based on these factors, staff is recommending that this program be removed. In order to address the Planning Commission’s intent, staff is recommending the following modifications to Program 7.15 (staff’s changes are shown in orange). Program 7.15: Evaluate and update the Community Design Guidelines to provide site design standards for Encourage developments with 110 or more residential units to include outdoor amenities such as the following: outdoor visiting and gathering spaces, places to exercise or recreate, and spaces reserved for edible landscape or community gardens. Chapter 5 of the Community Design Guidelines (CDG) already outlines design characteristics for residential projects. This would be the appropriate place to incorporate objective residential design standards for outdoor amenities because the CDG will be able to provide specific guidelines for how a project is to comply with the standards. Currently as a Housing Element program, implementation could be difficult since the program only encourages that residential projects include amenities as they wish. In addition, 10 units was changed to 11 units to be consistent with our existing definition of “Major Development Review” within the Zoning Regulations.1 2. Policy 10.2 Council directed staff to work with the City Attorney’s office to reword Policy 10.2. 1 Zoning Regulations Chapter 17.106.030(D): Major Development Review is a discretionary Planning Commission review process that includes public notice with a public hearing conducted as is required for all Planning Commission actions. 1) Multi-unit residential developments with more than 10 units; 2) New single-unit subdivisions with more than 10 units; 3) Nonresidential development with more than 10,000 gross square feet of new construction; 4) Significant additions and new construction of principal buildings in the C-D zone; 5) Any project for which an EIR is required. Packet Page 240 Item 16 Policy 10.2: Encourage, and where legally allowed, require new housing development to give preference in the following order: 1) individuals who are employed in business that are located in geographic areas that are customarily included in the City’s annual jobs-housing balance analysis, 2) individuals residing in the County, and 3) finally to individuals from outside the County. In reviewing the City’s Housing Element, HCD shared concerns with Policy 10.2 and Program 10.4. HCD stated in its letter that, “This policy [10.2] potentially erects barriers and prevents access to housing opportunities, particularly to individuals from outside of the City, and should be removed.” In light of this concern, as well as being mindful of fair housing rights, staff is recommending Goal 10 and its policies and programs be removed from the Housing Element to prevent any barriers to housing for any individual. Although this section is proposed for removal from the Housing Element, it does not mean that the City could not pursue other opportunities on a case by case basis, where legally allowed, to support housing for local individuals. 3. Update Historic Resource Inventory Council requested that a program be included in the Housing Element Update that outlines a timeframe for updating the Historic Resource Inventory. The Housing Element is part of a larger planning document, the General Plan. One of the other Elements in the General Plan is Conservation and Open Space. Section 3 of the Conservation and Open Space Element provides specific goals, policies and programs related to Cultural Heritage, such as Historic Resources. Policy 3.3.1. states, “Significant historic and architectural resources should be identified, preserved and rehabilitated.” The Conservation and Open Space Element is a more appropriate place to add a new program regarding a timeframe for updating the Historic Resource Inventory. Staff is recommending that if this is an important item for Council, to provide that direction to staff to consider as part of upcoming work plans for the Conservation and Open Space Element or the 2021-2023 Financial Plan. 4. Rezone for Microbusinesses The Council requested staff review opportunities to rezone residential zones to allow microbusinesses. Mixed-use projects are allowed in eight different zones (out of 16 zones) that allow for projects to combine both commercial spaces and residential units, or even live/work units. Land Use Element (LUE) Policy 2.3.6 states that “The City shall encourage mixed use projects, where appropriate and compatible with existing and planned development on the site and with adjacent and nearby properties. The City shall support the location of mixed-use projects and community and neighborhood commercial centers near major activity nodes and transportation corridors / transit opportunities where appropriate.” Additionally, the Neighborhood Commercial (C-N) zoning allows for businesses to be located within strategic areas near neighborhoods. Policy 3.3.1 of the LUE states in part that “The City shall provide for new or expanded areas of neighborhood commercial within, or extended into, nonresidential areas adjacent to residential neighborhoods.” Based on existing policies within the LUE, a new program for microbusinesses in or near residential neighborhoods would be better suited for the LUE rather than the Housing Element. Staff is recommending that if this is Packet Page 241 Item 16 an important item for Council, to provide direction to staff to consider as part of upcoming work plans for the LUE or 2021-2023 Financial Plan. 5. Reform CC&Rs As noted by Council, there are many CC&Rs still in existence within the City that include provisions that are discriminatory. Once a housing project is complete, management of the CC&Rs falls to the property owners and/or Homeowners Association (HOA). CC&Rs that are discriminatory are contrary to state and federal law and are therefore null and void. Currently, the County of San Luis Obispo offers a low-cost service to redact any illegal, restrictive covenants. Although these covenants are no longer enforceable, many property owners have taken the opportunity to remove the offending language from their property deeds. A copy of the required form is attached for reference (Attachment H). 6. Graywater Systems Council indicated that a graywater program could potentially be included as part of the Housing Element Update. Graywater systems are allowed in the City and depending on the amount of graywater released may mean a permit is required. The Utilities Department has provided an outline of the requirements on the City’s website (https://www.slocity.org/government/department-directory/utilities- department/conservation/graywater-systems). Graywater is regulated by the California Plumbing Code and Chapter 16 states that graywater must be used as it is created and cannot be stored on site for any purpose. There are three different classifications of graywater systems: 1) Clothes Washer System; 2) Simple System (less than 250 gallons/day); and 3) Complex System (more than 250 gallons/day). These three classifications vary in complexity and permitting requirements. The clothes washer system is the most common, and widely used system and uses wastewater from laundry to directly water a garden via a gravity fed line and does not require permitting of any type. Because this is an issue already addressed in the California Building Code, staff does not recommend referencing graywater systems in the Housing Element. 7. Restrictive Covenants A companion recommendation in this report is to adopt a resolution with the title, “A Resolution of the City Council of the City of San Luis Obispo, California, to Resolve that the City of San Luis Obispo Commits to being a Safe, Inclusive and Welcoming Community for Everyone and to Facilitate Voluntary Citizen Action to Redact or Repudiate Racist and Discriminatory Verbiage from Their Property Deeds.” (Attachment G) The City Council has expressed a commitment to making San Luis Obispo a welcoming, inclusive, and safe community for everyone, and to promoting free thought and speech, while condemning racism, hate speech, bigotry, violence, and prejudice. Adoption of the proposed resolution will commit the City to further this cause with respect to facilitating the removal of discriminatory language from property deeds in the City. Planning Commission Action On July 22, 2020, the Planning Commission unanimously recommended the City Council adopt a Packet Page 242 Item 16 resolution approving updates to the City’s Housing Element and Negative Declaration of Environmental Impact. The Planning Commission provided feedback at both the June 10th and July 22nd meetings regarding minor revisions to the goals, policies, and programs, including an additional policy and two new programs to address healthy communities (see discussion above and Attachment B). California Department of Housing and Community Development (HCD) Once a jurisdiction has completed a draft update to its housing element, it is required to be submitted for review and certification by the State of California. The Housing Element is the only Element in the General Plan that requires this review and certification process. The Department of Housing and Community Development (HCD) has been tasked to review Housing Elements for compliance with state law. HCD has 60 days to review the draft Housing Element and work with the City on any changes to the document. At the end of the 60 days, HCD issues a letter with their findings. The letter is usually a good indicator that HCD will certify the Housing Element, with their recommended modifications, once it is adopted by the City Council. Having a certified Housing Element allows the City to access state funds for future housing projects. On July 7, 2020, the City submitted a draft of the Housing Element Update to HCD for review. On August 6, 2020, City staff held a phone conference with staff from HCD to discuss their preliminary review of the Draft Housing Element Update and the revisions that needed to be made. On September 4, 2020, staff received a letter from HCD with the remaining items that needed to be modified in order for the Housing Element to be certified (Attachment D). Staff worked with HCD to address the items outlined in the letter and are reflected in the redlined Housing Element Update (Attachment E). The different colored redlines/revisions are not color coded and do not represent anything but a change to the original text that was presented to Council on September 1, 2020. Any yellow highlighted text are revisions that have been made since the Revised Housing Element Update was posted on the City’s website on October 29, 2020. Color coded revisions to the Goals, Policies and Programs are provided in Attachment B. New programs that have been added to the Housing Element Update in response to HCD’s comments and to comply with State Law. Below is the program number and the language of the new programs. Program 2.16: Create and make available to interested parties an informational packet that explains SB 35 streamlining provisions and eligibility within two years of Housing Element adoption. Program 3.10: In order to mitigate the loss of affordable housing units, replacement housing units shall be provided for sites identified in the site inventory when any new development (residential, mixed-use or non-residential) occurs on a site that has been occupied by or restricted for the use of lower- income households at any time during the previous five years. This requirement applies to: non-vacant sites and vacant sites with previous residential uses that have been vacated or demolished (see Government Code, section 65583.2, subdivision (g)(3), and Government Code, section 65915, subdivision (c)(3)). Packet Page 243 Item 16 Program 4.7: The City shall support Affirmatively Further Fair Housing by: x Facilitating public education and outreach by providing informational flyers on fair housing and reasonable accommodation at public counters and on the City’s website. Information will be included with utility billing at least once per year. x Training staff, elected officials, and appointees on issues of disparity, structural racism, and inequality. x Implementing language standards and procedures for providing equal access to City services and programs to all residents, including persons with limited proficiency in English. x Deed-restricting units to provide affordability and reduce displacement. x Supporting new technologies and/or products such as modular housing construction to reduce costs and increase access to housing. x Distributing information regarding tenant rights and Fair Housing resources as part of Code Enforcement’s response to housing code enforcement issues. Program 4.8: Continue to distribute information regarding Fair Housing by providing up to date information online and brochures at the front counter, providing educational materials to tenants, property owners and property managers, and making public service announcements (including but not limited to the City’s News page, social media sites, and newspaper ads) every year. Program 5.5: Update the Zoning Regulations to allow mixed-use development within Service Commercial (C-S) and Manufacturing (M) zones without a use permit within three years of the adoption of the Housing Element. Program 8.18: Review and amend the Zoning Regulations within one year of Housing Element adoption to ensure compliance with: 1) the Supportive Housing Streamlining Act (AB 2162) to allow supportive housing a use-by-right in zones where multi-family and mixed uses are permitted, including nonresidential zones permitting multifamily uses, if the proposed development meets specified criteria; and 2) AB 101, to allow Low Barrier Navigation Centers by-right in all residential zones, areas zoned for mixed-uses, and nonresidential zones permitting multifamily uses. Program 8.23: Update Zoning Regulations, within two years of Housing Element adoption, to be consistent with the Employee Housing Act; including: 1) an update of Table 2-1 to allow single-unit dwellings without a Conditional Use Permit within the Open Space and Conservation (C/OS) zone and employee housing consisting of no more than 36 beds in a group quarters, or 12 units or separate rooms or spaces designed for use by a single-family or household within the C/OS and AG zones, and 2) remove Chapter 17.148 - High-Occupancy Residential Use Regulations. To address conflicts of the Zoning Regulations and the Employee Housing Act, the City is Packet Page 244 Item 16 including new Program 8.23 in the Housing Element Update. Program 8.23 is necessary because the City allows agricultural uses within the Agricultural (AG) and Conservation and Open Space (C/OS) zones and per State Law, employee housing (i.e. farmworker housing) must be allowed in these zones as well. Any project proposed would be required to comply with the City’s development standards and code requirements, including the ability for the project to be served by City services and be located within the urban reserve line (URL). Programs that Further Support the Development of Housing HCD provided comments that the City has not successfully shown how affordable units will be developed on the sites identified in the inventory (see Attachment F, Appendix E). As such, HCD stated that the Housing Element must include programs that will incentivize, streamline, support, etc. the development of housing, especially affordable units. The following programs have been proposed to HCD and added to the Housing Element. They outline how the City will streamline the review of housing projects that meet certain criteria. One item to note is that in two of these programs it states, “allow [housing] developments…by right.” “By right,” under Government Code section 65583.2 (i)), means the City shall not require: a conditional use permit; a planned unit development permit; or other discretionary review or approval. It is important to note that this includes Architectural Review, which is the process that the City uses to apply its Community Design Guidelines to development projects. To ensure that the intent of the City’s design review process is honored, Program 6.22 directs staff to develop “objective design standards” into the Zoning Regulations. This process will ensure that the most important design criteria can still be applied to a housing project that is allowed “by right” or with no discretionary review. Program 2.17: In order to provide adequate sites for lower income households on non-vacant and vacant sites previously identified in the Housing Element (Table E-2), the City will, within one (1) year of the adoption of the Housing Element Update, allow developments (including mixed-use projects) that include at least 20 percent of the residential units as affordable to lower income households, by right (no discretionary review). Program 2.18: Utilize objective design standards to allow residential uses by right (no discretionary review) for those developments (including mixed-use projects) that include at least 20 percent of the residential units as affordable to low income households. Program 6.22:Update the City’s municipal code to expand objective design standards within one year of the adoption of the Housing Element Update. Program 6.23: Update the development review process and expand the thresholds of each review level (minor, moderate, and major) to eliminate or reduce the number of public hearings required for housing projects within one year of adopting the Housing Element. Staff is wrapping up informal discussions with HCD and further changes are anticipated per Packet Page 245 Item 16 those discussions. Staff has added a section to the draft Resolution (Attachment A) that requests authority be delegated to staff to allow for minor/administrative edits after the adoption of the Housing Element to achieve State certification. Policy Context The proposed amendments to the Housing Element are consistent with other land use goals and policies of the General Plan. CONCURRENCE Staff comments have been incorporated into the draft Housing Element. ENVIRONMENTAL REVIEW A Negative Declaration of Environmental Impact is recommended for the Housing Element Update (Attachment F). No potentially significant or significant impacts were identified. A Negative Declaration is therefore recommended for adoption in accordance with CEQA Guidelines section 15063(b)(2): “The lead agency shall prepare a negative declaration if there is no substantial evidence that the project or any of its aspects may cause a significant effect on the environment.” A 30-day public comment period was opened on July 9, 2020. A Notice of Intent to Adopt was filed with the County- Clerk Recorder and the State Clearing House. FISCAL IMPACT Budgeted: No Budget Year: 19-21 Funding Identified: No Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund N/A State Federal Fees Other: Total The Housing Element Update is a work program in the Housing Major City Goal adopted as part of the 2019-21 Financial Plan. The update was conducted entirely by City staff. Funding was provided as part of the Community Development Department budget for additional staff resources needed to cover normal workload while the project planner worked through the Housing Element update process. Adoption of the Housing Element Update prior to December 31, 2020 will ensure that the City has an effective Housing Element in place to start the new calendar year. If the City does not adopt its Housing Element Update before the end of the year then it will be Packet Page 246 Item 16 without a Housing Element until the update is certified by the State, which could take months. Going without a Housing Element is not recommended because, during this period of time, the City would not be eligible for grant applications through HCD or other State funding resources. Over the past several years, the City has received well over $1 million in grants from the State due to our certified Housing Element. There are currently a wide range of grants that the City will be applying for and maintaining an active, certified Housing Element is crucial to this effort. One of the fundamental aspects and takeaways from the update is that new housing programs when combined with existing housing programs and affordable housing monitoring is a significant resource commitment. Administration of the City’s new slate of housing programs will require the allocation of dedicated, full-time staff and thus the Community Development Department will likely need to evaluate resources available to support core essential housing programs as part of its 2021-23 Financial Plan work program. Recent housing law and HCD enforcement efforts indicate that the City will be well served to dedicate sufficient resources to Housing Element implementation to ensure success. ALTERNATIVES 1.Modify the Proposed 6th Cycle Housing Element.The Council may modify the proposed Housing Element. Specific direction should be given to staff regarding any modifications. 2.Continue the review of the 6th Cycle Housing Element.An action to continue the item should include direction to staff on pertinent issues. This alternative is not recommended as the Housing Element must be submitted to HCD by December 31, 2020. Jurisdictions on an 8-year planning period that do not adopt their element within 120 calendar days from the start date of the planning period must revise and adopt the housing element every four years until timely adopting at least two consecutive revisions by the applicable due date. Additionally, late adoption could impact the City’s eligibility to receive State funding for housing projects. Attachments: a - Draft Resolution b - Chapter 3 Redline Matrix c - Planning Commission Resolution No. PC-1017-2020 d - Letter from the Dept. of Housing and Community Development e - COUNCIL READING FILE - Revised Draft Housing Element f - COUNCIL READING FILE - Initial Study g - Resolution to support redaction of rascist language from property deeds. h - Restrictive Covenant Removal Form Packet Page 247 Item 16 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, APPROVING AND ADOPTING A NEGATIVE DECLARATION OF ENVIRONMENTAL IMPACT AND AMENDMENTS TO THE HOUSING ELEMENT OF THE GENERAL PLAN AS REPRESENTED IN THE COUNCIL AGENDA REPORT AND ATTACHMENTS DATED NOVEMBER 17, 2020 (GENP-0217-2020 & EID- 0218-2020) WHEREAS,State law requires cities and counties to adopt a general plan. The General Plan includes nine required elements, one of which is the Housing Element. The Housing Element must be updated every eight (8) years or as otherwise provided by State law; and WHEREAS,the Planning Commission of the City of San Luis Obispo conducted a web based public hearing, on July 22, 2020, and recommended approval of a Negative Declaration of Environmental Impact and amendments to the Housing Element to address the changing needs, resources, and conditions in the Community, as required by State law; and WHEREAS,the City Council of the City of San Luis Obispo conducted a web based public hearing, on September 1, 2020, and considered the Planning Commission’s recommendation, authorized staff to continue to work with HCD to ensure that the Housing Element fully complies with its guidelines, provided direction to staff regarding modifications to the Housing Element, and directed staff to return to City Council for final approval of the Housing Element; and WHEREAS,the City Council of the City of San Luis Obispo conducted a web based public hearing, on November 17, 2020, for the purpose of considering the Negative Declaration of Environmental Impact and amendments to the Housing Element; and WHEREAS, the City facilitated 12 presentations, meetings, online surveys, and a public workshop to identify housing needs, issues and opportunities in the community and inform policy and program changes; and WHEREAS, notices of said public hearing were made at the time and in the manner required by law; and WHEREAS, the City Council has duly considered all evidence, including the testimony of the applicant, interested parties, and the evaluation and recommendations by staff, presented at said hearing. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo as follows: Packet Page 248 Item 16 Resolution No. ______ (2020 Series) Page 2 R _____ SECTION 1.Findings. This Council, after considering the 6 th Cycle Housing Element update, the Planning Commission’s recommendations, staff recommendations, public testimony and correspondence, and reports thereon, makes the following findings: 1. The proposed amendments included in the draft Housing Element are consistent with other land use goals and policies of the General Plan. 2. The proposed amendments are appropriate and necessary to ensure that the City’s Housing Element meets State law and the changing needs, resources, and conditions in the community. 3. The City facilitated 12 presentations, meetings, online surveys, and a public workshop to identify housing needs, issues and opportunities in the community and inform policy and program changes. 4. The City has evaluated its ability to accommodate its Regional Housing Need Allocation (RHNA) number of 3,354 dwellings by December 2028 and determined there is sufficient land suitable for residential development to accommodate the RHNA number within the planning period. 5. Achieving Housing Element State certification will promote affordable housing opportunities and help achieve adopted housing goals by making the City eligible for various housing grants and financial incentives, and will foster cooperation among local and state agencies in addressing an urgent need for affordable housing in the City. SECTION 2:Environmental Review. The City Council does hereby adopt a Negative Declaration of Environmental Impact in accordance with CEQA Guidelines section 15063(b)(2): “The lead agency shall prepare a negative declaration if there is no substantial evidence that the project or any of its aspects may cause a significant effect on the environment.” SECTION 3.Action. The City Council does hereby adopt the proposed amendments to the Housing Element, which is incorporated herein by reference,and directs staff to complete any minor, administrative changes to the Housing Element that are required by the State of California Department of Housing and Community Development (HCD) for certification. Should HCD require substantial changes to the Housing Element adopted herein, staff shall bring such changes back to Council for review and adoption. SECTION 4.Effective Date. The 6th Cycle Housing Element shall become effective immediately upon adoption of this resolution. Packet Page 249 Item 16 Resolution No. ______ (2020 Series) Page 3 R _____ SECTION 5.Repeal of Previous Element. The Housing Element adopted January 20, 2015, is repealed upon the effective date of the 6th Cycle Housing Element. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of ____________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on ____________________________. ____________________________________ Teresa Purrington City Clerk Packet Page 250 Item 16 GENP-0217-2020 & EID-0218-2020 Attachment B: Housing Element Goals, Policies, and Programs Redlined Matrix The matrix below provides a legislative draft of Housing Element Chapter 3: goals, polices, and programs. A brief description is provided explaining why the proposed modification or addition or removal better achieves housing goals or state requirements. x Initial modifications made to existing Goals, Policies and Programs are shown in red. x Modifications based on Planning Commission direction and public comment are shown in blue. x Modifications made based on direction provided by the State of California Housing and Community Department (HCD) are shown in green. x Modifications made based on City Council direction are shown in purple. x Changes highlighted in yellow are based on direction provided by HCD after the revised public draft was posted online. x Policies are highlighted in gray. #New #Goals Policy/Program Reason for Modification Goal 1 - Safety: Provide safe, decent shelter for all residents. 1.1 1.1 Safety Assist those citizens unable to obtain safe shelter on their own. 1.2 1.2 Safety Support and inform the public about fair housing laws and programs that allow equal housing access for all city residents. 1.3 1.3 Safety Maintain a level of housing code enforcement sufficient to correct unsafe, unsanitary or illegal conditions and to preserve the inventory of safe housing, consistent with City Council’s code enforcement priorities. Updated to be consistent with current code enforcement priorities. 1.4 Safety Assist owners of older residences with information on ways to repair and upgrade older structures to meet higher levels of building safety, efficiency, and sustainability. Per Planning Commission (PC) comments on June 10, 2020, staff is recommending a new policy that supports improvements to older residential structures. 1.4 1.5 Safety Continue to improve Correct unsafe, unsanitary or illegal housing conditions, improve barrier to accessibility,andenergy efficiency, or and improve unsafe neighborhoods annually by Rehabilitate 1) using Federal, State and local housing funds, such as Community Development Block Grant Funds and 2) proactively promoting neighborhood wellness through Code Enforcement’s Neighborhood Service Program., with the objectives of 30 single-family, 75 multi- family, 10 historic, and 20 mobile homes for extremely low, very low, low and moderate income homeowners and renters during the planning period.Code Enforcement staff shall Added language from Program 3.9. The RHNA provides the objectives for the 6th Cycle Housing Element. Packet Page 251 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification continue to provide property owners and tenants with information on how to rectify violations, who to contact in Code Enforcement for assistance, and other resources that may be pertinent to the citation. 1.5 1.6 Safety Continue code enforcement to expedite the removal of illegal or unsafe dwellings, to eliminate hazardous site or property conditions, and resolve chronic building safety problems. 1.6 -----Safety Consider a Rental Inspection Program to improve the condition of the City’s Housing Stock. In May 2015 the City Council adopted the Rental Housing Inspection Ordinance. In March 2017 the City Council voted to repeal the ordinance. 1.7 1.7 Safety Continue to support local and regional solutions to homelessness by funding supportive programs services, and housing solutions. such as the Maxine Lewis Memorial Shelter and The Prado Day Center. Maxine Lewis Memorial Shelter and the Prado Day Center are now housed within the 40 Prado Homeless Service Center. 1.8 -----Safety Create an educational campaign for owners of older residences informing them of ways to reduce the seismic hazards commonly found in such structures and encouraging them to undertake seismic upgrades. Unreinforced masonry buildings have been retrofitted to meet current building code requirements. Proactive education is complete because no additional structures need seismic retrofits. Although complete, staff will continue to have information available regarding seismic hazards for those community members interested in further education. Goal 2 -Affordability: Accommodate affordable housing production that helps meet the City’s quantified objectives. 2.1 2.1 Affordability Income Levels For Affordable Housing households. For purposes of this Housing Element, affordable housing is that which is obtainable by a household with a particular income level, as further described in the City’s Affordable Housing Standards. Housing affordable to Extremely Low, Very Low, Low, and Moderate income persons or households shall be considered “deed-restricted affordable housing.” Income levels are defined as follows: ❑Extremely low 30% or less of County Area median household income ❑Very low: 31 to 50% of County Area median household income. ❑Low: 51% to 80% of County Area median household income. Packet Page 252 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification ❑Moderate: 81% to 120% of County Area median household income. ❑Above moderate: 121% or more of County Area median household income. 2.2 2.2 Affordability Index of Affordability. The Index of Affordability shall be based on the City’s Affordable Housing Standards, updated annually per the County of San Luis Obispo’s Area Median Income determined by California Department of Housing and Community Development. whether the monthly cost of housing fits within the following limits: For extremely low income households, not more than 25% of monthly income. For very low-and low-income households, not more than 25% of monthly income. For moderate income households, not more than 30% of monthly income. For above-moderate income households, no index. These indices may be modified or expanded if the State of California modifies or expands its definition of affordability for these income groups. Updated the policy to have the ability to remain consistent with standardized County data. 2.3 2.3 Affordability For housing to qualify as “deed-restricted affordable” under the provisions of this Element, guarantees must be presented that ownership or rental housing units will remain affordable for the longest period allowed by State law, or for a shorter period under an equity-sharing or housing rehabilitation agreement with the City. The Equity Share Program has a 45- year deed restriction if an owner does not choose to exercise the equity share option. 2.4 2.4 Affordability Encourage housing production for all financial strata of the City's population, as allocated in the proportions shown in the Regional Housing Needs Allocation, for the 2014 –2019 6th cycle planning period. The number of units per income category are These proportions are: extremely low and income /,12 percent,very low income, 12 percent 825 units; low income, 16 percent 520 units; moderate income, 18 percent 604 units; and above moderate income, 42 percent 1,405 units. Updated with the new RHNA under the 6th Cycle Housing Element. 2.5 2.5 Affordability Continue to manage the Affordable Housing Fund so that the fund serves as a sustainable resource for supporting, at a minimum, 4 new affordable housing development during the planning period. The fund shall serve as a source of both grant funding and below market financing for affordable housing projects; and funds shall be used to support a wide variety of housing types at the following income levels: extremely low, very low, low, and moderate, but with a focus on production efficiency to maximize housing Packet Page 253 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification benefits for the City’s financial investment, and to support high quality housing projects that would not be feasible without Affordable Housing Fund support. 2.6 2.6 Affordability Continue to Review existing and proposed building, planning, engineering and fire policies and standards every year as housing developments are reviewed to determine whether changes are possible that could assist the production of affordable housing, or that would encourage preservation of housing rather than conversion to non-residential uses, provided such changes would not conflict with other General Plan policies. Such periodic reviews will seek to remove regulations on an annual basis within 2-6 months that have been superseded, are redundant or are no longer needed. 2.7 2.7 Affordability Continue to prioritize implement existing procedures that speed up the processing of applications, construction permits, and water and sewer service priorities for affordable housing projects. City staff and commissions shall give such projects priority in allocating work assignments, scheduling, conferences and hearings. and in preparing and issuing reports and water and sewer service allocations. Updated language to be consistent with City policies and processes. 2.8 -----Affordability Continue to pursue outside funding sources for the payment of City impact fees so that new dwellings that meet the City’s affordable housing standards can mitigate their facility and service impacts without adversely affecting housing affordability. Reductions have been built into the new fee structure that was approved as a part of AB 1600 in 2018. 2.9 -----Affordability To the extent outside funding sources can be identified to offset impacts on City funds, exempt dwellings that meet the moderate income, Affordable Housing Standards from planning, building and engineering development review and permit fees, including water meter installation fee. Maintain exemptions for extremely-low, very-low and low-income households. Reductions have been built into the new fee structure that was approved as a part of AB 1600 in 2018. 2.10 2.8 Affordability Continue to Coordinate an annual public and private sector actions meeting to discuss and encourage the development of housing that meets the City’s housing needs. 2.11 2.9 Affordability Continue to Assist with the issuance of tax- exempt bonds, tax credit financing, loan underwriting or other financial tools to help develop or preserve at least 20 affordable units annually through various programs. including, but not limited to: (1) below market financing through the SLO County Housing Trust Fund and Eliminating the examples allows for more opportunities and flexibility to fund affordable housing opportunities. Packet Page 254 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification (2) subsidized mortgages for extremely low, very-low, low-and moderate income persons and first-time home buyers, and (3) self-help or “sweat equity”homeowner housing. 2.12 2.10 Affordability Consider updating Update the Affordable Housing Standards to include incorporating Homeowners’Association (HOA)fees and a standard allowance for utilities in the calculation for affordable rents and home sales prices within two years of adopting the Housing Element. Added language based on findings and recommendations from the 2020 Affordable Housing Nexus Study. 2.13 2.11 Affordability In conjunction with the Housing Authority and other local housing agencies, continue to provide on-going technical assistance and education to tenants, property owners and the community at large on the need to preserve at-risk units as well as the available tools to help them do so. 2.14 2.12 Affordability In conjunction with local housing providers and the local residential design community, continue to Continue to provide technical assistance planning services as requested by the public, builders, design professionals and developers regarding design strategies to achieve affordable housing and density bonuses. Updated language to be consistent with City policies and processes. 2.15 2.13 Affordability Update the Inclusionary Housing Ordinance, including Table 2A, based on findings and recommendations in the 2020 Affordable Housing Nexus Study and conduct further feasibility analysis in order to Eevaluate the Inclusionary Housing Ordinance requirements and the effect of Table 2A on the City’s ability to provide affordable housing in the proportions shown in the Regional Housing Needs Allocation, per Policy 2.4. Added language based on findings and recommendations from the 2020 Affordable Housing Nexus Study. 2.16 -----Affordability The City will evaluate and consider including a workforce level of affordability in its Affordable Housing Standards to increase housing options in the City for those making between 121 percent and 160 percent of the San Luis Obispo County median income. This affordability category cannot be used to meet inclusionary housing ordinance requirements and is not eligible for City Affordable Housing Funds. Creating a workforce level of affordability was examined and found that it could not be successfully implemented on a citywide basis as there are no existing State standards for such an income level. 2.17 2.14 Affordability Continue to consider support increasing density bonuses for residential projects densities above the state density bonus allowance of 35%for projects that provide housing for to promote the development of units for extremely low, very low and extremely low income households. Reordered wording. Packet Page 255 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 2.15 Affordability Evaluate a flexible density pilot program and initiate an update of the Zoning Regulations and Community Design Guidelines to incorporate flexible density development options in Downtown Core and portions of Upper Monterey and Mid-Higuera Special Focus Areas to support the production of 50 smaller residential units (150 to 600 square feet)per year during the planning period. This program was recommended in part by input from the community and the work program associated with the Housing Major City Goal. The community and Council identified that the Downtown and portions of Upper Monterey and Mid-Higuera Special Focus Areas could be appropriate for higher density housing development. 2.16 Affordability Create and make available to interested parties an informational packet that explains SB 35 streamlining provisions and eligibility within two years of Housing Element adoption. The City is subject to SB 35 streamlining. This packet would provide information for developers, the public,and staff on what projects quantify for the process and the steps that must be taken to submit a project under SB 35 streamlining provisions. 2.17 Affordability In order to provide adequate sites for lower income households on non-vacant and vacant sites previously identified in the Housing Element (Table E-2), the City will, within one (1) year of the adoption of the Housing Element Update, allow developments (including mixed- use projects) that include at least 20 percent of the residential units as affordable to lower income households, by right (no discretionary review). Per Gov. Code Section 65583.2, subsection (c), sites that have been listed in previous Housing Element are subject to a Housing Element program that allows housing development by right (no discretionary review) when 20% of the units are affordable to low income households. 2.18 Affordability In order to provide adequate sites for lower income households on non-vacant and vacant sites previously identified in the Housing Element (Table E-2), the City will, within one (1) year of the adoption of the Housing Element Update, allow developments (including mixed- use projects) that include at least 20 percent of the residential units as affordable to lower income households, by right (no discretionary review). This program is an opportunity for the City to incentivize the development of affordable housing for low income households in other areas or specific sites within the City that are not listed within the Housing Element inventory (Appendix E). Goal 3 -Housing Conservation: Conserve existing housing and prevent the loss of safe housing and the displacement of current occupants. 3.1 3.1 Housing Conservation Continue to encourage the rehabilitation, remodeling or relocation of sound or rehabitable housing rather than demolition. Demolition of non-historic housing may be permitted where conservation of existing housing would preclude the achievement of other housing objectives or adopted City goals. 3.2 3.2 Housing Conservation Discourage the removal or replacement of housing affordable to extremely low, very-low, low-and moderate income households, and avoid permit approvals, private development, municipal actions or public projects that remove or adversely impact such housing unless such actions are necessary to achieve General Plan objectives and: (1) it can be demonstrated that Packet Page 256 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification rehabilitation of lower-cost units at risk of replacement is financially or physically infeasible, or (2) an equivalent number of new units comparable or better in affordability and amenities to those being replaced is provided, or (3) the project will correct substandard, blighted or unsafe housing; and (4) removal or replacement will not adversely affect housing which is already designated, or is determined to qualify for designation as a historic resource. 3.3 -----Housing Conservation Encourage seismic upgrades of older dwellings to reduce the risk of bodily harm and the loss of housing in an earthquake. All multi-family structures have been retrofitted and single-family residences are exempt from seismic retrofits. Additionally, any upgrades to older residential structures is now covered in the proposed new Policy 1.4. 3.4 3.3 Housing Conservation Encourage the construction, preservation, rehabilitation or expansion of residential hotels, group homes, integrated community apartments, and single-room occupancy dwellings. 3.5 3.4 Housing Conservation Preserve historic homes and other types of historic residential buildings, historic districts and unique or landmark neighborhood features. 3.6 -----Housing Conservation Preserve the fabric, amenities, yards (i.e. setbacks), and overall character and quality of life of established neighborhoods. Moved to Goal 7: Neighborhood Quality & Design and is now Policy 7.9. 3.7 3.5 Housing Conservation Encourage and support creative strategies for the rehabilitation and adaptation and reuse of residential, commercial, and industrial structures for housing. 3.8 -----Housing Conservation Adopt an ordinance that implements policy 3.2 to discourage removal or replacement of affordable housing. Affordable housing units are protected by the State of California Housing Accountability Act,SB 330 (see Policy 3.2), and the “no net loss” requirements of SB 166.An ordinance is no longer required. 3.9 -----Housing Conservation Correct unsafe, unsanitary or illegal housing conditions, improve accessibility and energy efficiency and improve neighborhoods by collaborating with agencies offering rehabilitation programs. City will use State or Federal grants or other housing funds to implement the program and provide services such as home weatherization, repair and universal access improvements. Consolidated this program by adding the first sentence to Policy 1.4 which provides a broader context to support all housing including the preservation of existing housing. Packet Page 257 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 3.10 3.6 Housing Conservation Continue to encourage the creation of dwellings in the Downtown Core (C-D Zone) and the Downtown Planning Area by continuing the "no net housing loss" program, consistent with Chapter 17.86 17.142 (Downtown Housing Conversion Regulations) of the Zoning Regulations. Updated to be consistent with Zoning Regulations update. 3.11 3.7 Housing Conservation Continue to identify residential properties and districts eligible for local, State or Federal historic listing in accordance with guidelines and standards to help property owners repair, rehabilitate and improve properties in a historically and architecturally sensitive manner. 3.12 3.8 Housing Conservation Continue to monitor and track affordable housing units at-risk of being converted to market rate housing annually and verify that tenants are properly notices and aware of their rights. Provide resources to support the Housing Authority, and local housing agencies, purchase and manage at-risk units. 3.13 3.9 Housing Conservation Work annually with non-profit organizations, faith-based organizations, or the Housing Authority of the City of San Luis Obispo, the City will to encourage rehabilitation of residential, commercial or industrial buildings to expand extremely low, very-low, low or moderate income rental housing opportunities. 3.10 Housing Conservation In order to mitigate the loss of affordable housing units, replacement housing units shall be provided for sites identified in the site inventory when any new development (residential, mixed- use or non-residential) occurs on a site that has been occupied by or restricted for the use of lower-income households at any time during the previous five years. This requirement applies to: non-vacant sites and vacant sites with previous residential uses that have been vacated or demolished (see Government Code, section 65583.2, subdivision (g)(3), and Government Code, section 65915, subdivision (c)(3)). This is a newrequirement of state law. Goal 4-Mixed-Income Housing. Preserve and accommodate existing and new mixed income neighborhoods and seek to prevent neighborhoods or housing types that are segregated by economic status. 4.1 4.1 Mixed-Income Housing Within newly developed neighborhoods, housing that is affordable to various economic strata should be intermixed rather than segregated into separate enclaves. The mix should be comparable to the relative percentages of extremely low, very-low, low, moderate and above-moderate income households in the City’s quantified objectives. Packet Page 258 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 4.2 4.2 Mixed-Income Housing Include both market-rate and affordable units in apartment and residential condominium projects and intermix the types of units. Affordable units should be comparable in size, appearance, and basic quality to market-rate units. 4.3 4.3 Mixed-Income Housing Extremely-low and very low-income housing, such as that developed by the Housing Authority of the City of San Luis Obispo or other housing providers, may be located in any zone that allows housing, and should be dispersed throughout the City rather than concentrated in one neighborhood or zone. 4.4 4.4 Mixed-Income Housing In its discretionary actions, housing programs and activities, the City shall affirmatively further fair housing and promote equal housing opportunities for persons of all economic segments of the community. 4.5 4.5 Mixed-Income Housing Review new development proposals for compliance with City regulations and revise projects or establish conditions of approval as needed to implement the mixed-income policies. 4.6 4.6 Mixed-Income Housing Consider aAmending the City’s Inclusionary Housing Ordinance and Affordable Housing Incentives to require that affordable units in a development be of similar size,number of bedrooms, character and basic quality as the nonrestricted units in locations that avoid segregation of such units including equivalent ways to satisfy the requirement.Also evaluate adjusting the City’s allowable sales prices for deed-restricted affordable units per a variety of unit types. Added language based on findings and recommendations from the 2020 Affordable Housing Nexus Study. 4.7 Mixed-Income Housing The City shall support Affirmatively Further Fair Housing (AFFH) by: •Facilitating public education and outreach by providing informational flyers on fair housing and reasonable accommodation at public counters and on the City’s website. Information will be included with utility billing at least once per year. •Training staff, elected officials, and appointees on issues of disparity, structural racism, and inequality. •Implementing language standards and procedures for providing equal access to City services and programs to all residents, including persons with limited proficiency in English. •Deed-restricting units to provide affordability and reduce displacement. New requirement per state law. Packet Page 259 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification •Supporting new technologies and/or products such as modular housing construction to reduce costs and increase access to housing. •Distributing information regarding tenant rights and Fair Housing resources as part of Code Enforcement’s response to housing code enforcement issues. 4.8 Mixed-Income Housing Continue to distribute information regarding Fair Housing by providing up to date information online and brochures at the front counter, providing educational materials to tenants, property owners and property managers, and making public service announcements (including but not limited to the City’s News page, social media sites, and newspaper ads) every year. The Housing Element needs to show how the City supports Fair Housing. Goal 5 - Housing Variety and Tenure. Provide variety in the location,type, size, tenure,and style of dwellings. 5.1 -----Housing Variety Encourage the integration of appropriately scaled, special needs housing into developments or neighborhoods of conventional housing. AB 101 allows this type of housing in all zones and there is limited ability control scale and design. 5.2 5.1 Housing Variety Encourage mixed-use residential/commercial projects in all commercial zones, especially those close to activity centers where compatible with existing and planned surrounding development. to include live-work and work-live units where housing and offices or other commercial uses are compatible. Combined with Policy 5.3 to form one policy that encourages mixed-use development, consistent with the Zoning Regulations update which no longer identifies live/work or work/live units separately from mixed-use. 5.3 -----Housing Variety Encourage the development of housing above ground-level retail stores and offices to provide housing opportunities close to activity centers and to use land efficiently. See above. 5.4 5.2 Housing Variety New planned In general,housing developments of twenty (20) or more units should provide a variety of dwelling types, sizes and styles or forms of tenure. 5.3 Housing Variety Encourage the development of a variety of “missing middle” housing types. This new policy is based on community feedback and the work program associated with the Housing Major City Goal to address the need for more housing. Missing middle housing types include duplexes, triplexes, quadplexes, cottages, etc. Policy 5.4 also replaces Program 2.16 which discusses workforce housing. 5.5 -----Housing Variety Review new developments for compliance with City regulations and revise projects or establish conditions of approval as needed to implement the housing variety and tenure policies. Updated language to be consistent with City policies and processes. Packet Page 260 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 5.4 Housing Variety Evaluate opportunities for promoting and implement “missing middle” housing types (e.g. duplex, triplex, quadplex, cottages, etc) to increase housing options in the City within three years of adopting the Housing Element. New program to implement new Policy 5.3. 5.5 Housing Variety Update the Zoning Regulations to allow mixed- use development within Service Commercial (C- S) and Manufacturing (M) zones by right without a use permit within three one year of the adoption of the Housing Element. Consider amending the Zoning Regulations to streamline the permitting process for mixed-used projects in commercial zones. New program to support Policy 5.1 and to streamline approval of projects with residential units per HCD’s direction. Goal 6 - Housing Production. Plan for Facilitate the production of new housing to meet the full range of community housing needs. 6.1 6.1 Housing Production Consistent with the growth management portion of its Land Use Element and the availability of adequate resources, the City will plan to accommodate up to 3,354 dwelling units for the 6th cycle housing element update in accordance with the assigned Regional Housing Needs Allocation.1,144 dwelling units between January 2014 and June 2019 in accordance with the assigned Regional Housing Needs Allocation. Updated to be consistent with the 6th Cycle RHNA. 6.2 ----Housing Production New commercial developments in the Downtown Core (C-D Zone) shall include housing, unless the City makes one of the following findings: Housing is likely to jeopardize the health, safety or welfare of residents or employees; or The property’s shape, size, topography or other physical factor makes construction of new dwellings infeasible. Updated to be consistent with Zoning Regulations update. The Zoning Regulations require housing as a part of any development within the downtown. 6.3 6.2 Housing Production If City services must be rationed to development projects, residential projects will be given priority over non-residential projects. As required by SB 1087,Housing affordable to lower income households will be given first priority. 6.4 6.3 Housing Production City costs of providing services to housing development will be minimized. Other than for existing housing programs encouraging housing affordable to extremely low, very-low and low income persons, the City will not make new housing more affordable by shifting costs to existing residents. 6.5 6.4 Housing Production When sold, purchased, or redeveloped for public or private uses, City-owned properties within the urban reserve shall include housing as either a freestanding project or part of a mixed-use development where land is suitable and appropriate for housing. Packet Page 261 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 6.6 -----Housing Production Property located behind the former County General Hospital shall be designated a “Special Considerations” zone and may be considered suitable for residential development after further analysis and environmental review, provided that development be limited to site areas with average slopes of less than 20 percent, that approximately one-half of the total site area be dedicated for open space and/or public use, and that an additional water tank be provided if determined necessary to serve new development. Completed as a part of the LUE update as part of the special focus areas section;Program 8.6. General Hospital Site. 6.7 6.5 Housing Production Support the redevelopment of excess public and private utility properties for housing where appropriately located and consistent with the General Plan. 6.8 6.6 Housing Production Consistent with the City’s goal to stimulate higher density infill where appropriate in the Downtown Core (C-D Zone), Upper Monterey, and Mid-Higuera Special Focus Areas,, the City shall consider changes to the Zoning Regulations that would allow for flexible density standards that support the development of smaller apartments and efficiency units. This policy was updated to encourage additional residential units not only in Downtown, but in Upper Monterey and Mid-Higuera Special Focus Areas consistent with the City’s Major City Goal work program and new Program 2.15. 6.9 6.7 Housing Production Encourage and support employer/employee financing programs and partnerships to increase housing opportunities specifically targeted towards the local workforce. Revised language allows for more flexibility and creativity to implement the policy. 6.10 6.8 Housing Production To help meet the 6th cycle RHNA production targets Quantified Objectives, the City will support residential infill development and promote higher residential density where appropriate. Updated to be consistent with the 6th Cycle RHNA. -----6.9 Housing Production Specific plans for any new area identified shall include R-3 and R-4 zoned land to ensure sufficient land is designated at appropriate densities to accommodate the development of extremely low-, very low- and low-income dwellings. Converted Program 6.14 into a policy. 6.11 6.10 Housing Production Maintain the General Plan and Residential Growth Management Regulations (SLOMC 17.88144) exemption for new housing in the Downtown Core (C-D zone), accessory dwelling units (ADUs), and new housing in other zones that is enforceably for deed-restricted for extremely-low, very low, low-and moderate income households, pursuant to the Affordable Housing Standards. Updated to be consistent with Zoning Regulations update. Packet Page 262 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 6.12 6.11 Housing Production Continue to allow flexible parking regulations for housing development, especially in the Downtown Core (C-D Zone), including the possibilities of flexible use of city parking facilities by Downtown residents, where appropriate, and reduced or no parking requirements where appropriate guarantees limit occupancies to persons without motor vehicles or who provide proof of reserved, off-site parking. Such developments may be subject to requirements for parking use fees, use limitations and enforcement provisions. 6.13 6.12 Housing Production Continue to evaluate, every two to three years within the planning period, opportunities to develop and implement incentives to encourage additional housing in the Downtown, Upper Monterey, and Mid-Higuera Special Focus Areas Downtown Core (C-D Zone), particularly in mixed-use developments. Density based on flexible density in a project should be explored to encourage the development of smaller units. Modified to be consistent with Policy 6.6. 6.14 ----Housing Production Specific plans for any new expansion area identified shall include R-3 and R-4 zoned land to ensure sufficient land is designated at appropriate densities to accommodate the development of extremely low, very-low and low income dwellings. These plans shall include sites suitable for subsidized rental housing and affordable rental and owner-occupied dwellings, and programs to support the construction of dwellings rather than payment of in-lieu housing fees. Such sites shall be integrated within neighborhoods of market-rate housing and shall be architecturally compatible with the neighborhood. Converted to Policy 6.9. 6.15 6.13 Housing Production Consider General Plan amendments, as projects are proposed,to rezone commercial, manufacturing or public facility zoned areas for higher-density, infill or mixed-use housing where compatible with surrounding development. Group requested rezones so that as many as possible can be considered consistent with Government Code §65358,that allows a general plan to be amended more frequently than four times during any calendar year land development patterns are suitable and where impact to Low- Density Residential areas is minimal.For example,Areas to be considered for possible rezoning include, but are not limited to the following sites: A. Portions of South Broad Street Corridor and Little Italy area Updated to remove sites that have been developed and added new sites that may be considered for additional housing development. New language in blue added per the recommendation of the PC at the June 10, 2020 meeting. Packet Page 263 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification B. 1499 San Luis Drive (rezone vacant and underutilized School District property) C. 1642 Johnson Avenue (vacant School District property) D. 4325 South Higuera Street (former P.G.&E. yard) E.4355 Vachell Lane (vehicle storage) F.173 Buckley Road (Avila Ranch) G. 2143 Johnson Avenue (adjacent to County Health Department) H. 3710 Broad Street (Plumbers and Steamfitters Union) I.11950 Los Osos Valley Road (Pacific Beach High School) J. 2500 Block of Boulevard Del Campo (adjacent to Sinsheimer Park) K.12165 & 12193 Los Osos Valley Road (adjacent to Home Depot) L. 1150 & 1160 Laurel Lane (Atoll Business & Technology Center) M.600 Tank Farm Road (Temporary Unimproved Parking Area) N.12500 Los Osos Valley Road (053-141-013) (Agricultural fields and San Luis Creek) O.Los Osos Valley Road (053-161-020) (Agricultural fields and San Luis Creek) 6.16 6.14 Housing Production Continue to provide City resources,including $40,000 annually for operational support,that to support the SLO County Housing Trust Fund’s efforts to provide below market financing and technical assistance to affordable housing developers as a way to increase to construct or preserve five affordable housing units per year production in the City of San Luis Obispo. 6.17 6.15 Housing Production Encourage residential development through infill development and densification within City Limits and in designated expansion areas over new annexation of land. Reducing duplicity. The Land Use Element provides direction on the areas that the City encourages densification and development in both infill and expansion areas. 6.18 6.15 Housing Production Seek opportunities Meet every other year during the planning period with other public and private agencies to identify excess, surplus, ans underutilized parcels for residential development. and public utilities to identify, assemble, develop, redevelop and recycle surplus land for housing, and to convert vacant or underutilized public, utility or institutional buildings to housing. Consistent with new State law. 6.19 6.16 Housing Production Continue to Incentivize 20 affordable housing developments per year during the planning period consistent with SLOMC Affordable Housing Incentives. with density bonuses, parking reductions and other development incentives, including City financial assistance. Simplified as the requirements are outlined in the City’s Municipal Code. Reference to City financial assistance was removed because it is not a “development incentive.” Packet Page 264 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 6.20 6.17 Housing Production Continue to Financially assist in the development of 20 housing units per year that are affordable to extremely low, very-low, low-or and moderate income households during the planning period using State, Federal and local funding sources, with funding priority given to projects that result in the maximum housing benefits for the lowest household income levels. 6.21 6.18 Housing Production Actively seek and collaborate with non-profit housing providers to (jointly) apply for three new revenue sources each year during the planning period, including State, Federal and private/non- profit sources, and financing mechanisms to financially assist with development of affordable housing affordable to development for extremely low, very low and low or moderate income households and first- time homebuyers. 6.22 ----Housing Production Continue to exempt the rehabilitation or remodeling of up to 4 dwellings of up to 1200 square feet each from Architectural Review Commission review. New multi-unit housing may be allowed with “Minor or Incidental” or staff level architectural review, unless the dwellings are located on a sensitive or historically sensitive site. Implemented. Section 17.106.030 has been added to the 2018 Zoning Regulations update which references SLOMC Chapter 2.48 that includes language that exempts the rehabilitation or remodeling of up to 4 dwellings of up to 1,200 square feet each from Architectural Review Commission review. 6.23 -----Housing Production Assist in the production of affordable housing by identifying vacant or underutilized City-owned property suitable for housing, and dedicate public property, where feasible and appropriate for such purposes, as development projects are proposed. Implemented. Staff completed an inventory of City-owned property and found that no City-owned properties are suitable for housing. 6.24 -----Housing Production Community Development staff will proactively provide information for properties suitable for housing as identified in the Land Use and Housing Elements. Implemented.Staff actively provides information regarding any land identified in the Housing Element or the Land Use Element that may be suitable for housing development possibilities. 6.25 -----Housing Production Evaluate and consider amending the General Plan to designate the 46 acres associated with the former County General Hospital as a “Special Considerations” zone, suitable for housing development on areas of the site of less than 20 percent average slope, provided that open space dedication and public improvements are part of the project. Completed. The Land Use Element was updated in 2015 to include Program 8.6 which identified the General Hospital site as a Special Planning Area. 6.26 6.19 Housing Production Continue to update the Review the Affordable Housing Incentives (Chapter 17.90140, SLOMC) and Zoning Regulations every two years during the planning period and update to ensure density bonus incentives are consistent with State Law. Updated to be consistent with Zoning Regulations update. Packet Page 265 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 6.27 -----Housing Production Evaluate and consider increasing the residential density allowed in the Neighborhood- Commercial (C-N), Office (O) and Downtown Commercial (C-D) zoning districts. The City will evaluate allowing up to 24 units per acre in the C- N and O zones, and up to 72 units per acre in the C-D zone, twice the current density allowed in these areas. A detailed analysis of increasing the residential density allowed in various zoning districts was considered and evaluated as a part of the zoning update and determined that it would need to be part of a larger update to the Land Use Element (LUE) and require additional environmental review. 6.28 -----Housing Production Evaluate how lot patterns (i.e. size, shape, slope) in the City’s multi-family zones affect the City’s ability to meet housing production policies. If warranted, consider setting a minimum number of dwellings on each legal lot in the R-2, R-3 and R-4 zones, regardless of lot size, when other property development standards, such as parking, height limits and setbacks can be met. Implemented. In 2018 the Zoning Regulations were updated to include minimum number of dwellings on each legal lot in the R-2, R-3 and R-4 zones, regardless of lot size as long as the development can meet all property development standards, such as parking, height limits and setbacks. 6.29 -----Housing Production Continue to pursue incentives to encourage development of Secondary Dwelling Units (SDUs). Possible incentives include SDU design templates, flexible development standards, fee reductions or deferrals, or other measures to encourage the construction of SDUs where allowed by zoning. Implemented. The City updated the Zoning Regulations in 2018 and 2020 to be consistent with State law regarding SDUs (now called ADUs – Accessory Dwelling Units).In addition, the City has also eliminated impact fees requirements for ADUs. 6.30 6.20 Housing Production Evaluate and update consider updating adopting the Subdivision and Zoning Regulations,within three years of the Housing Element Adoption, changes to support small lot subdivisions, ownership bungalow court development Eliminate the one acre minimum lot area for PD overlay zoning,and other alternatives to conventional subdivision design. The Zoning Regulations were updated in 2018 and included a revision to the PD overlay zoning to allow a minimum of one-half of a contiguous acre for a PD (as opposed to a one acre minimum). 6.31 -----Housing Production Consider scaling development impact fees for residential development based on size, number of bedrooms, and room counts. Completed as a part of the AB 1600 and fee schedule update. 6.32 6.21 Housing Production Continue to submit annual the Housing Element Annual Progress Reports (APR) to the State Department of Housing and Community Development and the Governor’s Office of Planning and Research on or before April 1st of each year for the prior calendar year, pursuant to per Government Code Section 65400. 6.22 Housing Production Update the City’s municipal code to expand objective design standards within one year of the adoption of the Housing Element Update. SB 330 restricts cities from imposing or enforcing new design standards established on or after January 1, 2020, that are not objective design standards. This program provides a plan to expand the existing objective design standards within the Zoning Regulations to include additional standards that are contained within the Community Design Guidelines. Packet Page 266 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 6.23 Housing Production Update the development review process and expand the thresholds of each review level (minor, moderate, and major) to eliminate or reduce the number of public hearing required for housing projects within one year of adopting the Housing Element. Consistent with the State’s goal to streamline the review process for housing projects, this program outlines a plan to restructure the review process and eliminate or reduce the number of public hearings needed to approve a housing project. Goal 7 - Neighborhood Quality. Maintain, preserve and enhance the quality and livability of neighborhoods. encourage neighborhood stability and owner occupancy, and improve neighborhood appearance, function and sense of community. Modified to provide focus on neighborhood quality, amenities, and access and less on specific tenure .Where projects propose home ownership, Goal 10: Local Preference, outlines policies and programs to support local home ownership. 7.1 7.1 Neighborhood Quality Within established neighborhoods, new residential development should shall be of compatible design character, size, density and quality that respects the existing neighborhood character, to enhance and maintains the quality of life for existing and future residents. Reworded for consistency with state law. 7.2 7.2 Neighborhood Quality Higher density housing should maintain high quality standards for unit design, privacy, security, on-site amenities, and public and private open space. Such standards should be flexible enough to allow innovative design solutions.in special circumstances, e.g. in developing mixed- use developments or in housing in the Downtown Core. 7.3 -----Neighborhood Quality Within established neighborhoods, housing should not be located on sites designated in the General Plan for parks or open space. Covered by polices within the Conservation and Open Space Element and the Land Use Element. 7.4 7.3 Neighborhood Quality Within expansion areas, New residential developments should incorporate be an integral part of an existing neighborhood or should establish a new neighborhood,with pedestrian and bicycle linkages that provide direct, convenient and safe access to adjacent neighborhoods, schools, parks, and shopping areas. The City no longer has any areas that are considered “expansion areas.”The Policy should apply to all new residential projects. 7.5 7.4 Neighborhood Quality Discourage the creation of walled-off or physical separations between residential enclaves, or of separate, unconnected tracts to enhance,is discouraged because physical separations prevent the formation of safe, walkable, and enjoyable neighborhoods. Reworded for clarity. 7.6 7.5 Neighborhood Quality Housing should shall be sited to enhance safety along neighborhood streets and in other public and semi-public areas. 7.7 7.6 Neighborhood Quality The physical design of neighborhoods and dwellings should promote walking and bicycling and preserve open spaces and views. Packet Page 267 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 7.8 7.7 Neighborhood Quality Continue to encourage strategies and programs that increase long-term residency and stabilization in neighborhoods. ----7.8 Neighborhood Quality Preserve the fabric, amenities, yards (i.e. setbacks), and overall character and quality of life of established neighborhoods. Policy 3.6 was moved to Goal 7 as it better relates to Neighborhood Quality than Housing Conservation. ----7.9 Neighborhood Quality Encourage neighborhood design elements that improve overall health of residents such as providing safe and convenient opportunities to access healthy food and attractive places for recreational exercise. This is a new policy that has been added as recommended by the Planning Commission to address public health and housing. 7.9 7.10 Neighborhood Quality Continue to utilize a diverse range of outreach methoods implement varied strategies,including such as early notification through email notifications electronic media,the City’s website and social media accounts improvements,and neighborhood outreach meetings, etc., to ensure residents are aware of and able to participate in planning decisions affecting their neighborhoods early in the planning process. Updated to be consistent with current requirements and policies. 7.10 7.11 Neighborhood Quality Continue to work directly with neighborhood groups and individuals to address concerns pertaining to Identify specific neighborhood needs, problems, trends and opportunities for physical improvements. 7.11 7.12 Neighborhood Quality Continue to fund neighborhood improvements, including parks, sidewalks, traffic calming devices, crosswalks, parkways, street trees and street lighting to improve aesthetics, safety and accessibility. 7.12 -----Neighborhood Quality Continue to develop and implement neighborhood parking strategies, including parking districts, to address the lack of on-and off-street parking in residential areas. Implemented. The City has a process where Neighborhood Parking Districts can be created. The City has also been working on the creation of demand-based parking strategies. 7.13 7.13 Neighborhood Quality Continue the City’s Neighborhood Services and proactive enforcement Code Enforcement programs to support neighborhood wellness. ----7.14 Neighborhood Quality Encourage new developments with 10 or more residential units be reviewed and scored by the Healthy Communities Work Group prior to submitting a planning application to the City. This is a new program recommended by the Planning Commission to support Policy 7.9. The City Council directed staff to review this program and provide more clarity. The requirement to have a housing project be evaluated by an outside group poses several concerns: 1) reduced predictability in the review process for developers or the public; 2) review timing and scoring is outside the control of the City; 3) once a score is Packet Page 268 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification given to the project, the City does not have development standards or code requirement to interpret the score; and 4) this requirement could result in the delaying the approval of housing projects (this could place the City in a difficult position of conflict with state law). Staff is recommending that this program be removed. ----7.14 Neighborhood Quality Evaluate and update the Community Design Guidelines to provide site design standards for Encourage developments with 110 or more residential units to include outdoor amenities such as the following: outdoor visiting and gathering spaces, places to exercise or recreate, and spaces reserved for edible landscape or community gardens. This is a new program recommended by the Planning Commission to support Policy 7.9. The City Council directed staff to review this program and provide more clarity. Staff is recommending that the program be connected to an update of the Community Design Guidelines. 10 units was changed to 11 units to be consistent with what is defined as “Development Review –Major” within the Zoning Regulations. Goal 8 -Special Housing Needs. Encourage the creation and maintenance of housing for those with special housing needs. 8.1 8.1 Special Housing Needs Encourage housing development that meets a variety of special needs, including large families, single parents, disabled persons, the elderly, students, veterans, the homeless, or those seeking congregate care, group housing, single-room occupancy or co-housing accommodations, utilizing universal design. 8.2 8.2 Special Housing Needs Preserve manufactured housing or mobile home parks and support changes in these forms of tenure only if such changes provide residents with greater long-term security or comparable housing in terms of quality, cost, and livability. 8.3 -----Special Housing Needs Encourage manufactured homes in Specific Plan Areas by: A) When the City considers adopting new specific plans, including policies that support owner-occupied manufactured home parks with amenities such as greenbelts, recreation facilities, and shopping services within a master planned community setting. Such parks could be specifically designed to help address the needs of those with mobility and transportation limitations. B) Establishing lot sizes, setback, and parking guidelines that allow for relatively dense Manufactured homes are allowed in all residential zones; applicants have not shown any interest in creating new manufactured home parks.New, higher density development is more efficient and cost effective. The most recent affordable housing projects have all been multi-family apartments. Packet Page 269 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification placement of manufactured homes within the master planned neighborhood. C) Locating manufactured home parks near public transit facilities or provide public transportation services to the manufactured home parks to minimize the need for residents to own automobiles. 8.4 8.3 Special Housing Needs Encourage Cal Poly University to continue to develop on-campus student housing to meet existing and future needs and to lessen pressure on City housing supply and transportation systems. 8.5 8.4 Special Housing Needs Strengthen the role of on-campus housing by encouraging Cal Poly University to require freshmen and sophomore students to live on campus. 8.6 8.5 Special Housing Needs Locate fraternities and sororities on the Cal Poly University campus. Until that is possible, they should be located in Medium-High and High- Density residential zones near the campus. 8.7 8.6 Special Housing Needs Encourage Cal Poly University to develop and maintain faculty and staff housing, consistent with the General Plan. 8.8 8.7 Special Housing Needs Disperse special needs living facilities throughout the City where public transit and commercial services are available, rather than concentrating them in one district. 8.9 8.8 Special Housing Needs Support Continue to support regional efforts to address homelessness implement the document “The Path Home: San Luis Obispo County’s 10 Year Plan to End Chronic Homelessness”. Revised to be consistent with current activities and SB 101. 8.10 8.9 Special Housing Needs Encourage a variety of housing types that accommodate persons with disabilities,and promote aging in place, and include amenities such as visiting space, first floor accessibility, etc.including a goal of “visitability” in new residential units, with an emphasis on first-floor accessibility to the maximum extent feasible. Based on community feedback, this policy was revised to highlight that housing for persons with disabilities or aging in place should include amenities that support those living within the units. 8.11 -----Special Housing Needs Encourage changes to City regulations that would support the special housing needs of disabled persons, including persons with developmental disabilities. Completed. Regulations have been updated to address special housing needs. In addition, the building code is regularly updated to meet State and Federal requirements. 8.12 8.10 Special Housing Needs Assist the homeless and those at risk of becoming homeless by supporting shelters, temporary housing, and transitional housing.and by facilitating general housing assistance. The role of the City is not to place individuals in housing. There are several local non-profits involved with helping people find housing. The City, if contacted, connects people to these local organizations. Packet Page 270 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 8.13 8.11 Special Housing Needs Continue to provide resources that support local and regional solutions to meeting the needs of the homeless and continue to support, jointly with other agencies, shelters and programs, such as Housing First and Rapid Rehousing, for the homeless and for displaced individual and families. women and children. 8.14 8.12 Special Housing Needs Continue to enforce the mobile home rent stabilization program to minimize increases in the cost of mobile home park space rents. 8.15 8.13 Special Housing Needs Continue to look for Support opportunities in specific plan areas within the City suitable for tenant-owned mobile-home parks, cooperative or limited equity housing, manufactured housing, self-help housing, or other types of housing that meets special needs. 8.16 8.14 Special Housing Needs Advocate developing more housing and refurbishing campus housing at Cal Poly University. 8.17 8.15 Special Housing Needs Work with Cal Poly University Administration to secure designation of on-campus fraternity/sorority living groups. 8.18 8.16 Special Housing Needs Jointly develop and implement a student housing plan and Continue to support “good neighbor programs” with Cal Poly State University, Cuesta College, the City and local City residents. The program would seek to improve communication and cooperation between all groups the City and the schools, set on campus student housing objectives and establish clear, effective standards for about student housing in residential neighborhoods. Revised for clarity. 8.19 8.17 Special Housing Needs Provide public educational information at various City Offices, on the City website, and other electronic media platforms the Community Development Department public counter on universal design concepts (i.e. aging in place) for new and existing residential dwellings. Revised for clarity. 8.20 8.18 Special Housing Needs Transitional Housing and Supportive Housing: Continue to allow the establishment of transitional and supportive housing in all zoning districts where residential uses are allowed. Review and amend the Zoning Regulations within one year of Housing Element adoption to ensure compliance with: 1) the Supportive Housing Streamlining Act (AB 2162) to allow supportive housing a use-by-right in zones where multi-family and mixed uses are permitted, including nonresidential zones permitting multifamily uses, if the proposed development Revised to be consistent with State law. Packet Page 271 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification meets specified criteria; and 2) AB 101, to allow to allow homeless shelters, transitional housing and supportive housing (Low Barrier Navigation Centers) by right in all residential zones, areas zoned for mixed-uses, and nonresidential zones permitting multifamily uses without a conditional use permit to be alignment with Government Code Section 65660 (AB 101). 8.21 8.19 Special Housing Needs Continue to look for partnership opportunities with non-profit housing developers and service providers to that can be acquire four vacant, blighted, or underutilized properties (land, retail or commercial space, motels, apartments, housing units, mobile home parks)during the planning period for and conversion into affordable permanent and supportive housing and permanent supportive housing for homeless persons and families. Revised to broaden the opportunities for the City to partner with local non- profit housing developers. 8.22 -----Special Housing Needs Consider addition of an overlay zone to existing and future mobile home and trailer park sites to provide constructive notice that additional requirements, such as rent stabilization and a mobile home park conversion ordinance may apply. The City’s Municipal Code contains a Mobile Home Park Rent Stabilization Ordinance that applies citywide to all mobile home parks. The Ordinance satisfies this program by protecting owners and renters of mobile homes from unreasonable rent increases. Staff has evaluated that an overlay zone would not provide any additional benefit. 8.23 8.20 Special Housing Needs Actively Continue to seek and collaborate with non-profit housing providers to (jointly) apply for two revenue sources each year during the planning period for State, Federal, and local funding sources to encourage and financially assist with the development of housing for persons with developmental disabilities. The City will seek grantopportunities for housing construction and rehabilitation specifically targeted for persons with developmental disabilities. Consolidated the wording of this program. No change in the content. 8.24 -----Special Housing Needs Continue to coordinate with the County, social services providers and non-profit organizations for delivery of existing, improved and expanded services, including case management, drug, alcohol, detoxification, and mental health services. This program is covered in Program 8.21. 8.25 8.21 Special Housing Needs Continue to coordinate monthly engage with the County Department of Social Services, Homeless Services Oversight Council (HSOC), social services providers, and non-profit organizations and Friends of Prado Day Center (FPDC)to identify, evaluate, and implement strategies to reduce the impacts of homelessness on the City. Updated language to be consistent with current organizations and agencies. Packet Page 272 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 8.22 Special Housing Needs Work with other jurisdictions to advocate for State legislation that would: 1) provide funding to help Cal Poly University provide adequate on- campus student housing, and 2) allow greater flexibility for State universities and community colleges to enter into public-private partnerships to construct student housing. Relocated Program 10.6. 8.23 Special Housing Needs Update Zoning Regulations, within two years of Housing Element adoption, to be consistent with the Employee Housing Act; including: 1) an update of Table 2-1 to allow single-unit dwellings without a Conditional Use Permit within the Open Space and Conservation (C/OS) zone and employee housing consisting of no more than 36 beds in a group quarters, or 12 units or separate rooms or spaces designed for use by a single- family or household within the C/OS and AG zones, and 2) remove Chapter 17.148 -High- Occupancy Residential Use Regulations. Revised to be consistent with state law regarding the Employee Housing Act. Goal 9 - Sustainable Housing Site, and Neighborhood Design. Encourage housing that is resource conserving, healthful, economical to live in, environmentally benign, and recyclable when demolished. 9.1 9.1 Sustainable Housing, Site and Neighborhood Design Residential developments should promote sustainability consistent with the Climate Action Plan (CAP) and California Building Energy Efficiency Standards –Title 24 in their design, placement, and functionality use.Sustainability can be promoted through a variety of housing strategies, including the following: A) Maximize use of renewable, recycled-content, and recycled materials, and minimize use of building materials that require high levels of energy to produce or that cause significant, adverse environmental impacts. B) Incorporate renewable energy features into new homes, including passive solar design, solar hot water, solar power, and natural ventilation and cooling. C) Minimize thermal island effects through reduction of heat-absorbing pavement and increased tree shading. Avoid building materials that may contribute to health problems through the release of gasses or glass fibers into indoor air. D) Design dwellings for quiet, indoors and out, for both the mental and physical health of residents. F) Design dwellings economical to live in because of reduced utility bills, low cost maintenance and operation, and improved occupant health. G) Use construction materials and methods that maximize the recyclability of a building’s parts. Updated to be consistent with current City and State policies. Strategies were removed because they are outlined in the CAP and Title 24. Packet Page 273 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification Educate public, staff, and builders to the advantages and approaches to sustainable design, and thereby develop consumer demand for sustainable housing. I) City will continue to refer to a sustainable development rating system, such as the LEED or GreenPoint programs when evaluating new development proposals. 9.2 9.2 Sustainable Housing, Site and Neighborhood Design Residential units site, subdivision layouts, and neighborhood designs amenities should be coordinated to support make residential sustainable design work.Some ways to do this include: A) Design subdivisions to maximize solar access for each dwelling and site. B) Design sites so residents have usable outdoor space with access to both sun and shade. C) Streets and access ways should minimize pavement devoted to vehicular use. D) Use neighborhood retention basins to purify street runoff prior to its entering creeks. Retention basins should be designed to be visually attractive as well as functional. Fenced-off retention basins should be avoided. E) Encourage cluster development with dwellings grouped around significantly-sized, shared open space in return for City approval of smaller individual lots. F)Treat public streets as landscaped parkways, using continuous plantings at least six feet wide and where feasible, median planters to enhance, define, and to buffer residential neighborhoods of all densities from the effects of vehicle traffic. Examples were removed as innovative sustainable designs are extensive. 9.3 -----Sustainable Housing, Site and Neighborhood Design Preserve the physical neighborhood qualities in the Downtown Planning Area that contribute to sustainability. Some ways to do this include: A) Maintain the overall scale, density and architectural character of older neighborhoods surrounding the Downtown Core. B) Encourage the maintenance and rehabilitation of historically designated housing stock. The Historic Preservation Ordinance preserves and protects historic structures and districts. Additionally, the Conservation and Open Space Element includes Policies 3.3.4, 3.3.5, that direct preservation of historic buildings, districts, and neighborhoods. Program 3.6.3 directs construction within historic districts. 9.4 9.3 Sustainable Housing, Site and Neighborhood Design To promote energy conservation and a cleaner environment,Continue to encourage the development of dwellings with energy-efficient designs, utilizing passive and active solar features, and the use of energy-saving techniques that exceed minimums prescribed by State law. 9.5 9.4 Sustainable Housing, Site and Neighborhood Design Actively Continue to promote water conservation through housing and site design to help moderate the cost of housing. Packet Page 274 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 9.6 9.5 Sustainable Housing, Site and Neighborhood Design Support programs that provide financing for sustainable home upgrade projects such as installation of solar panels, heating and cooling systems, water conservation and windows to improve the energy efficiency of the City’s existing housing stock. 9.7 9.6 Sustainable Housing, Site and Neighborhood Design Continue to educate planning and building staff and citizen review bodies on energy conservation issues, including the City’s energy conservation policies and Climate Action Plan. Staff shall work with applicants to achieve the City’s energy conservation goals. 9.8 9.7 Sustainable Housing, Site and Neighborhood Design Continue to provide assurance of long-term solar access for new or remodeled housing and for adjacent properties, consistent with historic preservation guidelines and revise regulations found to be inadequate. 9.9 -----Sustainable Housing, Site and Neighborhood Design Continue to implement the Water Quality Control Board’s “Post-Construction Stormwater Management Requirements for Development Projects in the Central Coast Region”, to reduce the amount of impermeable surface. Implemented. All development projects are required to include Post- Construction Stormwater Management Requirements as a part of a project application, which allows staff to verify that the project is consistent with the Regional Water Board’s Requirements. 9.10 9.8 Sustainable Housing, Site and Neighborhood Design Implement Climate Action Plan programs that increase the production of “green” housing units and projects and require use of sustainable and/or renewable materials, water and energy technologies (such as, but not limited to solar, wind, or thermal). 9.11 9.9 Sustainable Housing, Site and Neighborhood Design Continue to promote building materials reuse and recycling in site development and residential construction, including flexible standards for use of salvaged, recycled, and “green” building materials. Continue the City’s construction and demolition debris recycling program as described in Chapter 8.05 of the Municipal Code. 9.12 -----Sustainable Housing, Site and Neighborhood Design Consider incentivizing dwelling units to a minimum size of 150 square feet, consistent with the California Building Code, by reduced impact fees and property development standards. Implemented. The City has implemented a reduction in the impact fees for smaller units with AB 1600 and the fee schedule update. Additionally, ADU requirements have been revised to be consistent with state law and impact fees removed in order to incentivize the development of this type of smaller unit. Packet Page 275 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 9.13 9.10 Sustainable Housing, Site and Neighborhood Design Continue to support Consider participating in financing programs for sustainable home improvements such as solar panels, heating and cooling systems, water conservation and energy efficient windows. Goal 10 - Local Preference. Maximize affordable housing opportunities for those individuals who are employed in business that are located in geographic areas that are customarily included in the City’s annual jobs -housing balance analysis who live or work in San Luis Obispo while seeking to balance job growth and housing supply. 10.1 10.1 Local Preference Administer City housing programs and benefits, such as First Time Homebuyer Assistance or affordable housing lotteries, to give preference to individuals as outlined in Policy 10.2. to: 1) persons living or working in the City or within the City’s Urban Reserve, and 2) persons living in San Luis Obispo County. See discussion under Policy 10.2 10.2 -----Local Preference Cal Poly State University and Cuesta College should actively work with the City and community organizations to create positive environments around the Cal Poly Campus by: A) Establishing standards for appropriate student densities in neighborhoods near Campus; B) Promoting homeownership for academic faculty and staff in Low-Density Residential neighborhoods in the northern part of the City; and C) Encouraging and participating in the revitalization of degraded neighborhoods. This Policy did not address local preference. Supporting housing for employees at Cal Poly, Cuesta, CMC, etc. is covered in Policy 10.2. 10.2 Local Preference Encourage, and where legally allowed, require new housing development to give preference in the following order: 1) individuals who are employed in business that are located in geographic areas that are customarily included in the City’s annual jobs-housing balance analysis, 2) individuals residing in the County, and 3) finally to individuals from outside the County. Council directed staff to work with the City Attorney’s office to reword Policy 10.2. In reviewing the City’s Housing Element, HCD shared concerns with Policy 10.2 and Program 10.4. They stated that, “This policy [10.2] potentially erects barriers and prevents access to housing opportunities, particularly to individuals from outside of the City, and should be removed.” In re- reviewing Goal 10 and the associated policies and programs staff is recommending these be removed from the Housing Element in order prevent limiting housing to any individual. 10.3 Local Preference Continue to work with the County of San Luis Obispo for any land use decisions that create significant expansion of employment in the unincorporated areas adjacent to the City to mitigate housing impacts on the City. Packet Page 276 Item 16 GENP-0217-2020 & EID-0218-2020 #New #Goals Policy/Program Reason for Modification 10.4 Local Preference Encourage residential developers to sell or rent their projects to those residing or employed in the City first before outside markets. See discussion under Policy 10.2 10.5 Local Preference Work with Cal Poly to address the link between enrollment and the expansion of campus housing programs at Cal Poly University to reduce pressure on the City's housing supply. This program is covered in Program 8.16. 10.6 Local Preference Work with other jurisdictions to advocate for State legislation that would: 1) provide funding to help Cal Poly University provide adequate on- campus student housing, and 2) allow greater flexibility for State universities and community colleges to enter into public-private partnerships to construct student housing. Relocated under Goal 8 as Program 8.22. Goal 11 - Suitability. Develop and retain housing on sites that are suitable for that purpose. 11.1 Suitability Where property is equally suited for commercial or residential uses, give preference to residential use. Changes in land use designation from residential to non-residential should be discouraged. Policies and programs within Goal 11 are covered by the other Goals of the Housing Element, the Housing Major City Goal, the Conservation and Open Space Element, the Land Use Element, and the Safety Element. 11.2 Suitability Prevent new housing development on sites that should be preserved as dedicated open space or parks, on sites subject to natural hazards such as unmitigable geological or flood risks, or wild fire dangers, and on sites subject to unacceptable levels of man-made hazards or nuisances, including severe soil contamination, airport noise or hazards, traffic noise or hazards, odors or incompatible neighboring uses. 11.3 Suitability The City will continue to ensure the ability of legal, non-conforming uses to continue where new development is proposed. Packet Page 277 Item 16 Packet Page 278 Item 16 Packet Page 279 Item 16 STATE OF CALIFORNIA - BUSINESS, CONSUMER SERVICES AND HOUSING AGENCY GAVIN NEWSOM, Governor DEPARTMENT OF HOUSING AND COMMUNITY DEVELOPMENT DIVISION OF HOUSING POLICY DEVELOPMENT 2020 W. El Camino Avenue, Suite 500 Sacramento, CA 95833 (916) 263-2911 / FAX (916) 263-7453 www.hcd.ca.gov September 4, 2020 Michael Codron, Director Community Development City of San Luis Obispo 919 Palm Street San Luis Obispo, CA 93401-3218 Dear Michael Codron: RE: City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element Thank you for submitting the City of San Luis Obispo’s (City) draft housing element received for review on July 7, 2020, along with revisions received on August 21, 2020. Pursuant to Government Code section 65585, subdivision (b), the California Department of Housing and Community Development (HCD) is reporting the results of its review. Our review was facilitated by a telephone conversation on August 6, 2020 with Rachel Cohen, Associate Planner, and Tyler Corey, Principal Planner. In addition, HCD considered comments from California Rural Legal Assistance pursuant to Government Code section 65585, subdivision (c). The draft element addresses many statutory requirements; however, revisions will be necessary to comply with State Housing Element Law (Article 10.6 of the Gov. Code). The enclosed Appendix describes the revisions needed to comply with State Housing Element Law. To remain on an eight-year planning cycle, the City must adopt its housing element within 120 calendar days from the statutory due date of December 31, 2020 for San Luis Obispo Council of Governments (SLOCOG) localities. If adopted after this date, Government Code section 65588, subdivision (e)(4) requires the housing element be revised every four years until adopting at least two consecutive revisions by the statutory deadline. For more information on housing element adoption requirements, please visit HCD’s website at: http://www.hcd.ca.gov/community-development/housing- element/housing-element-memos/docs/sb375_final100413.pdf Public participation in the development, adoption and implementation of the housing element is essential to effective housing planning. Throughout the housing element process, the City should continue to engage the community, including organizations that represent lower-income and special needs households, by making information regularly available and considering and incorporating comments where appropriate. Packet Page 280 Item 16 Michael Codron, Director Page 2 Several federal, state, and regional funding programs consider housing element compliance as an eligibility or ranking criteria. For example, the CalTrans Senate Bill (SB) 1 Sustainable Communities grant; the Strategic Growth Council and HCD’s Affordable Housing and Sustainable Communities program; SB 2 Planning Grants as well as ongoing SB 2 funding (Permanent Local Housing Allocation) consider housing element compliance and/or annual reporting requirements pursuant to Government Code section 65400. With a compliant housing element, the City meets housing element requirements for these and other funding sources. HCD appreciates the cooperation Rachel Cohen and Tyler Corey provided during the course of our review. We are committed to assisting the City in addressing all statutory requirements of State Housing Element Law. If you have any questions or need additional technical assistance, please contact Shawn Danino, of our staff, at shawn.danino@hcd.ca.gov. Sincerely, Megan Kirkeby Deputy Director Enclosure Packet Page 281 Item 16 APPENDIX CITY OF SAN LUIS OBISPO The following changes would bring the City’s housing element into compliance with Article 10.6 of the Government Code. Accompanying each recommended change, we cite the supporting section of the Government Code. Housing element technical assistance information is available on HCD’s website at http://www.hcd.ca.gov/community-development/housing-element/housing-element-memos.shtml. Among other resources, the housing element section contains HCD’s latest technical assistance tool, Building Blocks for Effective Housing Elements (Building Blocks), available at http://www.hcd.ca.gov/community-development/building-blocks/index.shtml and includes the Government Code addressing State Housing Element Law and other resources. A. Housing Needs, Resources, and Constraints 1. Include an analysis and documentation of household characteristics, including level of payment compared to ability to pay, housing characteristics, including overcrowding, and housing stock condition. (Gov. Code, § 65583, subd. (a)(2).) The element relies upon American Community Survey data to evaluate the condition of the housing stock (page A-15 thru A-16). However, the element must include analysis of the condition of the existing housing stock based upon a local estimate. For example, the analysis could include estimates from a recent windshield survey or sampling, estimates from the code enforcement agency, or information from knowledgeable builders/developers, including non-profit housing developers or organizations. Further, the analysis could collect information on unit type (single family, multifamily, mobilehomes) to better guide policies and programs. For additional information, see the Building Blocks at http://www.hcd.ca.gov/community-development/building- blocks/housing-needs/housing-stock-characteristics.shtml. 2. An inventory of land suitable and available for residential development, including vacant sites and sites having realistic and demonstrated potential for redevelopment during the planning period to meet the locality’s housing need for a designated income level, and an analysis of the relationship of zoning and public facilities and services to these sites. (Gov. Code, § 65583, subd. (a)(3).) The City has a regional housing need allocation (RHNA) of 3,354 housing units, of which 1,345 are for lower-income households. To address this need, the element relies on permitted and entitled projects, accessory dwelling units (ADUs), vacant and nonvacant sites, sites with existing historic structures, and specific plan areas. To demonstrate the adequacy of these sites and strategies to accommodate the City’s RHNA, the element must include complete analyses, as follows: Progress in Meeting the RHNA: The element indicates (page D-9) that 47 units affordable to very low-income households, 49 units affordable to low-income household, and 27 units affordable to moderate-income households have been built, permitted or entitled. The element must also demonstrate affordability based on actual or anticipated sales price or rent level of the units or other mechanisms ensuring Packet Page 282 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 2 September 4, 2020 assumed affordability levels (e.g., financing, inclusionary requirements). Given the City’s growth management and phasing requirements, the element must also demonstrate their availability in the planning period. For additional information, see the Building Blocks at http://www.hcd.ca.gov/community-development/building- blocks/housing-needs/projected-housing-needs.shtml. Sites Inventory: The element appears to describe sites outside city limits. If utilizing sites outside city limits toward the regional housing need allocation, the element must: (1) identify and analyze the sites pursuant to statutory requirements, (2) demonstrate suitability and availability for development in the planning period including a schedule of anticipated milestones for annexation and accounting for any phasing requirements, and (3) add policies and programs with a schedule of actions to make the sites available for development in the planning period, including alternative measures with specified completion dates if the sites are not made available with zoning early in the planning period. Previously Identified Nonvacant and Vacant Sites: If nonvacant sites were identified in a prior adopted housing element or vacant sites were identified in two or more consecutive planning periods, the sites are inadequate to accommodate housing for lower-income households unless: x The site’s current zoning is appropriate for the development of housing affordable to lower-income households by either including analysis or meeting the appropriate density. See Government Code section 65583.2, subdivision (c)(3), and x The site is subject to a housing element program that requires rezoning within three years of the beginning of the planning period to allow residential use by right for housing developments in which at least 20 percent of the units are affordable to lower-income households (Gov. Code, § 65583.2, subd. (c).). The element should identify which sites, if any, have been identified in multiple planning period and include the applicable program. Suitability of Non-Vacant Sites: The element must describe the methodology used to determine the additional development potential within the planning period. The methodology must consider factors including the extent to which existing uses may impede additional residential development, development trends, market conditions, and regulatory or other incentives or standards to encourage additional residential development on these sites. (Gov. Code, § 65583.2, subd. (g).) For sites with residential uses, the inventory could also describe structural conditions or other circumstances and trends demonstrating the redevelopment potential to more intense residential uses. For nonresidential sites, the inventory could also describe whether the use is operating, marginal or discontinued, and the condition of the structure or could describe any expressed interest in redevelopment. The site inventory identifies multiple Packet Page 283 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 3 September 4, 2020 sites that include “contributing historic structures” or “historic structures”. The element should analyze the effect of historic structures on the ability to redevelop sites. For example, the element should describe additional restrictions, costs, and processes affiliated with redevelopment on these sites. Also, the element utilizes various factors to indicate potential for redevelopment but must also support these assumptions with analysis and development trends. For example, the element appears to assume existing lot coverages to indicate potential for redevelopment but should also support these assumptions with analysis and development trends. For additional information and sample analysis, see the Building Blocks at: http://www.hcd.ca.gov/community- development/building-blocks/site-inventory-analysis/analysis-of-sites-and- zoning.shtml#analysis Specific Plans: The housing element relies upon sites within specific plan areas to accommodate the City’s regional housing need for lower-income households. The element should analyze the specific plan areas for their suitability and availability for development in the planning period. The analysis must at least describe each overall plan, impacts of phasing on availability for development in the planning, the timing for overall buildout, and any affordability requirements. Emergency Shelters: The element describes the Public Facilities zone as accommodating emergency shelters without discretionary action. However, the element must analyze the zone for its capacity (acreage, average lot size, vacant, non-vacant) and suitability (proximity to transit and services and other uses allowed in the zone) to accommodate emergency shelters. For more information, see the Building Blocks at http://www.hcd.ca.gov/community-development/building-blocks/site-inventory- analysis/zoning-for-variety-housing-types.shtml and HCD’s SB 2 memo at http://www.hcd.ca.gov/community-development/housing-element/housing-element- memos/docs/sb2_memo050708.pdf. 3. An analysis of potential and actual governmental constraints upon the maintenance, improvement, or development of housing for all income levels, including the types of housing identified in paragraph (1) of subdivision (c), and for persons with disabilities as identified in the analysis pursuant to paragraph (7), including land use controls, building codes and their enforcement, site improvements, fees and other exactions required of developers, and local processing and permit procedures. The analysis shall also demonstrate local efforts to remove governmental constraints that hinder the locality from meeting its share of the regional housing need in accordance with Government Code section 65584 and from meeting the need for housing for persons with disabilities, supportive housing, transitional housing, and emergency shelters identified pursuant to paragraph (7). Transitional housing and supportive housing shall be considered a residential use of property and shall be subject only to those restrictions that apply to other residential dwellings of the same type in the same zone. (Gov. Code, § 65583, subd. (a)(5).) Fees and Exaction: The element must describe all required fees for single family and multifamily housing development, including impact fees, and analyze their impact as potential constraints on housing supply and affordability. For example, the analysis Packet Page 284 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 4 September 4, 2020 could identify the total amount of fees and their proportion to the development costs for both single family and multifamily housing. For additional information and a sample analysis and tables, see the Building Blocks at http://www.hcd.ca.gov/community- development/building-blocks/constraints/fees-and-exactions.shtml. Architectural Review: The element must describe and analyze the architectural review process, including approval procedures and decision-making criteria, for their impact as potential constraints on housing supply and affordability. The element describes three levels of review. The element should analyze each level separately for its impacts on housing development. For example, the analysis could describe required findings and discuss whether objective standards and guidelines improve development certainty and mitigate cost impacts. The element must demonstrate this process is not a constraint or it must include a program to address this permitting requirement, as appropriate. Also, under specified conditions, any subjective design standards are suspended pursuant to Government Code section 66300 (see below). The element should evaluate consistency with these requirements and include actions as appropriate. For additional information and sample analysis, see the Building Blocks at http://www.hcd.ca.gov/community-development/building-blocks/constraints/processing- permitting-procedures.shtml. Growth Caps: The element notes “the City’s housing supply shall grow no faster than one percent per year.” The Housing Crisis Act of 2019 (SB 330, 2019) was signed by Governor Newsom on October 9, 2019 and became effective on January 1, 2020. The Housing Crisis Act (Gov. Code, § 66300) generally prohibits a locality from enacting a development policy, standard or condition that reduces intensity, imposes moratoriums, enforces subjective design standards or implements any provision that limits approvals or caps population. These provisions remain in effect until January 1, 2025. Specifically, Government Code section 66300, subdivision (b)(1)(D), with limited exception not applicable here, does not allow affected jurisdictions to adopt new or enforce existing limits on the number of land-use approvals or permits. The City should evaluate consistency with these requirements and if necessary, immediately void or suspend the annual growth cap. 4. Analyze any special housing needs such as elderly; persons with disabilities, including a developmental disability; large families; farmworkers; families with female heads of households; and families and persons in need of emergency shelter. (Gov. Code, § 65583, subd. (a)(7).) The element notes only 1.1 percent of the labor force in agriculture and other industries and therefore the housing needs of farmworkers are not critical. However, the element also notes close to 10,000 farmworkers in the County and appears to constrain housing for farmworkers through local preference policies (Policy 10.2). As a result, the element should acknowledge this significant need and include specific policies and programs. Packet Page 285 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 5 September 4, 2020 B. Housing Programs 1. Identify actions that will be taken to make sites available during the planning period with appropriate zoning and development standards and with services and facilities to accommodate that portion of the city’s or county’s share of the regional housing need for each income level that could not be accommodated on sites identified in the inventory completed pursuant to paragraph (3) of subdivision (a) without rezoning, and to comply with the requirements of Government Code section 65584.09. Sites shall be identified as needed to facilitate and encourage the development of a variety of types of housing for all income levels, including multifamily rental housing, factory-built housing, mobilehomes, housing for agricultural employees, supportive housing, single-room occupancy units, emergency shelters, and transitional housing. (Gov. Code, § 65583, subd. (c)(1).) As noted in Finding A-2, the element does not include a complete site analysis, therefore, the adequacy of sites and zoning were not established. Based on the results of a complete sites inventory and analysis, the City may need to add or revise programs to address a shortfall of sites or zoning available to encourage a variety of housing types. In addition, the element should be revised as follows: Replacement Housing Requirements: The housing element must include a program to provide replacement housing. Non-vacant sites identified in the sites inventory with existing, vacated, or demolished residential uses and occupied by, or subject to an affordability requirement for, lower-income households within the last five years, require a replacement housing program for units affordable to lower-income households (Gov. Code, § 65583.2, subd. (g)(3)). Absent a replacement housing program, these sites are not adequate sites to accommodate lower-income households. The replacement housing program must adhere to the same requirements as set forth in Government Code section 65915, subdivision (c)(3). Sites Identified in Multiple Planning Periods: The element must include a program for vacant sites identified in two of more consecutive planning periods’ housing elements or non-vacant sites identified in a prior housing element, that are currently identified to accommodate housing for lower-income households. The program must be implemented within the first three years of the planning period and commit to zone for the following: x sites must meet the density requirements for housing for lower income households, and x allow by-right approval for housing developments that include 20 percent or more of its units affordable to lower income households (Gov. Code, § 65583.2, subd. (c).). Program 4.5: The City’s strategy to accommodate lower-income RHNA relies heavily on mixed-use sites. Program 4.5 should be revised to quantify the number of mixed- use projects the City hopes to incentivize through program actions and expedite project reviews. Packet Page 286 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 6 September 4, 2020 Program 8.18 (zoning for a variety of housing types): The program proposes to amend zoning “if necessary” to facilitate a variety of housing types. However, based on analysis in the element, these zoning amendments are necessary, and the conditional language should be removed from the program. 2. Address and, where appropriate and legally possible, remove governmental and nongovernmental constraints to the maintenance, improvement, and development of housing, including housing for all income levels and housing for persons with disabilities. The program shall remove constraints to, and provide reasonable accommodations for housing designed for, intended for occupancy by, or with supportive services for, persons with disabilities. (Gov. Code, § 65583, subd. (c)(3).) As noted in Finding A-3 the element requires a complete analysis of potential governmental constraints. Depending upon the results of that analysis, the City may need to revise or add programs and address and remove or mitigate any identified constraints. In addition: Program 2.6: Program 2.6 commits to reviewing policies and standards annually to identify potential constraints to the development and preservation of affordable housing. The program should be revised to include a commitment for mitigation and/or removal of identified constraints within a specific timeframe when constraints are identified. Program 6.13: Program 6.13 commits the City to general plan amendments and rezoning as projects are proposed on 12 specific sites. However, the program limits actions to accommodate only two rezones per year. Limiting the number of rezones and placing the burden on applicants is a constraint that must be addressed. The program must be revised to eliminate any annual caps on rezoning and should not rezone only when a project is proposed. Program 8.23: Program 8.23 should be revised to clarify compliance with the Employee Housing Act, Health and Safety Code sections 17021.5 and 17021.6. For example, local zoning should allow single family uses for six or fewer employees in all zones allowing single family uses, not limited to zones allowing High Occupancy Residential Uses. Policy 10.2: Policy 10.2 indicates the City’s interest in giving preference to individuals employed in the geographic area, individuals residing in the County, and lastly, individuals from outside of the County. This policy potentially erects barriers and prevents access to housing opportunities, particularly to individuals from outside of the City, and should be removed. Program 10.4: Program 10.4 commits the City to work with developers to include restrictions in Covenant Codes and Restriction’s requiring for-sale properties to be restricted to owner-occupants for the first 5 years after sale. Given the shortage of housing for students and other special-needs groups. The element should include Packet Page 287 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 7 September 4, 2020 analysis describing why the actions are needed. In addition, the program should commit to monitoring its impacts as a constraint on the availability of housing in the City. If a constraint is identified, the program should also commit to mitigating the constraint by a specific date. 3. The housing element shall include programs to conserve and improve the condition of the existing affordable housing stock. (Gov. Code, § 65583, subd. (c)(4).) As noted in Finding A-1 the element requires a complete analysis of housing conditions. Depending upon the results of that analysis, the City may need to revise or add programs to address identified needs. In addition: Program 1.5: Program 1.5 commits to improving “at least one” unsafe, unsanitary or illegal housing condition, barrier to accessibility, energy efficiency, or unsafe neighborhood annually. Given the severity of need in the City, the program should be revised to commit greater assistance to households and could target some of its funding toward lower-income households. Program 1.6: Program 1.6 commits to code enforcement actions to expedite the removal of illegal or unsafe dwellings, to eliminate hazardous site or property conditions, and to resolve chronic building safety problem. The program should be revised to include enforcement officers provide a list of potential resources to homeowners when violations are cited. 5. Promote and affirmatively further fair housing opportunities and promote housing throughout the community or communities for all persons regardless of race, religion, sex, marital status, ancestry, national origin, color, familial status, or disability, and other characteristics protected by the California Fair Employment and Housing Act (Part 2.8 (commencing with Section 12900) of Division 3 of Title 2), Section 65008, and any other state and federal fair housing and planning law. (Gov. Code, § 65583, subd. (c)(5).) Reasonable Accommodation: The element describes the City currently has a procedure for requesting and granting a reasonable accommodation to zoning and land use requirements for persons with disabilities. To affirmatively further fair housing, the element could include a program to provide outreach and education on the availability of the reasonable accommodation procedure. For additional information, see the Building Blocks at http://www.hcd.ca.gov/community-development/building- blocks/constraints/constraints-for-people-with-disabilities.shtml . Fair Housing: The element must demonstrate how fair housing complaints are resolved and how fair housing information is disseminated in a variety of locations throughout the City or include a program to do so. For example, the program could: x Contract with the Fair Housing Council to provide fair housing services to its residents and property owners Packet Page 288 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 8 September 4, 2020 x Distribute educational materials to property owners, apartment managers, and tenants every two years; x Make public service announcements through different media (e.g., newspaper ads and public service announcements at local radio and television channels) at least two times a year; and x Conduct public presentations with different community groups. For additional information and a sample program, see the Building Blocks at http://www.hcd.ca.gov/community-development/building-blocks/program- requirements/equal-housing-opportunity.shtml . Affirmatively Further Fair Housing: The element must include actions that promote and affirmatively furthering fair housing opportunities. For example, the element could include a program committing to implement Government Code section 8899.50(b) which requires the City to administer its programs and activities relating to housing and community development in a manner to affirmatively further fair housing and take no action that is materially inconsistent with its obligation to affirmatively further fair housing (Gov. Code, § 65583, subd. (c)(5).) For your information pursuant to Government Code section 8899.50 “Affirmatively furthering fair housing” means taking meaningful actions, in addition to combating discrimination, that overcome patterns of segregation and foster inclusive communities free from barriers that restrict access to opportunity based on protected characteristics. Specifically, affirmatively furthering fair housing means taking meaningful actions that, taken together, address significant disparities in housing needs and in access to opportunity, replacing segregated living patterns with truly integrated and balanced living patterns, transforming racially and ethnically concentrated areas of poverty into areas of opportunity, and fostering and maintaining compliance with civil rights and fair housing laws. The duty to affirmatively further fair housing extends to all public agency’s activities and programs relating to housing and community development.” D. Quantified Objectives Establish the number of housing units, by income level, that can be constructed, rehabilitated, and conserved over a five-year time frame. (Gov. Code, § 65583, subd. (b) (1 & 2).) The element must include quantified objectives to establish an estimate of housing units by income category that can be constructed, rehabilitated, and conserved over the planning period. While the element includes objectives for new construction and units at-risk of conversion to market rate uses, it must also include rehabilitation objectives and additional conservation objectives (e.g. rental inspections, mobilehomes, replacement requirements). Packet Page 289 Item 16 City of San Luis Obispo’s 6th Cycle (2020-2028) Draft Housing Element 9 September 4, 2020 E. Public Participation Local governments shall make a diligent effort to achieve public participation of all economic segments of the community in the development of the housing element, and the element shall describe this effort. (Gov. Code, § 65583, subd.(c)(8).) While the element includes a general summary of the public participation process (Appendix G), it must also demonstrate diligent efforts were made to involve all economic segments of the community in the development of the housing element. The element includes a list of stakeholders that were invited to participate in the housing element update. However, the list did not demonstrate diligent effort to reach out to all economic segments of the community. While the City engaged many organizations, it should also include groups representing special-needs populations and consider and respond to comments received by HCD. During the period between the date of this review letter and the adoption of the final housing element, the City should continue its diligent public participation efforts to include all economic segments of the community. The element should be updated to describe additional efforts to circulate the revised housing element among low- and moderate-income households and organizations that represent them and consider and respond to comments received by HCD. In addition, the element should also summarize additional public comments and describe how they were considered and incorporated into the element. For additional information, see the Building Blocks at http://www.hcd.ca.gov/community- development/building-blocks/getting-started/public-participation.shtml. Packet Page 290 Item 16 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, TO RESOLVE THAT THE CITY OF SAN LUIS OBISPO COMMITS TO SAN LUIS OBISPO BEING A SAFE, INCLUSIVE AND WELCOMING COMMUNITY FOR EVERYONE AND TO FACILITATE VOLUNTARY CITIZEN ACTION TO REDACT OR REPUDIATE RACIST AND DISCRIMINATORY VERBIAGE FROM THEIR PROPERTY DEEDS WHEREAS,the Declaration of Independence defined the United States of America as a democracy based on the unalienable rights of life, liberty and the pursuit of happiness, and government by the consent of the people; and the 14th Amendment instilled equality of the races into the US Constitution; and WHEREAS, the City of San Luis Obispo will steadfastly strive to ensure that they are not, either consciously or unconsciously, engaging in any form of discrimination. This takes vigilance and a willingness to monitor and review numerical data, policies, practices and decision-making processes and organizational culture. It is not acceptable from a human rights perspective for an organization to choose to remain unaware of discrimination or to fail to act when a problem comes to its attention; and WHEREAS, in alignment with the goal of creating a safe and welcoming community, the City of San Luis Obispo values human rights, peace, respect, inclusivity and equity; and WHEREAS, the City Council of San Luis Obispo, recognize and acknowledge, as representatives of the City of San Luis Obispo, that various deeds throughout the City included a common but morally repugnant clause excluding all non-white races from ownership of the property covered by the deed; and WHEREAS, in 1948, the U.S. Supreme Court ruled such restrictions were unconstitutional, yet the restrictive language has regrettably been preserved due to the need to maintain historical continuity of the records; and WHEREAS, the City Council wants to proclaim for the public record that the City of San Luis Obispo will not tolerate racial bias, and welcomes warmly and without reservation neighbors of all races and ethnicities in our community. NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo that: SECTION 1.The City Council is committed to San Luis Obispo being a welcoming, inclusive, and safe community for everyone. While we promote free thought and speech, we condemn racism and brutality, hate speech, bigotry, violence, and prejudice in any form. Packet Page 291 Item 16 Resolution No. _____ (2020 Series) Page 2 R ______ SECTION 2.the City of San Luis Obispo wants to go on record that our City repudiates historical racial restriction on ownership, and deeply regrets that it was once considered acceptable. We also proclaim for the public record that the City of San Luis Obispo welcomes warmly and without reservation neighbors of all races and ethnicities in our community. SECTION 3.The City Council shall encourage and inform San Luis Obispo landowners of the ability to redact illegal verbiage in existing property deeds, or to acknowledge the clause excluding all non-white races from ownership of property and to repudiate the clause, stating that we welcome with enthusiasm and without reservations neighbors of all races and ethnicities. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of _____________________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, this ______ day of ______________, _________. ____________________________________ Teresa Purrington City Clerk Packet Page 292 Item 16 Recording Requested By When recorded mail document to Above Space for Recorder’s Use Only RESTRICTIVE COVENANT MODIFICATION I (We) have an ownership interest of record in the property located at ________________________________________ that is covered by the document described below. The following referenced document contains a restrictive covenant based on race, color, religion, sex, familial status, marital status, disability, national origin, source of income as defined in subdivision (p) of Section 12955, or ancestry that violates state and federal fair housing laws and that restriction is void. Pursuant to Section 12956.2 of the Government Code, this document is being recorded solely for the purpose of eliminating that restrictive covenant as shown on page(s)______________ of the document recorded on _______________ (date) In book ____________ and page__________ , or Document No. __________________________ of the Official records of the County of___________________________________________ , State of California. The document referenced above was originally indexed in the following manner and this document shall be indexed in like manner pursuant to Section 12956.2 (e). The effective date of the terms and conditions of this modification document shall be the same as the effective date of the original document referenced above. Dated Printed Name(s) A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. STATE OF CALIFORNIA } COUNTY OF } On before me, , a Notary Public, personally appeared who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/their/her authorized capacity(ies), and that by his/her/their signatures(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature Packet Page 293 Item 16 Page intentionally left blank. Packet Page 294 Item 16 Department Name: Community Development Cost Center:4003 For Agenda of:November 17, 2020 Placement:Public Hearing Estimated Time:60 minutes FROM: Michael Codron, Community Development Director Prepared By:John Rickenbach, Contract Planner SUBJECT:SPECIFIC PLAN AMENDMENT AND VESTING TENTATIVE TRACT MAP (VTTM 3142) FOR AN 11.44-ACRE NC-ZONED LOCATED IN THE SAN LUIS RANCH SPECIFIC PLAN; 1035 MADONNA ROAD (SPEC-0172-2020; SBDV-0173-2020) RECOMMENDATION As recommended by the Planning Commission, adopt a Resolution entitled “amending the San Luis Ranch Specific Plan and approving a Vesting Tentative Tract Map (VTTM 3142) based on findings and subject to conditions of approval. REPORT-IN-BRIEF The applicant, MI San Luis Ranch, LLC, has proposed a Specific Plan Amendment (SPA) and Vesting Tentative Tract Map (VTTM 3142) that would facilitate future commercial and residential development within an 11.44-acre portion of the Neighborhood Commercial (NC) zone of the San Luis Ranch Specific Plan (SLRSP). The Planning Commission recommended approval of the proposed project on September 23, 2020. The SPA would allow for 64-77 affordable housing units to be built within the NC zone of the SLRSP. 26 of the units within the project would replace the requirement for the same number of deed-restricted units within VTTM 3150, the 296-unit multi-family component of the SLRSP that was approved by the Planning Commission on March 11, 2020. VTTM 3142 would implement the proposed SPA and provide a framework for future development in that 11.44-acre area. It would subdivide Lot 7 (the commercially zoned land) from VTTM 3096, which is the main subdivision that covers the entire Specific Plan area. The Final Map for VTTM 3096 was approved in November 2018. The proposed VTTM would establish 11 parcels ranging from 0.30 to 2.77 acres in size to accommodate development within the NC-zoned area, with one lot being for the residences, and the other 10 for commercial uses with up to 114,300 SF of commercial development. Future development on the lots to be created in the NC zone within the VTTM will require a separate entitlement to permit the building design and proposed uses. Application materials associated with these actions are included as Attachment B. Packet Page 295 Item 17 DISCUSSION The following summarizes the proposed project: Specific Plan Amendment: 1. Increase the number of allowed residential units in the SLRSP from 580 to 654. This would allow for up to 77 affordable units within the NC area as part of a mixed use development (it also acknowledges that the previously-approved NG-30 MFR project in the SLRSP decreased its development potential from 299 to 296 units). Various references and tables with the SP would be updated. The current SP does not consistently acknowledge the requirement that the commercial development within the NC zone of the SLRSP must provide 34 units of affordable housing, meaning the actual current requirement is 580 + 34, or 614 total units. As described above, the affordable units in the NC zone would also address the affordability requirement for 26 of the previously- approved multi-family units in the NG-30 zone for a minimum of at least 60 affordable housing units (approved March 11, 2020); 2. Update the Design Guidelines for the Neighborhood Commercial site to address a potential horizontal and vertical mixed-use project; 3. Update the allowed level of commercial development to 139,300 SF (114,300 SF in the NC area and 25,000 in the Ag Center area), a decrease from 150,000 SF; 4. Update the allowed level of office development to 97,000 SF, a decrease from 100,000 SF; and 5. Amend the Community Garden location from Lot 7 Tract 3096 as shown on page 3-20 of SLRSP to the Farm on Lot 10 of Tract 3096; the Community Garden would be of equal or greater size. Vesting Tentative Tract Map 3142: 1. Subdivision of 11.44-acre Lot 7 of Tract 3096 into 11 parcels to accommodate a future proposal for commercial-retail pads and horizontal mixed-use to include the affordable housing site with parcels ranging in size from 0.30 acres to 2.77 acres; 2. Establish grading, drainage, utilities and storm water requirements for approximately 114,300 SF of retail and up to 77 Affordable housing units; and 3. Abandon and dedicate new right-of-way to conform with realignment of bus stop at Dalidio Drive immediately adjacent to Lot 7 of Tract 3096. Figure 1 shows the proposed lot boundaries within the VTTM. Although no Development Plan is proposed at this time, the application includes an illustrative site plan (Figure 2) to help visualize how the project could be implemented based on the boundaries of the proposed VTTM and in the context of the Specific Plan Amendment. This figure is not a Development Plan but may be useful to the Planning Commission as it conducts its review of the VTTM. Packet Page 296 Item 17 Figure 1: VTTM 3142 – Proposed Lot Layout Figure 2: Illustr ative Site Plan Packet Page 297 Item 17 Table 1 summarizes the key proposed project components, and a comparison to what is currently allowed under the approved San Luis Ranch Specific Plan: Table 1. Proposed Project Features and Consistency with Requirements Site Details Proposed Existing SLRSP Requirement Land Use Designation NC NC Commercial SF 114,300 SF (in NC under the amended SLRSP and VTTM) 25,000 SF (in AG under the SLRSP) 150,000 SF (LUE calls for a range of 50,000 to 200,000 SF) Office SF 97,000 SF 100,000 SF (LUE calls for a range of 50,000 to 150,000 SF) Residential Units 654 (77 within the NC zone) 580 (does not include 34 inclusionary units required as part of NC development) Environmental Status An Addendum was prepared to address potential changes associated with the application and finds the SPA and VTTM is consistent with the certified Final EIR and Supplemental Final EIR for San Luis Ranch Specific Plan. Background The intent of the specific plan amendment is to allow for additional affordable housing which will range from 64-77 units within the NC-zoned area, and would increase the number of units allowed within the entire Specific Plan area by 74 units overall, from 580 to 654. Under the approved Specific Plan, the commercial development in the NC zone was required to either develop or provide in lieu fees for 34 affordable housing units beyond the 580 units approved as part of the Specific Plan. On March 11, 2020, the Planning Commission approved a 296-unit multi-family residential development within the NG-30 portion of the Specific Plan (Resolution PC-1006-20; Attachment G), which included 26 deed-restricted units affordable to very-low income households. As part of their approval, they supported the concept of transferring the affordability requirement of those 26 units to a consolidated residential development in the NC zone, to combine with a possible future mixed use development project in the NC zone that could also include the 34 units required as part of the commercial development, for a minimum of at least 60 affordable housing units within the NC zone. If that occurred, those 26 units in the NG-30 zone would be sold as market rate units. The proposed Specific Plan Amendment is intended to facilitate this Planning Commission-supported concept. As proposed, the project is expected to deliver at least four and potentially up to 17 additional very-low income housing units. The reason for the range is that the buildings have not been designed yet and will ultimately have to compete for tax credits to ensure that all of the funding is available for construction. Currently, People’s Self-Help Housing Corporation (PSHHC) is the intended developer of the affordable housing project. Packet Page 298 Item 17 The VTTM would subdivide Lot 7 (the commercially zoned land) from VTTM 3096, the main subdivision that covers the entire Specific Plan area. The Final Map for VTTM 3096 was approved in November 2018. The proposed VTTM would establish 11 parcels ranging from 0.30 to 2.77 acres in order to accommodate development within the NC-zoned area, with one lot being for the residences, and the other 10 for commercial uses up to 114,300 SF of commercial development. Future development on the lots to be created in the NC zone within the VTTM will require a separate entitlement. In August 2020, an Addendum to the certified Final EIR for the SLRSP was prepared to evaluate possible impacts associated with revised mitigation requirements that would result from a revised development pattern as described above. The proposed action is consistent with the certified Final EIR and certified Supplemental Final EIR for San Luis Ranch Specific Plan, when considered in conjunction with that Addendum. (Attachment D). Previous Council or Advisory Body Action The City Council approved the San Luis Ranch Specific Plan in July 2017, which formed the basis for various subsequent applications within the Specific Plan area, including the one currently proposed. On September 23, 2020, the Planning Commission recommended approval of the proposed SPA and VTTM to the City Council (Attachment E, PC Resolution No. PC-10222020 and meeting minutes, Attachment F), with the following recommendations to be carried forward in a future Development Plan application pursuant to an approved SPA and VTTM: x Ensure that compatible design considerations are included for Lot 4 adjacent to the affordable housing; x Ensure the loading/unloading area doesn’t infringe on the residential parking area for the affordable housing; x Install a masonry wall instead of a wood fence and a 5 foot landscape buffer between the parking lot for lot 11 and the adjacent single family (NC-23) housing area to the south; x Consider adding a pedestrian crossing of Dalidio Drive mid-block between the traffic circle and Madonna Road; and x Bike parking for Lot 11 should include charging stations for e-bikes and parking for large bikes, such as cargo bikes. Related to the issue of affordable housing, the Planning Commission had previously reviewed and approved the Development Plan for the Multi-Family (NG-30) site of the San Luis Ranch Specific Plan (Attachment G, PC Resolution No. PC-1006-2020). In the review of the multi-family site, the Commission supported the concept of moving the affordable units on the NG-30 site to a location within the NC zone with the potential of a significant increase in the amount of affordable units. Condition 15.B. in the Resolution states the following, which would support the project as currently proposed in the NC zone: “The Base Inclusionary Housing Requirement [for the NG-30 project] may be modified by the Community Development Director in the event that an application for an Affordable Housing Project on the NC portion of the San Luis Ranch Specific Plan area is approved providing for at least the same number (26) very low income affordable housing units currently proposed for the multi-family site, in addition to the 34 very low income affordable housing units already required on the NC site through previous project entitlements.” Packet Page 299 Item 17 This SPA and VTTM are consistent with and provide for implementation of the relocation and increase in the number of affordable units. The Airport Land Use Commission (ALUC) reviewed the project on October 21, 2020. The ALUC found that the project revisions would not change the previous determination that the San Luis Ranch Specific Plan is consistent with the ALUP. Policy Context The proposed specific plan amendments and VTTM would further Housing Element goals by providing a feasible affordable housing opportunity in a mixed-use project in proximity to commercial development and nearby amenities. The attached Context Policy Analysis (Attachment H) includes a detailed General Plan evaluation of the proposed amendments. Subdivision Regulations In addition to the Specific Plan Amendment, the project includes a subdivision. The applicant has proposed a commercial common interest 11-lot subdivision with shared use of common parking areas and access. The subdivision component of the project (proposed VTTM 3142) requires a PC recommendation and final approval by the City Council. The VTTM provides for 11 lots total, with 10 commercial and 1 residential lot. The applicant’s illustrative site plan (Figure 2 above and Attachment 3) depicts the anticipated development of the commercial parcels and affordable housing development for the proposed horizontal mixed-use project. A future development plan approval will be required to review proposed building designs and final site plans for the residential lot and commercial development within the VTTM. Public Works has provided conditions of approval for final map requirements on public and private easements needed for access, parking, utilities, and drainage and final details that will be required at the time of development plan review. Subsequent ARC and PC Development Review Requirements The SPA and VTTM would direct future development within the NC-zoned area. However, a Development Plan with detailed information about building locations, circulation, parking, landscaping, lighting, and building design would be required to implement that development. Consistent with City requirements, the Development Plan application would be required to undergo Major Project Review, which includes Architectural Review Commission review and recommendation to the Planning Commission for final approval. Public Engagement As noted under “Previous Council or Advisory Body Action”, the SLRSP was approved by the City Council in July 2017, and the Planning Commission recommended approval of the proposed SPA and VTTM in September 2020. The Planning Commission and City Council hearings were noticed in the newspaper and notification was provided by mail to all occupants and owners within 300 feet of the project boundaries in accordance with City adopted procedures and the Government Code. Packet Page 300 Item 17 CONCURRENCE The City’s review of the SPA and VTTM involved all City departments in the development review process. Various conditions of approval from these departments were included in the Resolution related to the VTTM, based on those conditions set forth in the Planning Commission Resolution related to this action. ENVIRONMENTAL REVIEW The project, including the SPA, VTTM and development facilitated by those actions, is consistent with the certified Final Environmental Impact Report (FEIR) for SLRSP (July 2017) and Final Supplemental EIR (July 2018). In August 2020, an Addendum to the certified Final EIR for the SLRSP was prepared to evaluate possible impacts associated with revised mitigation requirements that would result from a revised development pattern as described above (Attachment D). The Addendum was approved by the City Council on August 18, 2020, per Resolution 11157, with appropriate CEQA Findings. The Addendum considered development with up to 654 units within the Specific Plan (consistent with what is now proposed) and found that impacts would not exceed those considered in the original certified Final EIR and Supplemental Final EIR. All mitigation measures adopted as part of the SLRSP FEIR and FSEIR that are applicable to the proposed project are carried forward and applied to the proposed project to effectively mitigate the impacts that were previously identified. Minor modifications to two transportation mitigation measures were included in the Addendum, which will not affect any actions being considered in the SPA and VTTM. FISCAL IMPACT Budgeted: NA Budget Year: NA Funding Identified: NA Fiscal Analysis: Funding Sources Current FY Cost Annualized On-going Cost Total Project Cost General Fund n/a State Federal Fees Other: Total NA There will be no net fiscal impact related to approving the SPA and VTTM. A Development Agreement that covers all development within the SLRSP was approved in 2018, and a Community Facilities District (CFD) was subsequently approved by the City Council in order to help facilitate the construction of required infrastructure as development occurs under the SLRSP. The proposed VTTM is consistent with and implements a portion of the SLRSP and Development Agreement. No previously unanticipated fiscal impacts would occur as a result of this action. Packet Page 301 Item 17 ALTERNATIVES 1.Approve the project.An action to introduce an Ordinance and adopt the Resolution as proposed, or with modifications to findings or project conditions. 2.Continue project.An action to continue the items should include a detailed list of additional information or analysis required. 3.Deny the project.An action denying the application should include findings that cite the basis for denial and should reference inconsistency with the General Plan, SLRSP, Zoning Regulations, Subdivision Regulations or other policy documents. Attachments: a - Draft resolution SPA and VTTM approval b - Project Application Materials (including SPA and VTTM) c - Applicant project statement d - CEQA Addendum and City Council Resolution of August 18, 2020 e - PC Resolution - September 23, 2020 f - 9-23-2020 PC meeting minutes g - Council Reading File - PC Resolution No. PC-1006-2020, March 11, 2020 h - Policy Context Analysis Packet Page 302 Item 17 R _________ RESOLUTION NO. XXXXX (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, APPROVING A SPECIFIC PLAN AMENDMENT FOR THE SAN LUIS RANCH SPECIFIC PLAN, IN ORDER TO ALLOW UP TO 139,300 SF OF COMMERCIAL, 97,000 SF OF OFFICE, AND 654 RESIDENTIAL UNITS WITHIN THE PLAN AREA, AND TO UPDATE OTHER ASPECTS OF THE SPECIFIC PLAN TO ACCOMMODATE THIS DEVELOPMENT; APPROVAL OF VESTING TENTATIVE TRACT MAP 3142 WITHIN PREVIOUSLY APPROVED VESTING TENTATIVE TRACT MAP 3096 TO CREATE 11 LOTS IN THE NC ZONE OF THE SAN LUIS RANCH SPECIFIC PLAN, FOR THE COMMERCIAL, OFFICE, AND RESIDENTIAL UNITS WITHIN THESE LOTS, AS ALLOWED UNDER THE SPECIFIC PLAN AMENDMENT; AND A DETERMINATION THAT THE PROJECT IS CONSISTENT WITH THE CERTIFIED FINAL EIR AND FINAL SUPPLEMENTAL EIR FOR SAN LUIS RANCH SPECIFIC PLAN WHEN CONSIDERED IN CONJUNCTION WITH AN ADDENDUM APPROVED BY THE CITY COUNCIL ON AUGUST 18, 2020; AS REPRESENTED IN THE AGENDA REPORT AND ATTACHMENTS DATED NOVEMBER 17, 2020 (1035 MADONNA ROAD, SPEC-0172-2020; SBDV-0173-2020) WHEREAS,the Planning Commission of the City of San Luis Obispo conducted a public hearing on September 23, 2020, pursuant to a proceeding instituted under SPEC-0172-2020 and SBDV-0173-2020, MI San Luis Ranch, LLC, applicant; and WHEREAS,the Planning Commission of the City of San Luis Obispo recommended approval of the Specific Plan Amendment as conditioned pursuant to said application; and WHEREAS,the City Council of the City of San Luis Obispo conducted a public hearing on November 17, 2020, pursuant to a proceeding instituted under SPEC-0172-2020 and SBDV- 0173-2020, MI San Luis Ranch, LLC, applicant; WHEREAS,the City Council of the City of San Luis Obispo has duly considered all evidence, including the testimony of the applicant, interested parties, and evaluation and recommendations by staff, presented at said hearing; and WHEREAS,notices of said public hearings were made at the time and in the manner required by law; and NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of San Luis Obispo as follows: SECTION 1.Findings. The City Council hereby approves the project (SPEC-0172-2020 and SBDV-0173-2020), based on the following findings: Packet Page 303 Item 17 Resolution No. XXXXX (2020 Series) Page 2 R _________ 1. The proposed amendment to the San Luis Ranch Specific Plan (SLRSP) is consistent with the intent of the General Plan because it will not result in additional impacts beyond those anticipated in the 2014 Land Use and Circulation Elements (LUCE) Final EIR, and because additional affordable housing allowed under the SPA would implement Housing Element goals. 2. The Specific Plan Amendment (SPA) is intended to ensure internal consistency, to clarify existing design guidelines, and to allow for more implementable mixed-use development consistent with the intent of both the General Plan and originally adopted Specific Plan. 3. The SPA does not substantively change the policy framework or overall land use or circulation pattern envisioned in the originally adopted Specific Plan. 4. The SPA would facilitate a Vesting Tentative Tract Map (VTTM)for horizontal mixed- use development within the NC zone of the SLRSP, consistent with the SPA as amended. 5. The SPA would allow for more logical and implementable location for a future Community Garden, which would now be located within the Agriculture (AG) zone of the SLRSP, in conjunction with the Agricultural Heritage Center. 6. The proposed VTTM is consistent with the General Plan and SLRSP as amended because the proposed subdivision implements goals for affordable housing, commercial and office development in the plan area. 7. The site is physically suited for the type and density of development allowed in the NC zone of the SLRSP, subject to approval of a future Development Plan for this area, subject to architectural review and possible conditions of approval related to that Development Plan; resulting development will be subject to consistency with the development standards of the SLRSP, Community Design Guidelines, and Zoning Regulations. 8. The VTTM will not conflict with easements for access through (or use of property within) the proposed subdivision since all parcels will have adequate access from Dalidio Drive as proposed for extension through the SLRSP, and the underlying project where condominium units will be created is consistent with the circulation pattern and planned accessways as envisioned within the SLRSP of which this project is a component. 9. The SPA and VTTM are not likely to cause serious health problems, substantial environmental damage, or substantially and unavoidably injure fish or wildlife or their habitat because the subdivision would be sufficiently setback from creeks or other potentially significant habitat areas for fish and wildlife, is surrounded by urban development, and is planned for further urban development consistent with the approved SLRSP and Final EIR, Final Supplemental EIR and Addendum for that project. Packet Page 304 Item 17 Resolution No. XXXXX (2020 Series) Page 3 R _________ SECTION 2.Environmental Review. The project is consistent with the certified Final Environmental Impact Report (FEIR) for SLRSP under the California Environmental Quality Act (CEQA) in conjunction with an Addendum prepared pursuant to CEQA Guidelines 15164, which was approved through City Council Resolution 11157 on August 18, 2020. On July 18, 2017, the City Council certified the FEIR for the SLRSP and approved the SLRSP through Council Resolution 10822 (2017 Series). A Final Supplemental EIR to address modifications to the phasing plan within the SLRSP was certified by the City Council on July 17, 2018, through Council Resolution 10927 (2018 Series). All mitigation measures adopted as part of the SLRSP FEIR, FSEIR and Addendum that are applicable to the proposed project are carried forward and applied to the proposed project to effectively mitigate the impacts that were previously identified. SECTION 3.Action. The project conditions of approval do not include mandatory code requirements. Code compliance will be verified during the plan check process, which may include additional requirements applicable to the project. The Planning Commission hereby recommends final approval to the City Council of the SPA and VTTM with the incorporation of the following conditions: Planning Division 1. The project shall comply with all mitigation measures and conditions applicable to the project site, as established under City Council Resolutions No. 10822 (2017 Series), No. 10927 (2018 Series), and No. 11157 (2020 Series). Engineering Division –Public Works/Community Development Department 2. Park improvement fees shall be paid at the time of map recordation unless otherwise approved for deferral by the Community Development Director for some or all of the proposed lots. If deferred to development, a separate Notice of Requirements may be required. 3. The subdivision shall be recorded with a final map. The map preparation and monumentation shall be in accordance with the City’s Subdivision Regulations, Engineering Standards, and the Subdivision Map Act. The map shall use U.S. Customary Units in accordance with the current City Engineering Standards. A separate application, checklist, and final map review fee shall be paid at the time of final map processing. 4. The map for Tract 3096 shall be recorded prior to or concurrent with this Vesting Tentative Map. All pertinent conditions and mitigation measures for Tract 3096 are applicable to this map. The map and related improvement plans shall be in agreement with the parent Tract 3096 approvals or the Tract 3096 improvement plans, and construction shall be amended to agree with the proposed development on this Lot 7. 5. The final map shall show and note all existing and proposed easements and offers of dedication. The noted areas of additional right-of-way dedication and right-of-way abandonment noted on VTM sheet C2 are supported and have been included in this VTM processing. The extent and limits of the new offer(s) of dedication and abandonments shall Packet Page 305 Item 17 Resolution No. XXXXX (2020 Series) Page 4 R _________ be confirmed with the approved subdivision improvement plans for Tract 3096 and/or any as-built construction. The developer shall confirm to the satisfaction of all potentially affected utility companies that all wire utilities and appurtenances are not located within the former PUE to be adjusted. 6. The final map shall show and note all public and private easements including but not limited to those needed for access, parking, utilities, drainage, and yards. Said easement may be provided in part or in total as blanket easements. 7.An easement agreement, CCR’s, or other document shall be approved to the satisfaction of the City to cover the use and maintenance of the several easements and related improvements. 8. The development plans shall show and note compliance with the City Standards, Design Guidelines, and policies in effect at the time of development plan submittal. 9. The development plans and supporting documents shall show and note compliance with the City’s Drainage Design Manual, Post Construction Stormwater Regulations, and the master drainage report for Tract 3096. 10. A drainage facility Operation and Maintenance Manual will be required with development plan submittals. A recorded agreement referencing the maintenance and reporting requirements will be required in conjunction with the building permit submittal(s). 11. The development plan shall show the minimum width for the multi-use path/pedestrian and bicycle easement and proposed improvement. The plans shall show and note compliance with City and Bike Plan Standards unless a reduced width is specifically approved by the City. If a minimum width of 8’ is supported, the plans shall show and label the required 2’ shoulder on either side of the path. The map shall amend all easements, plans, and sections accordingly. The final bike route, corner radii, width, lighting, signing and striping, etc. shall be approved to the satisfaction of the Transportation Division. 12. The development plans shall include all existing and proposed site sections to include all pertinent detail within the noted section. Additional sections may be needed for clarity or to provide better detail on the interface with the existing and proposed Tract 3096 improvements. The sections shall be expanded to include the proposed/approved right-of- way improvements in both Section A and Section B. Include all drive aisles, landscape areas, and sound walls or fences accordingly. The grades beyond the section lines shall generally represent the approved grades in accordance the PIP’s for Tract 3096. Show and label the tract boundary on the sections. 13. The development plans shall include a more comprehensive landscape plan. The plan shall include additional information and clarification on the depth of cover over the detention system for the proposed parking lot planters. Plant and tree selections shall honor the available planting zone above the detention structure. Packet Page 306 Item 17 Resolution No. XXXXX (2020 Series) Page 5 R _________ 14. The final map submittal and development plans shall include an exhibit to show compliance with the California Building Code for building setbacks, eave overhangs, exterior wall protection, opening protection or limitations, and required exit paths/yards to the satisfaction of the Building Official/Fire Marshal. 15. The development plans shall show the proposed parking lot dimensions, driveway approach widths, bay and parking space dimension, loading/unloading zones, and truck circulation in accordance with the Parking and Driveway Standards. 16. The proposed solid waste management plan, strategy, placement, and volumes shall be acceptable to the Utilities Department and San Luis Garbage Company. The final site plan improvements and circulation aisles shall show conformance with the approved solid waste management strategy. 17. Separate utilities are required to each lot in accordance with the subdivision regulations unless specifically approved for deferral to development. If approved for deferral, a separate Notice of Requirements may be required in conjunction with the map recordation. 18. The development plans shall evaluate the existing and proposed public and private fire hydrant spacing and locations that serve the project. The location of the existing or additional public hydrants and the location of the private on-site hydrants shall be approved to the satisfaction of the Fire Department. Transportation 19. The development plans shall identify short-term and long-term bicycle parking consistent with City Zoning Regulations, City Engineering Standards, and the San Luis Ranch Specific Plan. Short-term bicycle parking shall use “Peak Style” racks unless otherwise approved by the Public Works Department. 20. The development plans shall identify pedestrian connectivity between the on-side pedestrian walkways and the sidewalks along the Dalidio Road and Froom Ranch Way frontages to the satisfaction of the Public Works Director. 21. Prior to recordation of the Final Map for Tract 3142, the Project Applicant shall submit public improvement plans to establish the proposed pedestrian/bicycle pathway connection between Tract 3142 and the adjacent residential street (Homestead Place). This connection must be completed prior to issuance of any occupancy permits for development within Tract 3142. Utilities Department 22. The construction plans for sewer and water services shall be in accordance with the engineering design standards in effect at the time the building permit is approved. Packet Page 307 Item 17 Resolution No. XXXXX (2020 Series) Page 6 R _________ 23. Any sewer lateral that crosses one proposed parcel for the benefit of another shall provide evidence that a private utility easement appropriate for those facilities has been recorded prior to issuance of a Building Permit. 24. Calculations for the proposed sewer generations based on Section 7 of the City’s 2018 Engineering Design Standards shall be included in the building permit submittal. 25. The proposed gravity sewer system shall use HDPE pipe, or an approved equal, that meets or exceeds the performance needed to eliminate groundwater infiltration and root intrusion. 26. If commercial uses in the project include food preparation, provisions for grease interceptors and FOG (fats, oils, and grease) storage within solid waste enclosure(s) shall be provided with the design. These types of facilities shall also provide an area inside to wash floor mats, equipment, and trash cans. The wash area shall be drained to the sanitary sewer. 27. A separate water meter shall be provided for each new parcel per Chapter 13.04.120 of the City’s Municipal Code. The City’s water meters must be placed per the Engineering Standards and the water service lateral feeding the meter shall be perpendicular to the City’s main. 28.The project’s commercial and residential uses shall be metered separately. All residential units are to be individually metered. Privately owned sub-meters may be provided for residential apartments upon approval of the Utilities Director. The CCR’s for the property/homeowner association shall require that the sub-meters be read by the association (or P/HOA contracted service) and each apartment billed according to water use. 29. Building permit submittal shall clarify size of existing and proposed water services and water meters for the project, including both potable and recycled water. 30. Water service meter(s) shall be adequately sized to serve the project’s proposed units. Residential units shall be separately metered from the non-residential/commercial units, and service lines shall adhere to the provisions of MC 13.04.120. 31. Non-potable water shall be used for major construction activities, such as grading and dust control as required under Prohibited Water Uses; Chapter 17.07.070.C of the City’s Municipal Code. 32. Water service laterals shall have backflow prevention per City Standards since recycled water use is proposed on site. 33.The project is within the recycled water service area and shall include a “purple pipe” irrigation system, and backflow preventer consistent with the Engineering Design Standards. Packet Page 308 Item 17 Resolution No. XXXXX (2020 Series) Page 7 R _________ 34. Projects generating more than two cubic yards of total waste shall comply with AB 1826, and local waste management ordinance to reduce greenhouse gas emissions. 35. Each trash enclosure shall include space for the three waste streams: trash, recycling, and organics. 36. A letter of agreement for shared trash collection services shall be provided identifying how each parcel will be served. 37. Commercial and residential refuse services shall be separate unless a letter of agreement between the tenants and a Conditional Exception Application from the City’s Development Standards for Solid Waste Services are provided to the City with the building permit submittal. 38. The project will be required to provide a plan for the disposal, storage, and collection of solid waste material for both the residential and commercial components of the project. The development of the plan shall be coordinated with San Luis Garbage Company. The plan must be submitted for approval by the City's Solid Waste Coordinator. Fire Department 39. All access roads less than 36 feet in width shall have restricted parking and posted as fire lanes. One side only where 28-36 feet in width, both sides where less than 28 feet. 40. City standard fire hydrants shall be installed, spaced so as not to exceed 300 feet to any exterior wall in the development. Indemnification 41. The applicant shall defend, indemnify and hold harmless the City and/or its agents, officers and employees from any claim, action or proceeding against the City and/or its agents, officers or employees to attack, set aside, void or annul, the approval by the City of this project, and all actions relating thereto, including but not limited to environmental review (“Indemnified Claims”). The City shall promptly notify the applicant of any Indemnified Claim upon being presented with the Indemnified Claim and the City shall fully cooperate in the defense against an Indemnified Claim. Upon motion of Councilmember _________, seconded by Councilmember ___________, and on the following roll call vote: AYES: NOES: ABSENT: RECUSED: The foregoing resolution was adopted this 17th day of November 2020. Packet Page 309 Item 17 Resolution No. XXXXX (2020 Series) Page 8 R _________ ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: ____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on this ________________ day of ____________________, 2020. ____________________________________ Teresa Purrington City Clerk Packet Page 310 Item 17 Packet Page 311Item 17 Packet Page 312 Item 17 Packet Page 313 Item 17 Packet Page 314 Item 17 Packet Page 315 Item 17 Packet Page 316 Item 17 SAN LUIS RANCH RETAIL DEVELOPMENTILLUSTRATIVE SITE PLAN# 1046-09-CO19JULY 1, 20201” = 40’-0” (24X36 SHEET)02040 801” = 80’-0” (12X18 SHEET)LOT 10COMMERCIAL0.61 ACRES LOT 9COMMERCIAL 1.27 ACRESLOT 8COMMERCIAL0.41 ACRES LOT 4COMMERCIAL1.67 ACRES LOT 1COMMERCIAL 2.77 ACRESLOT 2COMMERCIAL0.98 ACRES LOT 3COMM.0.49 ACRES LOT 7COMMERCIAL0.3 ACRESLOT 6COMMERCIAL0.32 ACRES LOT 5COMM.0.72 ACRESLOT 11AFFORDABLE HOUSING1.88 ACRES AFFORDABLE HOUSING AFFORDABLE HOUSING PARKING SECURE PARKING GATESECUREPARKING GATEAFFORDABLE HOUSING PARKING DRAINAGE EASMENTSINGLE FAMILY RESIDENTIAL LOTSTO HWY 101 OVERPASS CONNECTIONOPEN SPACESINGLE FAMILY RESIDENTIAL LOTSALUC NO BUILD ZONERESIDENTIAL ENTRY MONUMENT LOCATIONS.BICYCLE/PEDESTRIAN CONNECTIVITY TO NEIGHBORHOOD.CLASS 1 PATH.BICYCLE PATHPEDESTRIAN PATH.VIGNETTE VIEW LOCATION.PUBLIC TRANSIT STOP.SOLID FENCE - PROVIDES PRIVACY AND VISUAL SCREENING AT PROPERTY LINES BETWEEN RESIDENTIAL TYPES.MASONRY WALL - PROVIDES PRIVACY AND BOTH NOISE AND VISUAL SCREENING AT PROPERTY LINES BETWEEN COMMERCIAL AND RESIDENTIAL ZONESSHORT TERM BICYCLE PARKINGLEGENDBUILDING STATISTICSSITE AREA:11.44 ACRES (498,408 SF)MAX ALLOWED LOT COVERAGE:80% = 9.16 ACRES (399,010 SF)PROPOSED LOT COVERAGE:79.63% = 9.11 ACRES (8.49 ACRES = 369,881 SF IMPERVIOUS + 0.62 ACRES = 26,931 SF PERVIOUS)MIN LANDSCAPE/PLAZA COVERAGE:20% = 2.29 ACRES (99,752 SF)PROPOSED LANDSCAPE COVERAGE:20.37% = 2.33 ACRES (101,596 SF) > 2.29 ACRESCOMMERCIAL(RED):114,300 SFAFFORDABLE HOUSING (YELLOW):60-77 AFFORDABLE HOUSING UNITS27,000 SF FOOTPRINT - 3 STORY BLDG.7,700 SF OPEN SPACE (100 SF PER UNIT)COMMERCIAL PARKING:REQUIRED: 114,300/500 = 229 SPACESSEVEN SPACES SHALL BE ADA COMPLIANTBICYCLE PARKING REQ’D: 229*20% = 46 REQUIRED(35 SHORT TERM, 11 LONG TERM)PROVIDED:370 SPACES AND 8 ACCESSIBLE SPACES - 2 VAN (301+ SPACES = 8 REQ’D)BICYCLE PARKING (370*20%)*75% = 74 (60 SHORT TERM SPACES PROVIDED -14 LONG TERM SPACES INSIDE BUILDINGS - TENANT PROVIDES)AFFORDABLE HOUSING PARKING:1.0 PER UNIT REQUIRED: 77*1.0 = 77 SPACES +2 MANAGERIAL(DARKER GREY ON SITE PLAN) PROVIDED: 90 SPACES > 79 SPACES4 ACCESSIBLE SPACES- 1 VANREQUIRED BUILDING HEIGHT:MINIMUM 20’, MAXIMUM 50 FT.PROPOSED BUILDING HEIGHT:NO CHANGEREQUIRED SETBACKS:(NO PROPOSED CHANGE)MINIMUM COMMERCIAL LANDSCAPE BUFFER:5’ STREET FRONT0’ SIDE INTERIOR LOT0’ STREET SIDE CORNER LOT15’ PARKING10’ REAR6’ LANDSCAPE BUFFER FROM PUBLIC STREET (FROOM RANCH WAY & DALIDIO)AND 10’ ADJACENT TO RESIDENTIALPROVIDED LANDSCAPE BUFFER:15’ LANDSCAPE BUFFER FROM PUBLIC STREET (FROOM RANCH WAY & DALIDIO) AND ADJACENT TO RESIDENTIAL50’-0”50’-0” LANDSCAPE BUFFER EXISTING P.U.E. SETBACK 10-0” 15’-0”PED/BICYCLEPATHA2A17,700 SF OPEN SPACEPED/BICYCLEPATHPED/BICYCLEPATHCLASS 1 PATHCLASS 1 PATHCLASS 1 PATHCLASS 1 PATHDRAINAGE EASMENT BIKE PATHPacket Page 317Item 17 SAN LUIS RANCH COMMERCIAL# 1046-09-CO19JULY 1, 2020MIXED USE/AFFORDABLE & PASEO VIGNETTTEPacket Page 318Item 17 SAN LUIS RANCH COMMERCIAL# 1046-09-CO19JULY 1, 2020AFFORDABLE RESIDENTIAL ENTRY MONUMENT & WAYFINDINGPacket Page 319Item 17 SAN LUIS RANCH COMMERCIAL# 1046-09-CO19JULY 1, 2020MIXED USE AND COMMERCIAL PLAZA VIGNETTEPacket Page 320Item 17 COMMERCIAL/RESIDENTIAL BUFFER6’10’ YARDSETBACKLANDSCAPEBUFFERSIDEWALKPARKINGPARKINGTRAVEL LANESPARKING AND COMMERCIAL VEHICLE ACCESSCOMMERCIAL VEHICLE ACCESSCOMMERCIAL BUILDINGSINGLE FAMILY HOME BUILDING ENVELOPESINGLE FAMILY HOME60’6’7’20’7’34’10’ 15’10’10’SETBACK10’34’10’ 15’LANDSCAPE BUFFER10’ YARD SETBACKSIDEWALK5’ HIGH VERTICAL MASONRY WALL FOR PRIVACY, VISUAL/NOISE SCREENING AT PROPERTY LINESSAN LUIS RANCH June 22, 2020Scale: 1/8” = 1’-0”(on 11x17 sheet)02486’6’10’ MIN10’ MINPacket Page 321Item 17 SFR AND MFR BUFFER6’10’ YARDSETBACKSIDEWALKPARKINGLANDSCAPEBUFFERPARKINGTRAVEL LANESTRAVEL LANESSIDEWALKPARKINGPARKING5’ HIGH VERTICAL FENCE FOR VISUAL SCREENING AND PRIVACY AT PROPERTY LINESPARKINGMULTI-FAMILYBUILDINGSINGLE FAMILY HOME BUILDING ENVELOPESINGLE FAMILY HOME60’6’7’20’7’6’10’ 60’10’10’SETBACK10’6’10’LANDSCAPE10’ YARD SETBACKSIDEWALK6’SAN LUIS RANCH June 22, 2020Scale: 1/8” = 1’-0”(on 11x17 sheet)02486’Packet Page 322Item 17 SAN LUIS RANCH June 22, 2020A30248Scale: 1” = 20’(on 11x17 sheet)MULTI-USE PATH - RETAIL SITEMULTI-USE PATH - @HARVEST WAY CONNECTION MULTI-USE PATH - @REAR RESIDENTIAL LOT18’ DEEP PARKING STALLS WITH PERVIOUS PAVERS18’ DEEP PARKING STALLS WITH PERVIOUS PAVERS24’ WIDE DRIVE AISLE24’ WIDE DRIVE AISLE7’ WIDE PEDESTRIAN PATH7’ WIDE PEDESTRIAN PATH30’ LANDSCAPE BUFFER WITH 10’ WIDE MEANDERING MULTI-USE PATH WITH 2’ WIDE SHOULDERS ON EACH SIDE25’ LANDSCAPE BUFFER WITH 10’ WIDE MEANDERING MULTI-USE PATH WITH 2’ WIDE SHOULDERS ON EACH SIDE10’ 10’ 18’24’25’ 25’ 18’ 18’ 24’ 24’ PEDESTRIAN SIDEWALKHARVEST WAYRESIDENTIAL LOTRESIDENTIAL LOTRESIDENTIAL LOTBUFFERDRIVE AISLECROSSWALKTRUCK DOCKCOMMERCIAL BUILDINGCOMMERCIAL BUILDINGCOMMERCIAL BUILDING7’ 7’ 4’12’6’ HIGH MASONRY WALL BETWEEN COMMERCIAL AND RESIDENTIALPacket Page 323Item 17 SAN LUIS RANCH June 22, 2020A40248Scale: 1” = 20’(on 11x17 sheet)MULTI-USE PATH - RETAIL SITEMULTI-USE PATH - @COMM/RESIDENTIAL BUFFER MULTI-USE PATH - @OPEN SPACE CONNECTION20’ LANDSCAPE BUFFER WITH 10’ WIDE MEANDERING MULTI-USE PATH WITH 2’ WIDE SHOULDERS ON EACH SIDE10’ 10’27’ 20’ BUFFER AFFORDABLE RESIDENTIAL BUILDINGAFFORDABLE RESIDENTIAL BUILDINGCOMMERCIAL BUILDINGAFFORDABLE SECURE PARKINGSECURE GATEMULTI-USE PATH6’ HIGH SOLID FENCE BETWEEN OPEN SPACE AND RESIDENTIAL FOR PRIVACY SCREENINGOPEN SPACE MULTI-USE PATH - CONNECTION TO DALIDIO ROAD AND BUS STOPPacket Page 324Item 17 Packet Page 325Item 17 Packet Page 326Item 17 Packet Page 327Item 17 Packet Page 328Item 17 Packet Page 329Item 17 Packet Page 330Item 17 April 9, 2020 City of San Luis Obispo Community Development Department 919 Palm Street San Luis Obispo, CA 93401 RE: Overview for San Luis Ranch Lot 7 Retail/Mixed Use site (Vesting Tentative Tract Map, Development Plan and Specific Plan Amendment) San Luis Ranch is excited to present to the City of San Luis Obispo for review and approval the re-subdivision of the 11.44-acre Retail/Mixed use site at San Luis Ranch. Our proposal includes the creation of 11 parcels for horizontal mixed-use development, with approximately 114, 300 square feet of retail space and 60 affordable units with the ability to add an additional 17 affordable units. This project fulfills the City goals and San Luis Ranch’s approvals by: 1. Building more affordable units that is required by the SLR Specific Plan. 2. We are teaming up with People’s Self Help Housing (PSHH) to build the 34 affordable units required by the Commercial portion of San Luis Ranch and proposing to move the 26 affordable units required by the Multi- family portion of San Luis Ranch to a combined 60 unit site as part of this application. We are also allowing the number of affordable units to increase by up to 17 units, if funding sources can be secured. (The current approval allows the project to pay a fee and not build the units per DA Section 7.05 and SLR SP Section 5.2.2). 3. Providing services and amenities not available in smaller or scattered affordable projects. 4. Building all the affordable units next to transit, services in a mixed-use setting. 5. Allowing the multi-family site to provide additional “affordable by design” micro units. 6. Building the balance of the site in retail uses of various sizes and locations to provide for a variety of services for the community. 7. The project will meet ALUC requirements. (Please see attached analysis dated March 27, 2020.) 8. The traffic generated by this proposal, even with the addition of more affordable units is under the approved traffic thresholds in the Certified EIR/SEIR. 9. The project does not cause any additional impact not reviewed in the Certified EIR/SEIR. 10. The project is in conformance with the current design guidelines and will allow for review of the buildings by the ARC prior to building permit approval. We have a contract with PSHH to build the affordable units, should the project be approved. With this integrated project, PSHH is able to deliver to the community more essential affordable housing supportive services, such as educational and wellness programming, individual and family counseling, and career and business guidance. Sincerely, Walter Heiberg; MI San Luis Ranch, LLC Packet Page 331 Item 17 APPLICATION SUMMARY SAN LUIS RANCH COMMERCIAL/MIXED USE VESTING TENTATIVE TRACT MAP #3142, DEVELOPMENT PLAN AND SPECIFIC PLAN AMENDMENT APPLICATIONS Overall Project Description Vesting Tentative Tract Map 3142 with concurrent Development Plan and Specific Plan Amendment is the subdivision of an 11.44-acre parcel into 11 parcels ranging in size from 0.30 acres to 2.77 acres to establish the horizontal mixed-use development for a total of approximately 114,300 SF of retail and up to 77 affordable housing units. Specific Plan Amendment application is the correction to the overall density allowed in the SLR Specific Plan to 654 units. The proposed VTTM#3142, Development Plan and Specific Plan Amendment applications are in substantial conformance with EIR/SEIR on file, based upon the updated traffic analysis as provided with application. Vesting Tentative Tract Map application: - Subdivision of Lot 7 Tract 3096, an 11.44-acre parcel into 11 parcels for horizontal mixed-use ranging in size from 0.30 acres to 2.77 acres; - Establish grading, drainage, utilities and storm water requirements for approximately 114,300 SF of retail and up to 77 Affordable housing building. - Abandon and dedicate new right-of-way to conform with realignment of bus stop at Dalidio Drive immediately adjacent to Lot 7 of Tract 3096; Development Plan application: - Refine further the Design Guidelines for the Retail site, establishing the horizontal and vertical relationship between the retail and residential uses; - Establish Affordable Housing allowed density to be a maximum of 77 units; - Establish retail development of approximately 114,300 SF of space. Specific Plan Amendment application: - SLR SP Master Planned Community currently requires 580 residential units and 34 commercial affordable housing units for a total of 614 units. - SLR SP Master Planned Community erroneously limited the allowed density to 614 units, when per Section 17.140.040 and the currently required affordable housing mix allows for up to 663 units in the SP Area at a 32.5% Density Bonus, rather than the 20% identified. - Correct the allowed density in the SLR SP to 654 residential units to accommodate up to 77 affordable housing units on-site – including correction of various reference tables and narrative language to correct overall allowed density. - Our application is seeking an overall density correction of 654 units, consistent with ALUC requirements. - Amend Community Garden location from Lot 7 Tract 3096 as shown on page 3-20 of SLR SP to the Farm on Lot 10 Tract 3096 – of equal or greater size. Packet Page 332 Item 17 Allowed Density per Adopted San Luis Ranch Specific Plan Use Land Use Category Market Rate Density Affordable Density Maximum Density RSF NG-10 194 4 198 RSF NG-23 79 4 83 MF NG-30 273 26 299 Retail NC 0 34 34 Total 546 68 614 Mix of Affordability CURRENT Affordable Income Level NG-10 NG-23 NG-30 NC Total Moderate (80%- 120%) 4 0 0 4 8 Low (51%-80%) 0 4 0 4 8 Very Low (31%-50%) 0 0 26 26 52 Extremely Low (30% and below) 0 0 0 0 0 Manager Unit 0 0 0 0 0 Total 4 4 26 34 68 Allowed Density Bonus Calculation per State Law and Section 17.140.040(E) – CURRENT Affordable Income Level Total Affordable Units Provided Percentage of General Plan Allowed Density 500 Units Percent Density Bonus 17.140.040(E) Density Bonus Calculation (500 Units X Percentage Allowed) Maximum Units Allowed in SLR SP Moderate 8 2% 0 Low 8 2% 0 Very Low/Extremely Low 52 10% 32.5% 163 68 663 Packet Page 333 Item 17 Proposed Maximum Density per San Luis Ranch Specific Plan Amendment Use Land Use Category Market Rate Density Affordable Density Maximum Density RSF NG-10 194 4 198 RSF NG-23 79 4 83 MF NG-30 296 0 296 Retail NC 0 77 77 Total 569 85 654 Mix of Affordability PROPOSED MINIMUM Affordable Income Level NG-10 NG-23 NG-30 NC Total Moderate 4 0 0 0 4 Low 0 4 0 7 11 Very Low/Extremely Low 0 0 0 52 52 Manager Unit 0 0 0 1 1 Total 4 4 0 60 68 Allowed Density Bonus Calculation per State Law and Section 17.140.040(E) – PROPOSED Affordable Income Level Total Affordable Units Provided Percentage of General Plan Allowed Density 500 Units Percent Density Bonus 17.140.040(E) Density Bonus Calculation (500 Units X Percentage Allowed) Maximum Units Allowed in SLR SP Moderate 4 1% 0 Low 11 4% 0 Very Low/Extremely Low 52 10% 32.5% 163 68 663 *NC Affordable Housing shows a minimum of 60 units. Breakdown provided is for purposes of calculating Density Bonus based upon the minimum number of affordable income units proposed. Actual number of NC affordable units will be between 60-77, with 100% of units available to low income or below. Packet Page 334 Item 17 City of San Luis Obispo General Plan Conformance Statement The proposed design and uses associated with Tract 3142 carry out the existing policies of the City’s adopted General Plan. The development intended with Tract 3142 fulfills the goals and policies of the General Plan, particularly those pertaining to affordable housing. “The City shall support the location of mixed-use projects and community and neighborhood commercial centers near major activity nodes and transportation corridors/transit opportunities where appropriate. - General Plan Policy 2.3.6 Tract 3142 locates additional affordable housing units immediately adjacent to commercial, service, employment and transit uses. “All land uses proposed shall be in keeping with safety parameters described in this General Plan or other applicable regulations relative to the San Luis Obispo Regional Airport.” - General Plan Policy 8.1.4 The County Airport Land Use Commission unanimously found the San Luis Ranch Specific Plan to be in conformance with the San Luis Obispo Airport Land Use Plan. Please see attached “Conformance of San Luis Ranch Commercial/Mixed Use Proposal – Tract 3142/Specific Plan Amendment” for detailed analysis of conformance with Airport Land Use Plan policies and conditions. City of San Luis Obispo Housing Element Policies: Policy 4.3. Extremely low- and very low-income housing, such as that developed by the Housing Authority of the City of San Luis Obispo or other housing providers, may be located in any zone that allows housing, and should be dispersed throughout the City rather than concentrated in one neighborhood or zone. Policy 6.19. Continue to incentivize affordable housing development with density bonuses, parking reductions and other development incentives, including City financial assistance. Policy 7.2. Higher density housing should maintain high quality standards for unit design, privacy, security, on-site amenities, and public and private open space. Such standards should be flexible enough to allow innovative design solutions in special circumstances. Affordable Housing for the San Luis Ranch Specific Plan Area, including Tract 3142, is consistent with the Housing Element policies: x The project is consistent by providing affordable development consistent with the San Luis Ranch locational criteria in a newly developing neighborhood. x A range of housing products from studio to three-bedroom units will be provided. The variety of floor plans and sizes of units in the project will appeal to different ages and income levels. x Affordable units maintain high quality standards for unit design, privacy, security, on-site amenities, and public and private open space. Packet Page 335 Item 17 San Luis Ranch Specific Plan Conformance Statement The proposed design and uses associated with Tract 3142 carry out the existing policies of the adopted San Luis Ranch Specific Plan. The development intended with Tract 3142 fulfills the goals and policies of the General Plan, particularly those pertaining to affordable housing, even more robustly than the adopted Specific Plan. San Luis Ranch Specific Plan Chapter 8 – Implementation Policies Policy 1.4. Promote high intensity, clustered development that promotes walking, biking, and transit use. Policy 3.3. Encourage pedestrian scale development that fosters walking to and from commercial uses. Policy 4.3. Promote affordable, entry level, and workforce housing opportunities whenever possible. Policy 6.1. Apply a multimodal approach to transportation networks for the site (i.e., considering safety and mobility of all users, including pedestrians, cyclists, drivers, and transit riders). Policy 6.3: Ensure a safe and efficient circulation system within the Plan Area. Tract 3142 locates up to 77 affordable housing units, targeting low and very-low income groups, in a single structure, immediately adjacent to multi-use (bike/ped) paths, as well as commercial, employment and transit uses. Residents and visitors in Tract 3142 have access to wide range of services, transportation options, and recreational opportunities. Packet Page 336 Item 17 ADDENDUM TO THE CERTIFIED FINAL SUPPLEMENTAL ENVIRONMENTAL IMPACT REPORT FOR THE SAN LUIS RANCH PROJECT AUGUST 2020 A. INTRODUCTION This document is an Addendum to the Final Supplemental Environmental Impact Report (FSEIR) prepared for the San Luis Ranch Project (State Clearinghouse Number 2015101083). The FSEIR was certified by the City of San Luis Obispo on July 17, 2018, pursuant to City Council Resolution No. 10927 (2018 Series). The Addendum is intended to bring the existing CEQA documentation up to date as appropriate. Because there are no new significant impacts or mitigation measures as a result of this updated analysis, an Addendum is the appropriate CEQA document. B. ADDENDUM REQUIREMENTS The Addendum has been prepared in accordance with the relevant provisions of the California Environmental Quality Act (CEQA) of 1970 (as amended) and the State CEQA Guidelines as implemented by the City of San Luis Obispo. According to §15164(b) of the State CEQA Guidelines, an Addendum to an Environmental Impact Report (EIR) is the appropriate environmental document in instances when “only minor technical changes or additions are necessary or none of the conditions described in Section 15162 calling for the preparation of a subsequent EIR have occurred”. Section 15162(a) of the State CEQA Guidelines states that no subsequent Negative Declaration shall be prepared for a project unless the lead agency determines, on the basis of substantial evidence in the light of the whole record, one or more of the following: (1) Substantial changes are proposed in the project which will require major revisions of the previous EIR or Negative Declaration due to the involvement of new significant environmental effects or a substantial increase in the severity of previously identified significant effects; (2) Substantial changes occur with respect to the circumstances under which the project is undertaken which will require major revisions of the previous EIR or Negative Declaration due to the involvement of new significant environmental effects or a substantial increase in the severity of previously identified significant effects; or (3) New information of substantial importance, which was not known and could not have been known with the exercise of reasonable diligence at the time the previous EIR or Negative Declaration was adopted, shows any of the following: (A) The project will have one or more significant effects not discussed in the previous EIR or Negative Declaration; Packet Page 337 Item 17 (B) Significant effects previously examined will be substantially more severe than shown in the previous EIR or Negative Declaration; (C) Mitigation measures or alternatives previously found not to be feasible would in fact be feasible, and would substantially reduce one or more significant effects of the project, but the project proponents decline to adopt the mitigation measure or alternative; or (D) Mitigation measures or alternatives which are considerably different from those analyzed in the previous EIR or Negative Declaration would substantially reduce one or more significant effects on the environment, but the project proponents decline to adopt the mitigation measure or alternative. This Addendum does not require circulation because it does not provide significant new information that changes the certified FSEIR in a way that deprives the public of a meaningful opportunity to comment upon a substantial adverse environmental effect of the project or a feasible way to mitigate or avoid such an effect. This Addendum includes this introduction and a description of the proposed actions addressed in the Addendum as they related to the previously-approved project. The technical analysis in support of this Addendum is included as an appendix to this document for reference (Appendix A). The CEQA documentation for this project, including this Addendum and certified FSEIR, is available for review on the City’s website at www.slocity.org. C. PREVIOUS CEQA DOCUMENTATION The City Council unanimously certified a Final EIR and approved the project on July 18, 2017, pursuant to City Council Resolution No. 10822 (2017 Series). A Notice of Determination (NOD) was prepared, and there were no legal challenges to the adequacy of the Final EIR during the 30- day statute of limitations associated with the NOD, pursuant to CEQA (PRC Section 21167 and CEQA Guidelines Section 15094). Subsequently, the City Council unanimously certified a Final Supplemental EIR and approved a modified project on July 17, 2018, pursuant to City Council Resolution No. 10927 (2018 Series). A Notice of Determination (NOD) was prepared, and there were no legal challenges to the adequacy of the Final EIR during the 30-day statute of limitations associated with the NOD, pursuant to CEQA (PRC Section 21167 and CEQA Guidelines Section 15094). D. REASONS WHY AN ADDENDUM IS APPROPRIATE Subsequent to the approval of an amendment to the previously approved San Luis Ranch project in July 2018, the City of San Luis Obispo conducted additional analysis of traffic operations related to the Project, a copy of which is attached hereto as Appendix A. The supplemental traffic analysis evaluates a proposal to implement the Project in a manner that is consistent with the San Luis Ranch Specific Plan, but with modifications to certain land uses, including a Packet Page 338 Item 17 reduction in the amount of Office square footage from 100,000 sf to 97,000 sf, a reduction in the amount of retail square footage from 150,000 sf to 139,300 sf, and an increase in residential uses from 580 dwelling units to up to 654 dwelling units, of which up to 281 would be single family residences and 373 would be multi-family residences, some of which are identified as affordable housing. The change in buildout potential will result in fewer vehicle trips associated with development of the Project at two intersections evaluated in the FSEIR - Intersection #16: South Higuera Street & Tank Farm Road and Intersection #18: Prado Road and South Higuera Street. The updated traffic analysis concludes that it would be appropriate to modify the mitigation measures associated with these intersections from requiring construction of improvements in conjunction with development of the Project to requiring payment of the Project’s fair share of the cost of the future improvements by the City or a future developer at a time to be determined by the City. The proposed changes do not materially change the findings and conclusions of the FSEIR, making a second Supplemental EIR unnecessary pursuant to Section 15162 of the CEQA Guidelines. E. UPDATED PROJECT ELEMENTS As discussed above, the project evaluated in this Addendum includes modifications from what was evaluated in the certified Final EIR and FSEIR to reflect an increase in housing potential from 580 units to 654 units, and a reduction in non-residential area from 250,000 SF to 236,300 SF. The overall land use mix and pattern envisioned under the approved Specific Plan otherwise remains unchanged. Please refer to the FEIR and FSEIR for setting information related to analyzing project impacts. F. UPDATED ENVIRONMENTAL IMPACT ANALYSIS This section addresses impacts associated with the project changes that have been proposed since the FSEIR was certified in July 2018. Except as noted below, none of the analysis or discussion included in the certified FSEIR has changed. The analysis addresses all the issue areas discussed in the Final EIR and FSEIR. Transportation The proposed changes would not affect any of the Project’s construction-related impacts or the overall footprint of development, which remains consistent with development that could occur under the approved Specific Plan. As discussed below, based on the June 2020 traffic memo, attached hereto as Appendix A, there would be fewer trips generated by development under the San Luis Ranch Specific Plan, and thus commensurately lesser impacts than what were identified in the FEIR/FSEIR. Previously identified impacts and mitigation measures would still apply. However, based on the June 2020 traffic memo, two mitigation measures may be modified as proposed without changing the severity of identified impacts. With regard to the Project’s operational impacts, the updated traffic analysis concludes that the implementation of mitigation measures required for two intersections analyzed in the FSEIR – Intersection #16: South Higuera Street & Tank Farm Road and Intersection #18: Prado Road and South Higuera Street –could be modified without additional impact from requiring construction of the improvements discussed therein in conjunction with buildout of the Project Packet Page 339 Item 17 to payment of the Project’s fair share toward future construction of these improvements by the City or a future developer, as determined by the City, when warranted by then existing conditions. These mitigation measures are modified as follows, new language is shown in underline and deleted language is shown in cross-out: T-1(g) Intersection #16: S. Higuera Street & Tank Farm Road. x Pay Fair share costs and dedicate necessary ROW for construction of the Prado Road Overpass & NB Ramps (Timing & Amount of Fair Share Payments as established in San Luis Ranch Development Agreement). x Develop a Travel Demand Management Plan consistent with section 2.4.3 and to the satisfaction of the Public Works Director (Prior to Building Permits or Occupancy) x Pay fair share costs in the amount of $42,500 toward future construction by City or another developer of an extension of the Extend northbound right turn pocket to 230' and channelize movement (Prior to Building Permits or Occupancy) T-2(j) Intersection #18: Prado Road & Higuera Street. x Install 2nd U.S. 101 northbound left turn lane (Prior to Building Permits or Occupancy) x Pay fair share costs in the amount of $75,000 toward future construction by City or another developer of an extension of the Extend westbound right turn pocket to 400' (Prior to Building Permits or Occupancy) No other changes to any other transportation-related mitigation measures are proposed. Air Quality, Greenhouse Gas Emissions, and Noise The reduction in the Project’s traffic would result in corresponding reductions in the Project’s Air Quality, Greenhouse Gas Emissions and operational Noise impacts, which are largely based on trip generation. However, the level of impacts identified in the FEIR and FSEIR would not change, nor would any mitigation measures associated with these issue areas. Water Resources and Recreation As noted in the FSEIR, the approved Specific Plan Project is projected to result in a total service population of 2,135 persons, of which the Project would generate 1,293 residents and 842 employees. Based on the population generation factors included in the FSEIR, the proposed changes would reduce the total service population to 2,042 persons, comprised of 1,418 residents (a net increase of 125 residents) and 624 employees (a net decrease of 218 employees). The changes in the service population for the project are not expected to generate any new or increased environmental impacts related to demands on water resources or recreational facilities, as described below. Packet Page 340 Item 17 Based on the water generation rates in Section 4.13 of the EIR, the proposed changes will result in an increase in water demand from 217.6 AFY to 226.66 AFY; however, this amount is well within the amount of available water disclosed under the EIR and would not result in any new or increased significant impacts. Similarly, the addition of 125 residents, an increase of less than 10%, would place some additional demands on City park and recreation facilities. However, as discussed in Section 4.11 of the FEIR, in addition to park facilities being constructed within the project, the additional residential units will pay required City park fees, which will reduce any impacts to recreational facilities to a level of less than significance, and the proposed changes would not result in any new or increased significant impacts. Other Impacts Described in the FEIR and FSEIR Several impacts described in previous CEQA documentation are based on the amount of land converted to development activities. The issues include Agricultural Resources, Biological Resources, Cultural Resources, Hazards, Hydrology/Water Quality, and Land Use. Because the development footprint would not change under the updated Project, impacts and mitigation measures related to these issues would not change. G. DETERMINATION In accordance with Section 15164 of the CEQA Guidelines, the City of San Luis Obispo (City) has determined that this Addendum to the certified FSEIR is necessary to document changes or additions that have occurred in the project description since the FSEIR was originally certified. The City has reviewed and considered the information contained in this Addendum and finds that the preparation of subsequent CEQA analysis that would require public circulation is not necessary. Packet Page 341 Item 17 Packet Page 342 Item 17 Packet Page 343 Item 17 Packet Page 344 Item 17 Packet Page 345 Item 17 Packet Page 346 Item 17 Packet Page 347 Item 17 Packet Page 348 Item 17 Packet Page 349 Item 17 Packet Page 350 Item 17 Packet Page 351 Item 17 Packet Page 352 Item 17 Policy Context Analysis The project area is within the San Luis Ranch Special Focus area as identified in Section 8.1.4 of the Land Use Element (LUE). Section 8.1.4 of the LUE identifies a general framework guiding development in that area, including issues related to circulation, site design, view protection, agricultural protection, and public safety. Specifically, it anticipates that the area could support commercial, office and residential development, and the proposed SPA and VTTM support implementation of SLRSP General Plan policy objectives. The LUE required that a specific plan be prepared for the entire 132-acre San Luis Ranch area. A specific plan is a tool for the systematic implementation of a general plan. The SLRSP was adopted in 2017. Because the Specific Plan is inherently consistent with the General Plan, the project’s consistency with the Specific Plan is the focus of this policy analysis. The proposed SPA would allow for additional housing not anticipated in the adopted SLRSP, increasing the number of possible residential units in the plan area from 580 to 654. The intent of this is to allow for additional affordable housing to be built within the NC-zoned area, beyond the 34 inclusionary units (or in lieu fees) required by the Zoning Regulations with respect to the development of commercial land (see SLRSP Section 5.2.2 for further discussion). The SPA would allow up to 77 affordable units to be constructed in the NC-zoned area, which would further Housing Element goals to provide needed affordable housing citywide. The proposed increase in housing has the potential effect of increasing impacts to public services and traffic beyond those anticipated under the General Plan and associated LUCE EIR, as well as the Final EIR and Supplemental Final EIR for the SLRSP. To address this, an Addendum to the Final EIR and Supplemental Final EIR for the SLRSP was prepared to evaluate the possible impacts associated with the updated pattern of development within the Specific Plan area (Attachment D). Based on that analysis, the modified development levels under the SPA would not result in greater impacts to traffic, public services, or any other issue addressed in the Final EIR and Supplemental Final EIR compared to what was anticipated under the approved Specific Plan prior to its possible amendment (please refer to the “Environmental Review” section for further discussion of CEQA-related issues). For that reason, the level of development anticipated under the amended SLRSP remains consistent with the General Plan. The land use pattern anticipated under the SPA is substantially similar to what was previously approved, so it too remains consistent with the General Plan. Packet Page 353 Item 17 San Luis Ranch Specific Plan Upon its adoption in 2017, the SLRSP became the primary guiding land use regulatory document for the area it encompassed. The proposed project area coincides with the portion of the NC- designated land generally northwest of the intersection of Froom Ranch Way and Dalidio Drive (figure, right). A Specific Plan is a tool for the systematic implementation of a General Plan. It effectively establishes a link between implementing policies of the general plan and the individual development proposals in a defined area. In the case of the SLRSP, it addresses the broad range of planning issues and policies typically covered in the City’s General Plan or zoning ordinance, from land use, circulation, site planning standards, design guidelines, landscape design requirements, project phasing, and infrastructure requirements. In some cases, it establishes standards that go beyond those included in the General Plan, or that are tailored to the needs of the project site. For that reason, the project will be evaluated against the requirements of the SLRSP to determine consistency with City planning policies. The table below summarizes key relevant policies from the SLRSP, and City staff’s analysis of the project’s consistency with those policies. The applicant has also provided a statement of conformity with the SLRSP and General Plan in the project statement (Attachment C). Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency Table 2-1. General Plan San Luis Ranch Performance Standards Applicant proposes to increase the Residential component from 580 to 654 units. However, this table shows what is in the adopted General Plan, and the proposed SPA would not change that. No change to this table is appropriate. Table 2-1 should not be modified as proposed Table 2-3. Planned San Luis Ranch Specific Plan Area Development This table includes proposed modifications to accommodate up to 654 residential units, and a downward revision to a maximum of 139,300 SF of commercial and 97,000 SF of office. Yes Figure 3: San Luis Ranch Specific Plan Land Use Map Packet Page 354 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency Although the residential buildout exceeds what is shown in Table 2-1, it is still consistent with the intent of the General Plan as described in Section 4.1 above. This change provides the basis for other modifications to the Specific Plan discussed below, and the determination of potential consistency. Section 2.5.1 Commercial Retail and Section 2.5.2. Office. The project is consistent with that intent. Section 2.5.1 and 2.5.2 call for commercial retail and office uses that would be accommodated by the VTTM. Yes Section 2.5.6. Integrated Residential Uses. San Luis Ranch will integrate residential uses in the Neighborhood Commercial Zone. Housing development and mixed-use projects in this Zone expand the range of housing opportunities offered by San Luis Ranch, creating an opportunity to make use of the community’s walkability and multimodal transit amenities, and could be promoted as an optimal choice for those seeking a car-free lifestyle. This section is a proposed amendment to the SLRSP. It allows for residential mixed use within the NC zone as proposed under the VTTM. Yes Section 3.3 Neighborhood Commercial (NC) Zone The introduction to this section does not mention residential uses as a possible land use that could be included in a mixed use project, although there are illustrations later in this section that support this concept, and Table 3- 6 includes residential as an allowed use. It is recommended that the introduction mention residential as a potential land use in this zone when part of a mixed-use development. Yes; see analysis for minor modification to SP 3.7.2. Commercial/Mixed Use Design Guidelines. [The following existing guidelines are modified as proposed, with new next underlined, and deleted text indicated by strikeout. Only modified Proposed modifications clarify the relationship between residential and commercial uses in project design that may come forward through a Development Plan. Each aspect of the proposed changes are analyzed below. Yes Packet Page 355 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency portions of the existing guidelines are shown.] Site Planning and Design a. Buildings should be sited close to and oriented toward external and interior streets. Building design should incorporate pedestrian walkways, outdoor seating, and landscape areas where possible. Where buildings front external and internal streets, building design should address the streets and not present the back of the building. b. Outdoor spaces should reflect careful planning and provide plaza spaces with defined edges, benches, and lighting that establish a sense of place. Building design should engage pedestrian circulation paths with outdoor seating, landscape areas, and pedestrian-oriented areas where possible. c. Transitional pedestrian-oriented outdoor spaces should be provided at horizontal mixed-use interface between uses. Transitional spaces should include courtyards, benches, landscape, and lighting that establish a sense of place. d. Clearly defined pedestrian and bicycle circulation paths should be provided across site connecting to parking, building entries, public ways, and multimodal transit connection points. Use of path defining elements such as enhanced paving and landscape should be incorporated. Site Planning and Design. In general, the intent is to promote higher quality design that emphasizes the visual attributes of development, integrates pedestrian and bicycle circulation, and encourages public meeting opportunities though design. These guidelines form a solid framework for mixed use projects that may come forward in a Development Plan. Building Form. Includes minor changes that do not alter the original intent, but clarify and help visualize how roofing elements would be integrated into design. Building Elements and Articulation. Includes minor changes that do not alter the original intent, but emphasize pedestrian access and functionality. Mixed-Use Integration. This is a new section to better articulate how residential and commercial uses will relate, both vertically and horizontally. It also describes how pedestrian connections can be better achieved. Commercial Plazas. This includes minor changes to an existing section to better clarify the original intent. Signs. This includes minor changes to an existing section to better clarify the original intent, and to ensure better consistency both within the SLRSP and the City’s sign regulations. Packet Page 356 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency e. Plazas, courtyards, pocket parks, and outdoor public spaces cafes should be designed in an inviting manner that to encourages pedestrian use through the incorporation of trellises, fountains, art, seating, and shade trees. Building Form b. Roofs covering the entire building such as hips and gables, are preferred over mansard roofs. Where practical and on short span roof elements, the primary roof form should address the entire building such as hips and gables. Application of flat roofs with parapets or mansard roofs should be limited in use and apply to large spans only. d. Vertical elements such as towers should be used to accent horizontal massing and provide visual interest and a point of reference, especially on corner buildings engaged with public areas. Building Elements and Articulation e. Building facades facing paseos should be articulated with detail and display windows provide for pedestrian scale elements and materials where it is not the primary entry. Mixed-Use Integration Building Materials. This includes minor changes to an existing section to better clarify the original intent. Exterior Colors. This includes minor changes to an existing section to better clarify the original intent. Utilitarian Aspects of Buildings. A provision related to pedestrian access to trash closures was eliminated because it unnecessarily restricted potential designs that could be visually less intrusive. Packet Page 357 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency a. Horizontal and vertical mixed-use incorporating both residential and office uses provide for a complete community and are encouraged. b. Where residential horizontal mixed- use faces commercial areas and parking, pedestrian transitional elements and buffers should be included such as low fencing or walls, screening planting, and seating alcoves. c. Delineation between public commercial areas and residential areas should be defined through the use of material change, signage and transitional elements. Transitional elements should include courtyards, benches, landscape, and lighting that establish a sense of place. d.Lower floors of both horizontal and vertical mixed-use buildings should communicate use through key elements such as scale, plate height, and architectural details. Commercial Plazas a.Specialized, defined, public outdoor spaces should be incorporated into the overall building and project design. These outdoor spaces should clearly define usable spaces and take advantage of any “leftover space.” have clear, recognizable shapes that reflect careful planning and should not be a result of “leftover” areas between structures. b. Site amenities, including benches, drinking fountains, provisions for bicyclists, water features, and public art, should be utilized and should complement the project’s architectural character and be oriented toward courtyards and paseos. Packet Page 358 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency Signs b. Signs should reflect the type of business through design, shape, or graphic form in addition to typographic information. c. Signs oriented toward pedestrian space and pathways should be appropriately detailed to enhance the public space. e. Signs should not detract from cover up windows or important architectural features. i. Sign construction should reflect a high level of craftsmanship and be consistent with City signage requirements unless otherwise addressed within the Specific Plan. Building Materials b. Smooth plaster finishes, 20-30 sand finish or smoother, are preferred over rough, textured stucco. Stucco may be used in combination with other materials such as siding and brick. Stucco should be primarily used for side and back walls that are not as visible from public view; with the richer materials used on the front or to accent architectural features serve as a supporting material with richer, more varied materials used on the front and public facing facades. Increased application of stucco is more appropriate on the rear and non- public faces of the buildings. c. Materials and colors should be architecturally consistent and enhance the overall project character while employing best Packet Page 359 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency design practices of authentic application. Exterior Colors a.Exterior colors should be consistent with the architectural style of the building. Color schemes that involve a minimum of three (3) colors should be utilized but tone on tone color palettes are also appropriate in limited application. b. Different colors accentuating different aspects and details of the building architecture should be utilized. Except for accenting different aspects and details of a building or as required by a national brand, bright colors should be avoided. Utilitarian Aspects of Buildings f. A pedestrian entrance to the trash enclosure should be provided so the large access gates do not have to be opened as often. 5.2.2 Affordable Housing. [The applicant suggests modifications to this section as follows:] 1.To reflect the fact that there would be up to 654 units within the SLRSP, and 64-77 affordable units on the NC site (instead of 34). 2.The applicant suggests they qualify for a 32.5% density bonus instead of the 20% included in the existing SLRSP. These changes essentially would allow for up to 34 additional affordable units within the SLRSP than are currently accommodated in the plan. In achieving this, there would be fewer deed restricted affordable units in the NG-30 zone, but a significant increase that more than offsets this within the NC zone. The density bonus provision corrects a clause that was inaccurately described in the original SLRSP, and allows for the magnitude of Yes Packet Page 360 Item 17 Project Consistency with the San Luis Ranch Specific Plan SLRSP Relevant Policy or Guidance Discussion Potential Consistency 3. States that there would be 2 deed restricted affordable units in each of the NG-10 and NG-23 zones. 4. Removes the requirement for 26 deed restricted affordable units in the NG-30 zone, since these will be transferred to the NC zone. affordable housing development contemplated in the amended SLRSP. Overall, these changes further the City’s broad goal of providing additional affordable housing to a greater extent than could occur under the originally-approved SLRSP. Tables 7-2, 7-4, 7-5, 7-7, 7-8, 7-10 and 7-11. [These are tables that project water demand, wastewater generation, solid waste generation, school demand, and buildout. These have been updated to reflect updated development potential.] The updated information does not affect development potential, or any aspect of future project. It is intended primarily for informational purposes. Yes Affordable Housing Requirements The City’s 2019-21 Financial Plan identifies affordable housing as a Major City Goal. The City’s Housing Element includes numerous policies and programs that support incentives, such as density bonuses, to provide housing for low, very low and extremely low-income households. The SLRSP as conceived accounts for a 20% density bonus for achieving affordable housing goals. The project now proposes up to a 32.5% density bonus to reflect current State Density bonus law. Both the SLRSP and the Development Agreement for the project require that development within the Specific Plan area include sufficient affordable housing to be consistent with Housing Element policies related to this issue (the SLRSP and Development Agreement are consistent with one another). In both documents, development in the NG-30 zone is required to provide 26 deed- restricted units that are affordable to very low-income households. The Housing Plan within the Development Agreement also requires that the project provide 10 deed-restricted workforce housing units (i.e., affordable to households earning from 121-160% of the area’s median income) within the NG-30 zone. The proposed Specific Plan Amendment would provide additional affordable housing as compared to the currently approved SLRSP. An additional 64-77 affordable units would be provided in the NC zone compared to what would otherwise be built, although even without the SPA, a commercial project would be required to pay in lieu fees toward the construction of 34 affordable units. It should be noted that under this proposal, the 26 deed-restricted units within the NG-30 zone would no longer be deed restricted but become market rate high density housing. Instead, Packet Page 361 Item 17 the 64-77 affordable units within the NC zone would include 26 deed restricted units (based on the requirement transferred from the NG-30 zone), as well as the 34 units that are required as part of the original SLRSP approval. Thus, this proposal could result in 4-17 units beyond the previously required 60 affordable units. Overall, the proposed project would result in a realistically achievable affordable housing project within the NC zone, functioning as a mixed-use project in proximity to commercial development, consistent with the intent of the City’s Housing Element goals. Packet Page 362 Item 17 Department Name: Administration Cost Center:1001 For Agenda of:November 17, 2020 Placement:Consent Estimated Time:N/A FROM: Derek Johnson, City Manager Prepared By:Victoria Tonikian, Interim Executive Assistant to the City Manager / Fiscal Officer SUBJECT:CONSIDER ADOPTING A RESOLUTION ESTABLISHING CITY SUPPORT FOR H.R. 1384, THE MEDICARE FOR ALL ACT OF 2019 RECOMMENDATION Consider adoption of a Resolution (Attachment A) establishing City support for H.R. 1384, the Medicare for All Act of 2019, and urging its passage by Congress. DISCUSSION On October 20, 2020, a majority of the Council directed staff to return with a resolution in support of H.R. 1384. In 2019, Congresswoman Pramila Jayapal introduced Medicare for All Act of 2019 (H.R. 1384). H.R. 1384 expands the Medicare program to ensure all United Stated residents have guaranteed access to healthcare and establishes a national health insurance program which provides comprehensive protection against increasing health care costs and health-related services. Upon enactment, the program will be administered by the Department of Health and Human Services. The purpose of this item is for the City Council to consider adoption of the proposed resolution in support of the Medicare for All Act of 2019. H.R. 1384 H.R. 1384 (Attachment B) proposes a national health insurance program which would provide health care coverage as described in the bill to all residents. H.R. 1384 would provide: 1. Coverage for all United States residents; 2. Automatic enrollment of individuals upon birth or residency in the United States; 3. Comprehensive health care coverage including all primary care, hospital, and outpatient services, prescription drugs, dental, vision, audiology, women’s reproductive health services, maternity and newborn care, long-term services and supports, prescription drugs, mental health, and substance abuse treatment, laboratory and diagnostic services, ambulatory services and more; 4. A full choice of any doctors, hospitals, and other providers; Packet Page 363 Item 18 5. Long-term care services for individuals of all ages living with disabilities; 6. Coverage with no premiums, deductibles, or copays for medical services; 7. Lower prescriptions costs. This legislation would allow Medicare to negotiate drug prices to substantially lower the costs of prescriptions drugs. In addition, private health insurers and employers may only offer coverage that is supplemental to, and not duplicative of, benefits provided under the program. Specified federal health programs would terminate upon implementation of H.R. 1384. However, the program does not affect veterans’coverage provided through the Department of Veterans Affairs or Native Americans’coverage provided by the Indian Health Service. If enacted, the transition to Medicare for All would occur in two years. One year after the date of enactment, persons over the age of 55 and under the age of 18 would be eligible for the program. Two years after the date of enactment, all people living in the United States would be eligible for the program. Arguments in Support: H.R. 1384 is sponsored by Representative Pramila Jayapal and the House Progressive Caucus and is cosponsored by other house members Proponents of H.R. 1384 make the following arguments in support of the bill: 1. H.R. 1384 would provide comprehensive, cost-free health insurance coverage for all U.S. residents, regardless of immigration status. 2. Costs would be manageable because the government can control all the costs to keep them low. 3. H.R. 1384 would explicitly cover reproductive health services, remove federal restrictions on coverage, and provide protection for providers offering reproductive health services. 4. H. R. 1384 would establish strong anti-discrimination protections for patients, require providers to act exclusively in their patient's interest, and include steps to address health inequities and reach underserved populations. Arguments in Opposition: Opponents of H.R. 1384 include: National Right to Life Committee, Partnership for America's Health Care Future , American Medical Association, PhRMA, America's Health Insurance Plans and the Federation of American Hospitals. Opponents of H.R. 1384 make the following arguments in opposition of the bill: 1. H.R. 1384 would place unprecedented strain on the federal budget, estimating an additional $32.6 trillion in federal budget commitments during the first 10 years. 2. H.R. 1384 would eliminate privately funded health plans, including employer sponsored coverage. Packet Page 364 Item 18 3. Concern that complete reliance on government funded health care would require rationing of services or degradation of quality care when there are insufficient funds (opponents argue that cost-sharing provisions of current private plans, which would be prohibited under H.R. 1384, prevent these effects). 4. Concern regarding reproductive health protections within the proposed bill, specifically that health providers who are morally opposed to abortion could be required to perform abortions if they provide other kinds of reproductive health care. 5. H.R. 1384 would erode the provisions that limit the use of federal funds for abortion services. Status of H.R. 1384 H.R. 1384 was introduced to the House of Representatives on February 27, 2019. On that same day, the bill was assigned to a committee in the House for review, and the committee referred the bill to a subcommittee for further review. On March 13, 2019, the sponsor, Congresswoman Pramila Jayapal, made introductory remarks to the House of Representatives on the bill. On December 10, 2019, the House Energy and Commerce Subcommittee on Health held a subcommittee hearing on the bill and no further action has been taken since. Previous Council Action During the development of the 2020 Legislative Action Platform at the April 21, 2020 City Council meeting, Council expressly discussed putting an item related to Medicare for All on the platform, but ultimately rejected doing so as a majority. Policy Context At the beginning of each year, the City Council considers a resolution to establish the City’s Legislative Action Platform. The resolution authorizes staff to respond to legislative issues affecting the City (via letters signed by the Mayor or relevant Department Head), provided the positions taken in those letters are consistent with the priorities identified in the platform. Specific direction is required by the Council if an item is not listed or consistent with adopted platform. Public Engagement The item will be presented at the City Council’s public meeting on November 17, 2020. The public has the opportunity to comment in writing prior to the meeting or submit public comment prior or during the meeting. Additionally, the City Council has received numerous written correspondence from community members in favor of supporting this bill. ENVIRONMENTAL REVIEW The California Environmental Quality Act does not apply to the recommended action in this report, because the action does not constitute a “Project” under CEQA Guidelines Sec. 15378. Packet Page 365 Item 18 FISCAL IMPACT There are no costs associated with taking a position on this bill. ALTERNATIVES The City Council may choose to decline the adoption of this Resolution supporting H.R. 1384. Attachments: a - Draft Resolution b - COUNCIL READING FILE - Medicare for All Act of 2019 (H.R. 1384) Packet Page 366 Item 18 R ______ RESOLUTION NO. _____ (2020 SERIES) A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SAN LUIS OBISPO, CALIFORNIA, IN SUPPORT OF H.R. 1384, THE MEDICARE FOR ALL ACT OF 2019 WHEREAS,every person in the City of San Luis Obispo deserves high quality health care; and WHEREAS,the rising cost of health care challenges City of San Luis Obispo’s municipal budget and the budgets of our small businesses, which keep our communities thriving; and WHEREAS,many of our residents have lost their employer-sponsored health insurance during the current COVID-19 pandemic; and WHEREAS, studies by conservative and liberal economists show nearly all residents and employers would spend far less with the program described in the text of H.R. 1384, The Medicare for All Act of 2019, than they do today for health coverage including medical, dental, vision, hearing, and other care and prescription drugs; and WHEREAS,H.R. 1384 would provide every person in San Luis Obispo all necessary medical care including prescription drugs; hospital, surgical and outpatient services; primary and preventive care; emergency services; women’s reproductive care; dental and vision care; and long- term care; and WHEREAS,H.R. 1384 would improve the existing Medicare program, provide coverage without copays, deductibles, or other out-of-pocket costs, and would protect the medical decisions made by patients and their doctors, and assure patients an unrestricted choice of doctors; and WHEREAS,the quality of life for the residents of the City of San Luis Obispo will vastly improve because residents would have access to the ongoing care they need instead of waiting until they have a medical emergency that could upend their lives and burden them with debt. Packet Page 367 Item 18 Resolution No. _____ (2020 Series) Page 2 R ______ NOW, THEREFORE, BE IT RESOLVED by the Council of the City of San Luis Obispo supports H.R. 1384 and urges its passage. Upon motion of _______________________, seconded by _______________________, and on the following roll call vote: AYES: NOES: ABSENT: The foregoing resolution was adopted this _____ day of _____________________ 2020. ____________________________________ Mayor Heidi Harmon ATTEST: ____________________________________ Teresa Purrington City Clerk APPROVED AS TO FORM: _____________________________________ J. Christine Dietrick City Attorney IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of the City of San Luis Obispo, California, on _______________________. ____________________________________ Teresa Purrington City Clerk Packet Page 368 Item 18