The URL can be used to link to this page

Home My WebLink AboutItem 5h. Authorization to Advertise Mission Plaza Concept Plan Phase 1- Restroom, Cafe Kiosk, Art Kiosk, and Park Lighting Replacement Project (Spec. No. 91439-01) Item 5h Department: Public Works Cost Center: 5002 For Agenda of: 6/20/2023 Placement: Consent Estimated Time: N/A FROM: Matt Horn, Public Works Director Prepared By: Shelsie Moore, Supervising Civil Engineer SUBJECT: AUTHORIZATION TO ADVERTISE THE MISSION PLAZA CONCEPT PLAN PHASE 1 INCLUDING MISSION PLAZA RESTROOM, CAFÉ KIOSK, ART KIOSK, AND PARK LIGHTING REPLACEMENT PROJECT, SPECIFICATION NO. 91439-01 RECOMMENDATION 1. Approve the project plans and specifications for the Mission Plaza Restroom and Kiosk project1, Specification No. 91439-01; and 2. Authorize staff to advertise bids; and 3. Authorize the City Manager to award the Construction Contract for the bid total if the lowest responsible bid is within the Publicly Disclosed Funding Limit of $2,400,000; and 4. Authorize the City Engineer to approve Contract Change Orders up to the available project budget; and 5. Authorize staff to procure a temporary restroom trailer for the duration of the project within the available project budget; and 6. Approve the sole source of Steven Handelman Studios Light Fixtures including exterior wall fixtures and pedestrian park pole light fixtures for all Mission Plaza; and 7. Authorize the advertisement of a Request for Proposal (RFP) for a lease tenant for the Café Kiosk in a form approved by the City Attorney; and 8. Authorize the City Manager to execute the agreement with the preferred tenant. POLICY CONTEXT With adoption of the Fiscal Year 2021-23 Financial Plan, Council established a Major City Goal of Economic Recovery, Resiliency, and Fiscal Sustainability. Within that Major City Goal is the strategic approach for Downtown Vitality with efforts to focus on supporting infrastructure investments. The Mission Plaza improvements are included in the infrastructure investments the City is pursuing to meet the Major City Goal by activating a public space and increasing safety of the plaza. Additionally, this is an approved capital improvement plan project in the recently adopted 2023-25 Financial Plan that continues to support the Major City Goal of Economic Resiliency, Cultural Vitality, and Fiscal Sustainability. 1 Project title condensed to “Mission Plaza Restroom and Kiosk” for construction documents. Page 153 of 802 Item 5h On May 17, 2022, Council approved a Purchasing Policy Update which requires Council approval for Public Projects with a value of $200,000 or more. DISCUSSION Background In 2017, the City Council reviewed and adopted the Mission Plaza Concept Plan. A major component of the Concept Plan is to replace the existing restroom and install a new kiosk to activate the plaza. Since 2018, the City has been working with RRM Design Group to prepare design documents for this phase of the Mission Plaza Concept Plan to meet the needs of the City. In 2020 after several advisory body meetings, a Council Study Session was conducted to get direction for the final scope of the project. The project then proceeded through the entitlement process in 2022 and received approval from the Community Development Department for architectural review and consistency with the goals and policies of the City’s General Plan for development in the Downtown Area. The project is subject to conditions of approval including but not limited to protection of the Murray Adobe by hiring a qualified Architectural Historian to monitor construction work and Archeological Monitoring in compliance with the Archaeological Resource Preservation Program Guidelines due to the historic nature of the site. Project The project will include the replacement of the existing restroom within the Mission Plaza with a new restroom, construction of a small café kiosk, arts kiosk, creation of an outdoor seating area, and associated site improvements surrounding these buildings . Figure 1: Rendering of Project Site Design Page 154 of 802 Item 5h The project will activate the Mission Plaza adjacent to the restroom, café kiosk, and art kiosk. The project also includes improving accessibility (ADA) and enhancing safety through site lighting and security cameras. The project is ready to advertise for construction and the construction plans (Attachment A) and special provisions (Attachment B) have been prepared and reviewed through the Building Permit review process. During construction of the project, the City will need to provide temporary restroom facilities for the public. In order to accommodate the needs of the City for the duration of the project, staff is requesting authorization to enter into a contract for the use of a restroom trailer on an as needed basis within the available project budget. Staff is also requesting authorization to advertise a Request for Proposal (RFP) for a tenant to lease the Café Kiosk. Staff would like to secure a tenant for the space prior to completion of construction in order to be ready to fully activate the plaza ad jacent to all the new improvements. This RFP will be prepared in a form approved by the City Attorney and the final tenant agreement will be executed by the City Manager and City Attorney. Sole Source Justification This project’s architectural design is unique due to the historical significance of being within the Downtown Historic District. The Mission Plaza has a unique and special character that reflects the community’s culture and history. The City hired RRM to design this project through the on-call architectural design services agreement after a public request for proposal and competitive selection process. In order to complete the full design, RRM subcontracted with Steven Handelman Studios for custom light fixtures that complemented the architectural design of the new buildings as well as compliments the Mission. Due to the need to pay special attention to the details of th is design, staff recommends approving a sole source justification to use Steven Handelman Studios light fixtures throughout the project. Figure 2: Proposed Steven Handelman Studios Light Fixtures Page 155 of 802 Item 5h These lights are specifically designed to reflect and complement the historic district with key elements that pull in details from the Mission Era. The fixtures are custom designed and fabricated by Steven Handelman Studios with the goal of achieving a timeless and authentic appearance that threads the natural and built environment. They are manufactured in a way that replicates forged aged metal that complements the architecture of the Mission. Staff recommends sole sourcing these products within the Mission Plaza and to complete this project in accordance with Municipal Code 3.24.060(C) since these custom light fixtures can only be purchased from one supplier. Previous Council or Advisory Body Action On September 5, 2017, the Mission Plaza Concept Plan was adopted by City Council. After the Mission Plaza Concept Plan was adopted, staff proceeded with the Mission Plaza Restroom and Kiosk project. The project was presented to many advisory bodies and then presented to City Council for a study session on February 18, 2020. Next the conceptual design was presented to the Cultural Heritage Committee on April 25, 2022. The project was reviewed by the Community Development Director through the Architectural Review application and the conceptual project plans were approved on June 1, 2022 based on findings and subject to project conditions that have been incorporated into the final construction documents. Public Engagement This project received public input throughout the process due to the many advisory body meetings listed above. Additionally, this project has received fundin g in each financial plan since the 2015-17 Financial plan. The City engages the public during each financial plan process. CONCURRENCE There is concurrence from the Community Development Department through the architecture review process and during review and approval of the project for building permit issuance. The building permit will be obtained prior to the start of construction and will be issued to the Contractor following the award of a construction contract. This project also has concurrence from the Administration Department as they have reviewed the project throughout the design process and from the Finance Department through the review of the sole source justification of Steven Handelman Studios light fixtures. ENVIRONMENTAL REVIEW On June 1, 2022, the Community Development Director approved the Architectural Review application for the proposed project, and found the project categorically exempt from the California Environmental Quality Act (CEQA) under CEQA Guidelines Section 15301 (Class 1, Existing Facilities), Section 15302 (Class 2, Replacement or Reconstruction), and Section 15303 (Class 3, New Construction of Small Structures). The project remains consistent with the previous discretionary approval, and identified categorical exemptions, as it includes replacement of the restroom building on the same site, for the same purpose and capacity, an existing structure as described in CEQA Guidelines Section 15302 (Replacement or Reconstruction); construction of a small kiosk Page 156 of 802 Item 5h building to be put to uses which are allowed in the Public Facilities (PF) Zone, with all necessary services and facilities available, as described in CEQA Guidelines Section 15303 (New Construction of Small Structures); and creation of an outdoor seating area through minor alteration of an existing public facility, as described in CEQA Guidelines Section 15301. The project is consistent with the applicable general plan policies as well as with applicable City Regulations. A Notice of Exemption will be filed through the Community Development Department upon Council approval of the project and confirmation of CEQA findings. FISCAL IMPACT The Mission Plaza Restroom and Kiosk project has been receiving funding since 2016. The table below shows the funding received to date. Prior Funding for Mission Plaza Restroom and Kiosk 2016-17 2017-18 2018-19 2019-20 2020-21 2021-22 2022-23 TOTAL $80,000 $0 $25,000 $45,000 $150,000 $0 $1,035,000 $1,335,000 The project account has a current balance of $922,785 to use toward construction. In Fiscal Year 2023-24, $2,429,972 will be added to the project account with Council’s approval of the 2023-25 Financial Plan. Of this amount, $2,354,302 is allocated for this project and $75,670 is allocated for the continuation of Mission Plaza Concept Plan Implementation in the primary plaza area. The proposed project is recommended to be awarded after July 1, 2023 when the next fiscal year funding is available. This project is structured with only a base bid due to the need to complete the entire project at this time for cost efficiencies. The project’s Construction Engineer’s Estimate is $2,250,000, but staff is recommending allowing the City Manager to award the construction contract if the lowest responsible bid is within the Publicly Disclosed funding amount of $2,400,000 in compliance with Public Contract Code Section 20103.8(c). This will allow staff to award the project and stay on schedule for construction if prices come in slightly higher than the engineer’s estimate. Mission Plaza Restroom and Kiosk Construction Estimate Restroom Building $550,000 Kiosk Building $250,000 Site Work(Including Lighting) $1,450,000 Total Engineer’s Estimate $2,250,000 Construction Contingency (23%) $510,000 Total Construction Estimate $2,760,000 Budgeted: Yes Budget Year: Ongoing Funding Identified: Yes Page 157 of 802 Item 5h Fiscal Analysis: Funding Sources Total Budget Available Current Funding Request Remaining Balance Annual Ongoing Cost General Fund $922,785 $922,785 $0 N/A State Federal Fees Other: General Fund: 2023-24 Funding Request for this Project $2,354,302 $2,354,302 Total $3,277,087 $3,277,087 $0 N/A The table below shows all estimated project costs to complete the project within the available budget if the bids come in under the Publicly Disclosed Funding Limit of $2,400,000. The project will require hiring many consultant services including a communications consultant, construction management consultant, archeological monitor, historian monitor, design consultant support, and special inspector. The City will also need to rent a temporary restroom for the duration of the project to support the plaza during construction. Project Account (2091439 - LRM) Publicly Disclosed Funding Limit:2,400,000$ Contingency (15%):360,000$ Construction Total:2,760,000$ Printing and Advertising 1,000$ Communications Consultant 20,000$ Construction Management 300,000$ Archeological and Historian Monitoring 25,000$ Design Consultant Construction Support 30,000$ Material Testing and Special Inspection 40,000$ Temporary Restrooms during Construction 100,000$ Total Project Costs:3,276,000$ Current Project Balance:922,785$ Project Budget Available July 1, 2023:2,354,302$ Total Available Budget:3,277,087$ Post Project Remaining Balance:1,087$ Mission Plaza Restroom and Kiosk, Specification 91439 Page 158 of 802 Item 5h ALTERNATIVES 1. Deny Authorization to Advertise the project. This alternative is not recommended by staff because the project is planned for construction this summer and delay in advertising will affect the completion of the project. 2. Deny Approval of the Sole Source of Steven Handelman Studios Light Fixtures for the Mission Plaza and pursue procurement of alternate light designs. This alternative is not recommended as the City would have to change the design and would therefore delay construction and completion of the project. ATTACHMENTS A - Project Plans (Spec. 91439-01) B - Special Provisions (Spec. 91439-01) C - Sole Source Justification for Steven Handelman Studios Light Fixtures Page 159 of 802 Page 160 of 802 CITY LIMITSCITY LIMITSReference Documents:City Standard Specifications - August 2020 EditionCity Engineering Standards - August 2020 EditionDATUM:SAN LUIS OBISPO COUNTY, CALIFORNIAMISSION PLAZARESTROOM & KIOSKAPPROVED BYSPECIFICATION NO.DATE SHEETBrian A. Nelson, City Engineer R.C.E. C79870 Approved DateMAY 12, 202391439-01FILE NO./LOCATIONNo. C 79870G001TOPOGRAPHIC SURVEYPREPARED BY: WALLACE GROUPDATE:JANUARY, 2016PROJECT No.: 0061-00840256-03-CU20SURVEY NOTES1. ALL MEASUREMENTS LISTED, SHOWN AND REPRESENTED HEREONARE BASED ON GROUND DISTANCES.2. THE CONTOUR INTERVAL IS 1 FOOT.3. THIS SURVEY WAS DONE FOR THE PURPOSE OF MASTER PLAN DESIGNFOR THE MISSION PLAZA AND SURROUNDING STREETS.4. UNDERGROUND UTILITY LOCATIONS ARE PLOTTED BASED ON ABOVEGROUND PAINT MARKS BY OTHERS, ABOVE GROUND SURFACESTRUCTURES. ACTUAL LOCATION MAY DIFFER. ADDITIONALUNDERGROUND UTILITY LINES MAY EXIST. FOR MORE INFORMATIONREGARDING UTILITY LOCATION, SIZE, DEPTH, CONDITION, ANDCAPACITY CONTACT UTILITY OR MUNICIPAL/PUBLIC SERVICE FACILITY.5. UNDERGROUND PIPE SIZES ARE BASED ON VISUAL OBSERVATIONSMADE FROM THE SURFACE AND ARE APPROXIMATE.6. EASEMENTS AFFECTING THE PROPERTY SHOWN HEREON MAY EXIST.NO TITLE INFORMATION WAS PROVIDED. NO ATTEMPT HAS BEENMADE TO PLOT EASEMENTS.HORIZONTAL CONTROL FOR POINTS 8044 & 8046 AS PUBLISHEDIN THE CITY OF SAN LUIS OBISPO 2007 HORIZONTAL CONTROLNETWORK. CITY NETWORK IS BASED ON THE NORTH AMERICANDATUM OF 1983 (NAD83) EPOCH DATE 1991.35, ZONE 5CALIFORNIA. POINT 8046 BEARS NORTH 88° 16' 09.74" EAST1240.47'VERTICAL CONTROL IS BASED ON THE CITY OF SAN LUIS OBISPOBENCHMARK SYSTEM 2007 AND REFERENCED BY BENCHMARKNO. 373 WITH AN ELEVATION OF 193.02'. POSITION IS NOTSHOWN. CITY'S BENCHMARK SYSTEM IS BASED ON THE NORTHAMERICAN VERTICAL DATUM OF 1988 (NAVD88).sheet no. descriptionGENERALG001 TITLE SHEETG002 GENERAL NOTESG003 CONDITIONS OF APPROVALCIVILCD101 DEMOLITION PLANCG101 HORIZONTAL CONTROL PLANCG102 GRADING, DRAINAGE & UTILITY PLANCG103 EROSION CONTROL PLANARCHITECTURALG-101 GENERAL NOTES & FINISH SCHEDULEG-103 ACCESSIBILITY DETAILSG-104 ACCESSIBILITY DETAILSG-105 CAL GREEN REQUIREMENTSG-106 CAL GREEN REQUIREMENTSG-107 CAL GREEN REQUIREMENTSAK101 FLOOR PLAN & DOOR SCHEDULEAK201 ROOF PLANAK103 REFLECTED CEILING PLANAK301 EXTERIOR ELEVATIONS & SECTIONAK501 INTERIOR ELEVATIONSAK601 WALL SECTIONSAR101 FLOOR PLAN & DOOR SCHEDULEAR102 ROOF PLANAR103 REFLECTED CEILING PLANAR301 EXTERIOR ELEVATIONSAR302 EXTERIOR ELEVATIONSAR401 BUILDING SECTIONSAR501 INTERIOR ELEVATIONSAR601 WALL SECTIONSA-901 DETAILSA-902 DETAILSA-903 DETAILSA-911 ADOBE DETAILSLANDSCAPE ARCHITECTURALTP001 TREE PROTECTION PLANTP501 TREE PROTECTION DETAILS & NOTESLC001 CONSTRUCTION NOTESLC101 CONSTRUCTION PLANLC501 CONSTRUCTION DETAILSLC502 CONSTRUCTION DETAILSLC503 CONSTRUCTION DETAILSLC504 CONSTRUCTION DETAILSLC505 CONSTRUCTION DETAILSLI101 IRRIGATION PLANLI201 IRRIGATION HYDROZONE PLANLI501 IRRIGATION DETAILSLI502 IRRIGATION DETAILSLP101 PLANTING PLANLP501 PLANTING DETAILSSTRUCTURALS-101 SHEET INDEX, ABBREVIATIONS & SYMBOLSS-102 GENERAL NOTESS-103 GENERAL NOTESS-104 GENERAL NOTESS-105 SPECIAL INSPECTIONS & TESTSS-201 RESTROOM FOUNDATION & ROOF FRAMING PLANS-211 KIOSK FOUNDATION & ROOF FRAMING PLANS-221 CMU ELEVATIONSS-301 TYPICAL CONCRETE DETAILSS-302 TYPICAL CONCRETE DETAILSS-303 FOUNDATION DETAILSS-401 TYPICAL MASONRY DETAILSS-402 TYPICAL MASONRY DETAILSS-403 TYPICAL MASONRY DETAILSS-404 TYPICAL STEEL DETAILSS-405 TYPICAL STEEL DETAILSS-406 TYPICAL STEEL DETAILSS-407 TYPICAL STEEL DETAILsS-411 STEEL DETAILSS-412 STEEL DETAILSELECTRICALE-001 ELECTRICAL NOTES, LEGEND, AND ABBREVIATIONSE-002 SINGLE LINE DIAGRAM AND FIXTURE SCHEDULEE-003 ELECTRICAL DETAILSE-004 ELECTRICAL DETAILSE-005 ELECTRICAL DETAILSE-006 ELECTRICAL DETAILSE-007 ELECTRICAL DETAILSE-008 ELECTRICAL DETAILSED-101 ELECTRICAL DEMOLITION SITE PLANED-102 EXISTING ELECTRICAL SITE PLANEK-101 ELECTRICAL KIOSK FLOOR PLANSER101 ELECTRICAL RESTROOM FLOOR PLANSES-101 ELECTRICAL SITE PLANET24101 ENERGY COMPLIANCE DOC. - INTERIOR LIGHTING(RESTROOM)ET24102 ENERGY COMPLIANCE DOC.-INTERIOR LIGHTING (KIOSK)PLUMBINGP1.0 PLUMBING NOTES, SCHEDULES, LEGEND &ABBREVIATIONSP2.0 PLUMBING DETAILSP3.0 PLUMBING FLOOR PLANS (RESTROOMS) WASTE ANDWATERP3.1 PLUMBING FLOOR PLANS (KIOSK) WASTE AND WATERindex to planssheet no. description100% CONSTRUCTIONDRAWINGSPhone:Fax:OWNERCity of San Luis Obispo Public Works990 Palm StreetSan Luis Obispo, CA 93401Shelsie Moore, Supervising Civil Engineer805-783-7735Phone:Fax:ARCHITECT / LANDSCAPE ARCHITECT / CIVIL / STRUCTURALRRM Design Group3765 S. Higuera St. Ste 102San Luis Obispo, CA 93401Kathryn Hicks, Project Manager(805) 543-1794(805) 543-4609Phone:Fax:ELECTRICAL ENGINEERThoma Electric3562 Empleo St., Ste. CSan Luis Obispo, CA 93401Christopher Jose(805) 543-3850SCOPE OF WORKPROJECT GENERALLY INCLUDES, BUT IS NOT LIMITED TO:xDEMOLITION OF EXISTING SITE IMPROVEMENTS, INCLUDING RESTROOM BUILDING,TRELLIS STRUCTURE, STONE WALLS, CURBS, GUTTERS, SIDEWALKS, EXISTINGUTILITIES, AND SELECT TREES AND LANDSCAPING.xCONSTRUCTION OF 504 SF SITE BUILT RESTROOM BUILDING AND 165 SF SITE BUILTKIOSK AND ASSOCIATED FOUNDATIONS AND UTILITIES.xCONSTRUCTION OF SURROUNDING PLAZA AND PATIO SPACE, INCLUDING BRICKPAVEMENT, SEATWALLS, STAIRS, GRANITECRETE PATIO, METAL RAILINGS, BARSEATING AREA AND DIGITAL ART KIOSK.xSITE UTILITES, INCLUDING NEW DOMESTIC WATER SERVICE, SEWER, AND ELECTRICAL.xSITE FURNISHINGS, INCLUDING BENCHES, TABLES, PLANTER POTS, DRINKINGFOUNTAIN, LIGHT POLES, AND STRING LIGHTS.xNEW IRRIGATION TO TIE INTO EXISTING SYSTEM.xNEW LANDSCAPE BOULDERS AND TREE, SHRUB, AND TURF-GRASS PLANTING,INCLUDING LARGE BOX SPECIMEN OLIVE TREES AT GRANTECRETE PATIO.PROJECT DIRECTORYEn.01 PLUMBING ENERGY COMPLIANCEPage 161 of 802 >>^^^^SDPROPERTY/RIGHT-OF-WAY LINECENTER LINESAWCUT AND CONFORM LINELIMIT OF WORKFENCE LINEFLOW LINEGRADE BREAKTREE PROTECTION ZONESTRIPINGTYPE II SLURRY SEALEXISTING POLE LIGHTPROPOSED POLE LIGHTPROPOSED DRINKING FOUNTAIN/BOTTLEFILLERSTORM DRAIN LINEWATER LINEROWLIMIT OF WORKGBWWSSSDOHEXISTING MANHOLEEXISTING SIGNEXISTING WATER VALVEEXISTING CLEANOUTEXISTING WATEREXISTING SEWEREXISTING STORM DRAINEXISTING OVERHEAD LINESEXISTING MAJOR CONTOUREXISTING MINOR CONTOURPROPOSED MAJOR CONTOURPROPOSED MINOR CONTOUR315S315315315ABBREVIATIONSAB AGGREGATE BASEAC ASPHALT CONCRETEAP ANGLE POINTARV AIR RELEASE VALVEBCR BEGIN CURVEBW BACK OF WALKCB CATCH BASINCL/CL. CENTERLINE/CLASSCMP CORRUGATED METAL PIPECONC. CONCRETEDBH DIAMETER AT BREAST HEIGHT [OF A TREE]DI DRAIN INLETDIP DUCTILE IRON PIPEEG EXISTING GRADEEX. EXISTINGELEV ELEVATIONFDC FIRE DEPARTMENT CONNECTIONFG FINISHED GRADEFL FLOWLINEFS FINISHED SURFACEFFE FINISHED FLOOR ELEVATIONFW FIRE WATERHP HIGH POINTIPS IRON PIPE SIZEJT JOINT TRENCHLP LOW POINTMAX. MAXIMUMEL. MINIMUMNTS NOT TO SCALEPL PROPERTY LINEPCL PARCELPCC PORTLAND CEMENT CONCRETEPOC POINT OF CURVE/POINT OF CONNECTIONPOT POINT OF TANGENTPRC POINT OF REVERSE CURVEROW RIGHT OF WAYRET. WALL RETAINING WALLRP REDUCED PRESSURERW RECYCLED WATERSD STORM DRAINSFM SEWER FORCE MAINSL STREET LIGHT/SERVICE LATERALSS SANITARY SEWERSTA STATIONSTD. STANDARDTBD TO BE DETERMINEDTBM TEMPORARY BENCHMARKTC TOP OF CURBTF TOP OF FOOTINGTP TOP OF PAVEMENTTG TOP OF GRATETYP. TYPICALTW TOP OF WALLUON UNLESS OTHERWISE NOTEDWWATERWSE WATER SURFACE ELEVATIONTHE PROJECT CONSISTS OF:xSIDEWALK AND PLAZA RECONSTRUCTIONxBUILDING DEMOLITIONxBUILDING CONSTRUCTIONxLANDSCAPING & IRRIGATIONxNET IMPERVIOUS AREA OF LESS THAN 5,000 SQUARE FEETTHE PROJECT IS A REGULATED PROJECT SUBJECT TO CENTRAL COAST POST-CONSTRUCTION STORMWATER REQUIREMENT 1 PER RESOLUTION R3-2013-0032. REFERTO PROJECT STORMWATER CONTROL PLAN APPLICATION FOR FURTHER DETAILS.STORMWATER COMPLIANCEGENERAL NOTESG002EARTHWORK QUANTITIESAREA OF DISTURBANCE:6,700 SQUARE FEETMAXIMUM CUT HEIGHT: 1 FOOTMAXIMUM FILL HEIGHT:2 FEETRAW CUT: 80 CUBIC YARDSRAW FILL:70 CUBIC YARDSADJUSTED FILL:(ASSUME 0% SHRI NK/SWELL)70 CUBIC YARDSNET QUANTITY:10 CUBIC YARDS EXPORTTHE APPROXIMATE RAW EARTHWORK QUANTITIES SHOWN HEREON REPRESENT THE ESTIMATED VOLUMETRIC DIFFERENCE CALCULATED BETWEEN THE PROPOSEDSUBGRADE AND ESTIMATED EXISTING SUBGRADE SURFACE, AND ARE SUBJECT TO CHANGE. THESE ESTIMATES DO NOT INCLUDE CONSIDERATIONS FOR LOSSES ORBULKING DUE TO: SOIL AMENDMENTS, STABILIZATION, CONSTRUCTION TECHNIQUE, FOOTING & TRENCHING SPOILS, ETC. THESE CONSIDERATIONS, IN ADDITION TOACTUAL FIELD CONDITIONS AND THE FINAL RECOMMENDATIONS OF THE GEOTECHNICAL ENGINEER, MAY SIGNIFICANTLY EFFECT THE FINAL IMPORT/EXPORTQUANTITIES. APPROXIMATE QUANTITIES SHOWN ON THESE PLANS ARE FOR PERMITTING PURPOSES ONLY. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TOCALCULATE ACTUAL QUANTITIES FOR THE PURPOSE OF CONSTRUCTION AND COST ESTIMATES. CONTRACTOR IS ALSO RESPONSIBLE FOR ADJUSTMENTS TO SLOPEHINGE POINTS IN ORDER TO PROVIDE GRADED PAD AREA ADJACENT TO PATHS, WALKWAYS, AND ROADS FOR UTILITY BOXES, TRANSFORMERS, AND ABOVE GROUNDUTILITY INFRASTRUCTURE.APPROXIMATE RAW EARTHWORK QUANTITIES SHOWN ABOVE FOR BIKE PATH AREA BETWEEN FOOTHILL BLVD AND RAMONA DRIVE ONLY. APPROXIMATE RAWEARTHWORK QUANTITIES FOR REMAINING PROJECT AREAS ARE NOT PROVIDED. CONTRACTOR IS RESPONSIBLE FOR ANY/ALL MATERIALS QUANTITIES, EARTHWORKQUANTITIES ASSOCIATED WITH WORK SHOWN HEREIN. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO CALCULATE ACTUAL QUANTITIES FOR THE PURPOSE OFBIDDING, COST ESTIMATES AND CONSTRUCTION.PROJECT SOILS REPORTPREPARED BY:EARTH SYSTEMS PACIFIC4378 OLD SANTA FE ROADSAN LUIS OBISPO, CA 93401DATE:OCTOBER 21, 2022UPDATED:N/AREPORT NAME:GEOTECHNICAL ENGINEERING REPORTMISSION PLAZA RESTROOM AND CAFESAN LUIS OBISPO, CALIFORNIAPREPARER:Robert Down, PELICENSE: PE 70206XXXNLSNLS1. ALL WORK SHALL BE PERFORMED IN CONFORMANCE WITH THESE PLANS, SPECIAL PROVISIONSPREPARED FOR THIS PROJECT AND THE 2020 CITY OF SAN LUIS OBISPO STANDARDSPECIFICATIONS AND ENGINEERING STANDARDS, IN CONJUNCTION WITH THE STATE OFCALIFORNIA DEPARTMENT OF TRANSPORTATION STANDARD SPECIFICATIONS AND STANDARDPLANS, 2015 EDITION (UNREVISED), AND LATEST EDITION OF CALIFORNIA MUTCD.2. IT SHALL BE THE RESPONSIBILITY OF THE CONTRACTOR OR PERMITTEE TO CONTACT"UNDERGROUND SERVICE ALERT OF NORTHERN/CENTRAL CALIFORNIA" BY PHONE AT 8-1-1FORTY-EIGHT (48) HOURS PRIOR TO START OF CONSTRUCTION FOR LOCATION OF POWER,TELEPHONE, OIL AND NATURAL GAS UNDERGROUND FACILITIES. CONTRACTOR OR PERMITTEESHALL ALSO CONTACT THE APPROPRIATE AGENCY FOR THE LOCATION OF CABLE T.V., WATER,SEWER, DRAINAGE OR UNDERGROUND FACILITIES.3. THESE PLANS DO NOT INDICATE ALL EXISTING FACILITIES IN THE VICINITY OF THE PROPOSEDWORK SUCH AS EXISTING IRRIGATION HEADS AND LINES, SHRUBBERY AND VEGETATION, ETC.THE CONTRACTOR MUST USE CARE TO AVOID DAMAGE TO ANY EXISTING IMPROVEMENTS ORVEGETATION IN THE VICINITY OF THE WORK, AND MUST REPAIR ANY FACILITIES DAMAGE DURINGCONSTRUCTION TO THE SATISFACTION OF THE ENGINEER.4. WHERE TRIMMING OF EXISTING VEGETATION IS REQUIRED DURING CONSTRUCTION IT MUST BEDONE IN A MANNER TO REMOVE THE MINIMUM POSSIBLE AMOUNT OF VEGETATION AND LEAVETHE REMAINING IN AN ATTRACTIVE CONDITION. CONTRACTOR MUST COORDINATE WITH CITYARBORIST PRIOR TO TRIMMING OF ANY VEGETATION.5. PROTECT TREE BRANCHES, TRUNK, ROOTS AND FOLIAGE THROUGH PROPER TRIMMING ANDCONSTRUCTION TECHNIQUES WHENEVER POSSIBLE PER CITY STD SECTION 20.6. THESE PLANS DO NOT INDICATE ALL OVERHEAD LINES. CONTRACTOR SHALL TAKE CARE DURINGCONSTRUCTION TO AVOID CONTACT WITH OR DAMAGE TO EXISTING OVERHEAD LINES.7. ANY EXISTING UTILITIES AND IMPROVEMENTS THAT BECOME DAMAGED DURING CONSTRUCTIONSHALL BE COMPLETELY RESTORED TO THE SATISFACTION OF THE ENGINEER AT THECONTRACTOR'S SOLE EXPENSE.8. CONTRACTOR SHALL CONTACT ALL UTILITY COMPANIES AND AGENCIES WITH SERVICES IN THEAREA PRIOR TO COMMENCING CONSTRUCTION ACTIVITIES AND COORDINATE WITH THE UTILITYCOMPANIES AFFECTED BY CONSTRUCTION.9. PROTECT SURVEY MONUMENTS IN PLACE DURING CONSTRUCTION. THE CONTRACTOR SHALL BERESPONSIBLE FOR ALL COSTS ASSOCIATED WITH THE REPLACEMENT OF DAMAGED ORDISPLACED SURVEY MONUMENTS AND SHALL NOTIFY THE CITY FIVE (5) WORKING DAYS PRIORTO RESTORING MONUMENTS. MONUMENTS SHALL BE RESET BY A CALIFORNIA LICENSED LANDSURVEYOR AND SHALL INCLUDE PREPARING AND FILING A CORNER RECORD WITH SAN LUISOBISPO COUNTY.10. ALL STRIPING AND MARKINGS SHALL BE PER CALTRANS REVISED STANDARD PLANS 2015 -A20A,A20B, A20C, A20D, A24A, A24B, A24C, A24D, AND A24E. ANY STRIPING NOT MARKED FOR REMOVALSHALL BE PROTECTED IN PLACE. SEE SPECIAL PROVISIONS SECTION 84.11. ALL CURB, GUTTER, AND SIDEWALK IMPROVEMENTS SHALL BE COMPLETED PRIOR TO THESTART OF PAVING WORK.12. CONCRETE SIDEWALKS MUST CONFORM TO ENGINEERING STANDARDS 4110 & 4220.13. REMOVAL AND REPLACEMENT OF EXISTING CONCRETE SHALL CONFORM TO ENGINEERINGSTANDARD 4910.14. ALL EQUIPMENT SUBMITTALS, INCLUDING PATH/STREET LIGHTING, SIGNS, ETC. SHALL BEAPPROVED BY CITY PRIOR TO INSTALLATION.15. CONTRACTOR SHALL BE RESPONSIBLE FOR LOCATING UTILITY COVERS IN FIELD.16. PROTECT UTILITY COVERS IN PLACE. ENSURE EXCESSIVE LIP BETWEEN COVER AND SLURRYDOES NOT FORM. THERMOPLASTIC STRIPING PLACED ON CONCRETE REQUIRES A PRIMER COATPRIOR TO APPLICATION.GENERAL NOTES:LEGEND:CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTHE PROJECT PROPERTY IS LOCATED WITHIN A FLOOD ZONE AS MAPPED BY FEMA MAP NUMBER 06079C1068G DATED NOVEMBER 16, 2012. THE LIMITS OF FLOODZONE AE ARE DEPICTED ON THE GRADING AND DRAINAGE PLAN SHEET. ALL PROPOSED STRUCTURES AND UTILITIES SHOWN ON THESE PLANS COMPLY WITH THECITY OF SAN LUIS OBISPO DRAINAGE DESIGN MANUAL AND FLOODPLAIN MANAGEMENT REGULATIONS.FLOODPLAIN AND DRAINAGE COMPLIANCEADDITIONAL NOTES:1. ALL WORK LOCATED WITHIN THE PUBLIC RIGHT-OF-WAY OR WITHIN THE JURISDICTION OF THEUTILITIES AND PUBLIC WORKS DEPARTMENTS SHALL COMPLY WITH THE MOST CURRENTEDITION OF THE ENGINEERING STANDARDS AND SPECIFICATIONS.2. A SEPARATE ENCROACHMENT PERMIT IS REQUIRED FOR ANY WORK IN THE PUBLICRIGHT-OF-WAY, WITHIN CITY EASEMENTS, OR FOR CONNECTIONS FOR PUBLIC UTILITIES. WORKREQUIRING AN ENCROACHMENT PERMIT INCLUDES BUT IS NOT LIMITED TO DEMOLITIONS,UTILITIES, WATER, SEWER, AND FIRE SERVICE LATERALS, CURB, STREET TREE PLANTING ORPRUNING, CURB RAMPS, STREET PAVING, AND PEDESTRIAN PROTECTION OR CONSTRUCTIONSTAGING IN THE RIGHT-OF-WAY.3. ANY SECTIONS OF DAMAGED OR DISPLACED CURB, GUTTER & SIDEWALK, OR DRIVEWAYAPPROACH SHALL BE REPAIRED OR REPLACED TO THE SATISFACTION OF THE PUBLIC WORKSDIRECTOR.4. CONTACT THE PUBLIC WORKS INSPECTION HOTLINE AT 781-7554 WITH AT LEAST A 48-HOURNOTICE FOR ANY REQUIRED ENCROACHMENT PERMIT INSPECTION OR FINAL INSPECTION.5. THE ADJOINING STREET SHALL BE CLEANED BY SWEEPING TO REMOVE DIRT, DUST, MUD ANDCONSTRUCTION DEBRIS AT THE END OF EACH DAY.6. A TRAFFIC AND PEDESTRIAN CONTROL PLAN SHALL BE SUBMITTED TO THE PUBLIC WORKSDEPARTMENT FOR REVIEW AND APPROVAL PRIOR TO ENCROACHMENT PERMIT ISSUANCE.7. ANY EXISTING SURVEY MONUMENTS SHALL BE PROTECTED IN PLACE OR SHALL BE TIED OUT BYA LICENSED LAND SURVEYOR PRIOR TO DISTURBANCE AND THEN REPLACED PRIOR TOOCCUPANCY IN ACCORDANCE WITH SECTION 8771 OF THE CALIFORNIA BUSINESS ANDPROFESSIONS CODE.8. EROSION CONTROL MEASURES SHALL BE IMPLEMENTED AND MAINTAINED TO THESATISFACTION OF THE BUILDING OFFICIAL AND PUBLIC WORKS DIRECTOR DURING ALLDEMOLITIONS, CONSTRUCTION AND GROUND DISTURBING ACTIVITIES.Page 162 of 802 CONDITIONS OF APPROVALG003XXXNLSNLSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS1. As conditioned, the project is consistent with the goals and policies of the City’s General Plan for development in the Downtown Area andfor Public and Cultural Facilities (Land Use Element (LUE) §§ 4 & 5) and with policies and programs for the treatment of Cultural Resources(Conservation and Open Space Element (COSE) § 3). The project improves and enhances Mission Plaza’s function as a space to accommodatepublic socialization in a setting which is festive and comfortable for public gatherings, walking, and sitting (LUE §§ 4.4 & 4.5). The reconstructedrestroom facilities are sited and designed such that the space is observable from the Plaza walkway and adjacent streets, and the multi-use kioskbuilding “activates” the space, to enhance public safety (LUE §§ 4.8 & 4.9). The style and character of the new buildings have been carefullyconsidered for compatibility with architecturally and historically significant buildings adjacent to the Plaza and in the Downtown Historic District,and the project involves no changes to the historic Murray Adobe (COSE §§ 3.3.1, 3.3.5, & 3.6.3). Condition of approval #3 requires anarcheological monitoring plan to be prepared and implemented, for the protection of, and avoidance of adverse effects on, potentialarchaeological resources, consistent with the City’s Archaeological Resource Preservation Program Guidelines (COSE §§ 3.5.1 & 3.5.4).2. The project conforms to the standards set forth in the City’s Zoning Regulations. The proposed replacement restrooms, new kiosk, and newoutdoor seating area will provide amenities for continued public use of the property within a Public Facility (PF) Zone and are designed and sitedin a manner consistent with applicable Property Development Standards (Zoning Regulations § 17.10.020 & Ch. 17.48).3. On April 25, 2022, the Cultural Heritage Committee found the project, as conditioned, to be consistent with the City’s Historic PreservationOrdinance (SLOMC Ch. 14.01) and with the supporting Historical Preservation Program Guidelines (HPPG). The property is located within theDowntown Historic District. Consistent with guidelines for construction in historic districts (HPPG §§ 3.1 & 3.2), proposed new buildings are oflimited size and scale, their materials, colors, and detailing have been carefully considered for architectural compatibility with the style anddetails exhibited by important historic buildings in the Downtown Historic District, without seeking to directly copy or mimic these buildings, andthey have been sited in a manner that enhances views through to the Murray Adobe from the street (HPPG §§ 3.2.1 & 3.2.2). Condition of approval#2 requires implementation of monitoring during construction activities to provide protection guidance for work adjacent to the Murray Adobe,and attention to appropriate surface treatment adjacent to the building to protect it from further moisture damage.4. The project is consistent with Community Design Guidelines, including Downtown Design Guidelines (CDG Ch. 4). The proposed buildingsare designed with consideration of the site context, incorporating local themes inspired by nearby historic buildings within the DowntownHistoric District, and employ authentic building styles, design elements, and materials (§§ 1.4 (A), 2.1, & 4.2 (D)).5. The work proposed under the project is categorically exempt from further environmental review, described in the Guidelines forImplementation of the California Environmental Quality Act (CEQA Guidelines). It involves: replacement of the restroom building on the same site,for the same purpose and capacity, an existing structure as described in Guidelines§ 15302 (Replacement or Reconstruction); construction of a small kiosk building to be put to uses which are allowed in the Public Facilities(PF) Zone, with all necessary services and facilities available, as described in Guidelines § 15303 (New Construction of Small Structures); andcreation of an outdoor seating area through minor alteration of an existing public facility, as described in Guidelines § 15301.Please note the project conditions of approval do not include mandatory code requirements. Codecompliance will be verified during the plan check process, which may include additionalrequirements applicable to the project.Planning1. Conformance to approved plans. Final project design and construction drawings submittedfor building permits shall be in substantial compliance with the plans approved by thisapplication, and with all conditions of approval. A separate full-size sheet shall be includedin plans submitted for permits, listing all conditions of project approval. Reference shall bemade in the margin of the listed conditions as to where in plans requirements are addressed. Anychange to approved design, colors, materials, landscaping or other conditions ofapproval must be reviewed and approved by the Community Development Director.2. Adobe Protection. A qualified Historic Architect or Architectural Historian withdemonstrated experience working with Adobe structures shall be retained to monitor andprovide protection guidance for any work in the immediate vicinity of the perimeter of theMurray Adobe. Final plans for construction permits to complete this project shall note thisrequirement and construction permits shall not be issued until a monitoring plan has beenapproved by the Community Development Director. Improvements adjacent to the base andperimeter of the Adobe shall be limited to decomposed granite, pea gravel, or similar surface,appropriately sloped to promote drainage away from the building and protect the buildingfrom damage by moisture, runoff, or new vegetation.3. Archaeological Monitoring. The applicant shall provide an archeological monitoring planprepared by a City-qualified archeologist to be implemented during construction. The planshall identify the qualified professional who will conduct the monitoring and circumstanceswhere a Native American tribal representative or qualified site monitor is required. The planshall recommend specific procedures for responding to the discovery of archeologicalresources during the construction of the project consistent with § 4.60 of the ArchaeologicalResource Preservation Program Guidelines. The plan shall be submitted as a part of thebuilding permit.Engineering4. Plans submitted for construction permits to complete the project shall include an overall siteplan depicting the existing structures, demolitions, new structures, site improvements, andall trees and their disposition.5. Plans submitted for construction permits to complete the project shall include a utility planshowing existing and proposed utility services for reference. The plan shall show the limitsof existing, new, replaced, abandoned, and relocated services where applicable.6. Plans submitted for construction permits to complete the project shall include a grading anddrainage plan to show the limit and extent of grading and drainage modifications to the plaza.Improved and re-directed drainage shall be conveyed in a non-erosive manner to an approvedoutlet.7. Plans and materials submitted for construction permits to complete the project shall showand note compliance with the City’s Floodplain Management Regulations, Drainage DesignManual (DDM), and Post Construction Stormwater Regulations (PCR). The plans andsupporting documents shall show that the new structures are located above or outside themapped Special Flood Hazard Area. The submittal shall include a summary drainage reportin accordance with § 2.3.1 of the Drainage Design Manual. DDM compliance may bedocumented as a minor project in a format provided by the city. Post ConstructionStormwater Regulations compliance documentation should clearly describe the relationshipof this first phase of the Mission Plaza Concept Plan to the overall Concept Plan project. Thephased development approach and PCR compliance strategy shall be resolved with the first phase ofpermitting to the satisfaction of the Community Development and Public Worksdepartments.8. The City supports the proposed tree removals and relocations with compensatory planting asestablished by the City Arborist. The building permit plan submittal shall include a treepreservation plan per City Standards and Specifications, to the satisfaction and approval ofthe City Arborist.Utilities9. Plans and materials submitted for construction permits to complete the project shall indicatethe provision of separate water meters for domestic (for bathroom and café) and landscapeservice. It is noted that the site has one existing two-inch water meter that can be modifiedto provide two meters (3/4” or 1”), as needed.10. Plans and materials submitted for construction permits to complete the project shall identify,depict, and describe existing and proposed storage for three waste streams (trash, recycling,and organics) and proposed methods of collection (i.e., Parks Maintenance, San LuisGarbage service, etc.).CONDITIONSFINDINGSSee sheet LC101 for Construction Plan.See sheet CD101 for Demolition Plan.See sheet TP001 for Tree Protection Plan.See sheet CG102 for Utility Plan.See sheet CG102 for Grading and DrainagePlan.See sheet TP001 for Tree PreservationPlan and TP501 for Tree Protection Details.New domestic water service has beenprovided. See sheet CG102.Sheet LC101 includes (2) permanent triplewaste stream receptacles placed in theplaza. It also includes a trash enclosureadjacent to the building which will holdrolling receptacles. See note 5 on sheet.REFERENCESee sheet CG102 for Grading and DrainagePlan, Stormwater Control Plan application,and summary drainage memorandum.See the current sheet.See Note 6 on LC101. See details on CG101and LC101 for paving conditions adjacentto the Adobe.Sheet A-911 added to plan set to documentrequired Adobe preservation work.Historian report added to SpecialProvisions as Appendix C.In process. Consultant is being hired bythe City.Monitoring report will be provided as partof Special Provisions as Appendix D.Page 163 of 802 NOTES1.THE EXISTING SITE CONDITIONS SHOWN HEREIN HAVE BEEN COMPILED BASED ONTOPOGRAPHIC FIELD SURVEYS AND AS-BUILT DRAWINGS OF THE EXISTINGIMPROVEMENTS. IT IS THE RESPONSIBILITY OF THE PROJECT CONTRACTOR TO VERIFYFIELD CONDITIONS, ESPECIALLY AT CRITICAL JOIN LOCATIONS AND REPORT ANY/ALLDISCREPANCIES IMMEDIATELY TO THE ENGINEER OF RECORD AND THE GOVERNINGAGENT FOR THEIR REVIEW PRIOR TO CONSTRUCTION.2. SUBSURFACE UTILITY DATA IS DEPICTED TO LEVEL "C" OF CI/ASCE 38-02 AS DEFINED INTHE GUIDELINE FOR DEPICTION OF EXISTING SUBSURFACE UTILITY DATA. REFER TO"UTILITY NOTES" ON THE GENERAL NOTES SHEET FOR ADDITIONAL INFORMATION ANDREQUIREMENTS.3. IT IS THE RESPONSIBILITY OF THE PROJECT CONTRACTOR TO CONTACT USA NORTH AT1-800-642-2444 BEFORE ANY TRENCHING OR EXCAVATION WORK.4.SEE ELECTRICAL DEMO PLANS FOR NOTES AND DETAILS.5.UTILITIES SHOWN ARE ACCURATE TO THE EXTENT OF THE AVAILABLE RECORDS ANDKNOWLEDGE. THE CONTRACTOR HAS THE RESPONSIBILITY TO VERIFY THE LOCATIONOF EXISTING UNDERGROUND UTILITIES AND TO NOTIFY UTILITY COMPANIES WHENWORKING IN THEIR PROXIMITY. PRIOR TO COMMENCING CONSTRUCTION, THECONTRACTOR SHALL POTHOLE TO VERIFY ALL EXISTING UTILITY POINTS OFCONNECTION AND ELEVATIONS. THE CONTRACTOR SHALL NOTIFY THE ENGINEER OFRECORD IF ANY DISCREPANCIES EXIST BETWEEN THE PLANS AND FIELD WORKCONDITIONS PERTAINING TO MATERIALS, ELEVATIONS, LOCATIONS,ETC., PRIOR TOCONTINUING WORKPROTECTION KEY NOTESPROTECT AND PRESERVE EXISTING TREE IN PLACE; SIZE PER PLAN. SEE TREEPROTECTION PLAN FOR NOTES AND DETAILS.PROTECT AND PRESERVE EXISTING UTILITY VAULTS, MANHOLES, AND OTHER SURFACEAPPURTENANCES IN PLACE. ADJUST TO FINISHED GRADE WHERE NECESSARY. SEEELECTRICAL PLANS FOR LID REPLACEMENT.PROTECT AND PRESERVE EXISTING BUILDING IN PLACE.PROTECT EXISTING RAILING IN PLACE.PROTECT EXISTING CAMERA, POLE, AND FOOTING IN PLACE.12345DEMOLITION KEY NOTESREMOVE EXISTING CONCRETE.REMOVE EXISTING POLE FOUNDATION AND SALVAGE EXISTING LIGHT FIXTURE ANDDELIVER TO CITY CORP YARD. REFER TO ELECTRICAL PLANS FOR REUSE OF CONDUITS.REMOVE EXISTING CONCRETE PAVERS.REMOVE AND SALVAGE EXISTING STONE AND STOCKPILE ON SITE FOR USE INPROPOSED WALL. CAREFULLY REMOVE STONE SO AS TO PRESERVE LARGEST PIECESPOSSIBLE.SAWCUT AND REMOVE EXISTING ASPHALT PAVEMENT.REMOVE EXISTING ELECTRICAL BOX. RELOCATE UTILITIES FOR USE WITH NEWRESTROOM. SEE ELECTRICAL PLANS FOR TEMPORARY CONNECTION TO POLEMOUNTED CAMERA.REMOVE AND PROPERLY DISPOSE OF EXISTING RESTROOM BUILDING, INTERIORFIXTURES, AND FOOTING. PROTECT EXISTING UTILITY CONNECTIONS FOR USE WITHNEW RESTROOM.REMOVE AND SALVAGE EXISTING SITE FURNISHINGS AND DELIVER TO CITY CORPYARD.REMOVE EXISTING CONCRETE CURB.REMOVE EXISTING IRRIGATION CONTROL VALVE AND BACKFLOW PREVENTOR.DOCUMENT AND SAVE EXISTING STATIONS AND WATERING TIMES FOR FUTURE USE.REMOVE EXISTING TREE, INCLUDING STUMPS AND ROOTS.REMOVE AND DISPOSE OF EXISTING RAILING.REMOVE AND SALVAGE EXISTING BRICK AND STOCKPILE ONSITE FOR REUSE.REMOVE EXISTING DRINKING FOUNTAIN AND PRESERVE EXISTING WATER AND SEWERCONNECTIONS FOR FUTURE USE.REMOVE EXISTING SEWER CLEANOUT AND PRESERVE SEWER CONNECTION FORFUTURE USE.EXISTING WATER SERVICE LINE TO BE ABANDONED PER CITY OF SAN LUIS OBISPOSTANDARD 6050.12345678910111213141516MURRAYADOBEMONTEREY STREETSSSSSSSSSSSSSSSSSSXXXXWLWL UTLW WREMOVE AND REINSTALLEXISTING SIGN PERCONSTRUCTION PLANREMOVE AND REPLACETHERMOPLASTICSTRIPING PERCALTRANS DETAIL 27B^SAWCUT EXISTINGASPHALTSSWWWWROWLIMIT OF WORKLIMIT OF WORKROWLIMIT OF WORKEXISTING OLIVE TREE TO BERELOCATED ON SITE. REFERTO TREE PROTECTION PLANBROAD STREET21111222223992137333456688814999910101011114111991111245REMOVE AWNING AND AWNING POST. NEWAWNING ADJACENT TO THE ADOBE SHALL BE ASTANDALONE STRUCTURE. EXISTING ADOBE ANDASSOCIATED FLASHING AT AWNING SHALL BEPROTECTED IN PLACE. ARCHITECT ANDCONTRACTOR TO COORDINATE WITH APPLIEDEARTHWORKS AND ADOBE PRESERVATIONISTFOR DESIGN PARAMETERS AND FINALINSTALLATION REQUIREMENTS.2SAWCUT EXISTINGCONCRETE8EXISTING CURBTO REMAINSAWCUT EXISTINGSIDEWALK & CURBSAWCUT EXISTINGBRICK PATH^^^^^^^^^2158" PVC WATERMAIN^^^^^^^^^^16REMOVE EXISTINGTRELLIS STRUCTURE8IRRIGATION LINES TO BEREMOVED, SEEIRRIGATION PLAN FORRECONNECT IONDEMOLITION PLANCD101NLSXXXNLSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'1030Page 164 of 802 SSSSSSSSSSSSSSSSSSSSWLWLWL UTLW W LIMIT OF WORKLIMIT OF WORKSSWWWWGBLIMIT OF WORKGBW WWW ^^^^^^^^^^^^^^^^^^^^LIMIT OF WORKEEEEEEEEEEEEEEEEEEWGBGBWMBFE212213214215216 214213212211210209208207206205210 211212213213210 2052002152142132122112102092072082062050.6%WWWWMONTEREY STREETBROAD STREETFEMA ZONE AE 198'WATER SURFACEELEVATION12367891011121314151617181920212223242526273031323334353637383940414243484950515253545556575859606162636465666768697071ROWROWPoint TablePoint #1234567891011121314151617181920212223242526273031323334353637383940414243484950515253545556575859606162636465666768697071Raw DescriptionCL MON LS 6729SET RBR WG CP 50SET X TBC WG CP 25SET X WG CP 48FD X WG CP 49TFCTFCTFCTFCTFCBRICK EDGEBRICK EDGEADOBE CORNERADOBE CORNERADOBE CORNERRESTROOM CORNERRESTROOM CORNERBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGE / BCBRICK EDGE / ECBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEKIOSKKIOSKKIOSKKIOSKKIOSKKIOSKKIOSKKIOSKBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGEBRICK EDGERESTROOM CORNERRESTROOM CORNERMOW STRIPMOW STRIPPATH EDGEPATH EDGEMOW STRIPMOW STRIPMOW STRIPMOW STRIPMOW STRIPNorthing2298777.82542298730.59742298780.28512298672.60122298681.30012298736.15002298755.10082298765.21882298775.33682298780.84092298819.93342298803.74532298794.36022298772.31812298781.83332298722.69792298727.65552298729.63522298732.87872298719.20742298728.47812298734.96592298747.21452298749.52922298708.03702298718.10432298735.22502298738.79492298745.05892298745.54892298749.83062298750.68742298756.49212298758.91962298764.66542298762.23792298770.00952298772.43702298760.10112298753.92242298749.69562298745.39532298746.15102298752.33072298756.56212298760.86192298777.08382298782.22352298790.43182298785.29122298801.53202298793.32382298798.46432298806.67262298704.92482298709.86792298674.69162298709.91572298728.45172298731.91822298733.78222298729.40232298718.34582298760.61402298772.0402Easting5766449.16095766519.49195766472.08295766392.64505766277.93665766419.19585766446.42975766455.10325766463.77685766471.68665766528.74135766540.00595766526.84535766542.65475766555.88575766471.80525766444.16295766423.72915766428.40025766437.91345766439.57615766435.06165766452.72145766451.11075766475.87825766477.68375766502.28775766507.41795766508.54135766508.20035766505.22095766506.45225766502.41295766505.90145766501.90325766498.41475766493.00685766496.49535766483.02005766487.31945766486.55985766480.37995766476.15355766471.85335766472.60975766478.78895766493.26255766500.64995766494.93815766487.55075766510.89025766516.60195766523.98945766518.27765766468.59475766440.98765766461.42835766436.91755766504.61865766510.03855766531.53095766528.42575766512.53665766550.55415766558.6550HORIZONTAL CONTROL PLANCG101NLSXXXNLSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'1030Page 165 of 802 IMPROVEMENT KEY NOTESCONSTRUCT 8" CURB PER CITY STD. 4020.CONSTRUCT 0" CURB PER MODIFIED CITY STD. 4020. (12" BELOW FINISHED SURFACEWITH #4 BAR)CONSTRUCT CURB TRANSITION FROM 8" TO 0".CONSTRUCT PATCH PAVING PER CITY OF SAN LUIS OBISPO STANDARD 4110INSTALLATION NOTE 1. ( APPROXIMATELY 2" AC OVERLAY OVER 8" PCC)INSTALL 4" WIDE SOLID WHITE STRIPE.INSTALL SEWER LATERAL PER CITY STD 6810; 2% MIN. SLOPE. REFER TO PLUMBING PLANSFOR RESTROOM AND KIOSK CONNECTIONS.INSTALL 2" WATER SERVICE INCLUDING 2" METER PER CITY STD 6210.INSTALL SEWER CLEANOUT WITH G-5 VALVE WELL AND COVER PER CITY OF SAN LUISOBISPO STANDARD DRAWING NUMBER 6710.INSTALL 2" REDUCED PRESSURE BACKFLOW PREVENTER PER CITY STD 6550.INSTALL 1 12" POLYETHELENE 200 PSI WATER SERVICE LINE.INSTALL 2" POLYETHELENE 200 PSI WATER SERVICE LINE.INSTALL NDS SPEE-D CHANNEL DRAIN WITH 4-INCH PVC OUTLET PIPE MATCHINGEXISTING DITCH FLOWLINE.INSTALL 4" PERFORATED PVC PIPE, PERFORATIONS FACE DOWN, SLOPE 0.5% MINIMUM.WRAP PIPE WITH NON-WOVEN FILTER FABRIC.INSTALL 4" PVC STORM DRAIN PIPE, SLOPE 0.5% MINIMUMINSTALL NDS 12" SQUARE CATCH BASIN WITH CAST IRON GRATEREMOVE EXISTING SEWER CLEANOUT; CONNECT TO EXISTING SEWER LATERALINSTALL NDS POP-UP DRAIN EMITTER PER DETAIL ON THIS SHEET.INSTALL DRINKING FOUNTAIN; SEE DETAIL ON SHEET LC505.INSTALL FLUSH WITH GROUND ISOLATION VALVE PER CITY OF SAN LUIS OBISPOSTANDARD 8640.INSTALL NDS SPEE-D ROUND CATCH BASIN WITH 4" CONNECTION.1234567891011121314151617181920MURRAYADOBEFFE: 215.35SSSSSSSSSSSSSSSSSSSSWLWL UTLLIMIT OF WORKLIMIT OF WORKSSWWWWGBLIMIT OF WORKGBW WWWLIMIT OF WORKEEEEEEEEEEEEEEEEEEWGBGBWMBFE214.52FS214.52FS214.77FS214.79FS214.80FS214.85FS214.86FS214.80FS214.79FS214.78FS214.79FS215.40FS213.85FS214.64FS214.72FS214.48FS215.38FS215.14FS214.93 FS215.86 TW215.13 TC215.13 FL214.81 TC214.81 FL214.25 TC213.58 FL213.05 FSMATCHEXISTING214.37 FS215.54 TW214.61FS215.66FS MATCHEXISTINGA-A-215.82 TC215.32 FL214.55 TC213.88 FL212.94 FSMATCHEXISTINGDOORDOORGRANITE PLANTER CURB,SEE CONSTRUCTION PLANSTRANSITION PANEL, PAVEWITH RECYCLED BRICK214.88FS214.96FS215.09FS215.96 TC215.46 FL215.82 TC215.32 FL215.71 TC215.21 FL216.10 TC215.60 FL216.05 TC215.55 FL215.90 TC215.40 FL215.91 TC215.41 FL212213214215216 214213212211210209208207206205210211212213213210205 200215214213212211210209207208206205215 215214214214231554215.30FS215.30FS215.70FS MATCHEXISTING214.59FS212.74 FSMATCHEXISTING3.1%2.0%0.6%3.9%3.9%0.5%0.5%1.6%1.3%1.5%10.4%12.0%0.6%0.8%0.8%1.5%1.5% 0.7% 1.8%4.7%867WWWWPAINT NEW CURB REDMOW CURB. SEECONSTRUCTION PLANSGRANITECRETE PAVING;SEE DETAIL 3 SHEET LC502SEE CONSTRUCTION PLANSBRICK PAVING;SEE LANDSCAPE PLANSKIOSKFFE: 214.82RESTROOMFFE: 214.65213MONTEREY STREETBROAD STREET214.40FS213.44FS213.87FS213.53FS213.95FS214.17FS213.75FS214.71FS214.28FS214.46 FS214.80 TW1.6%213.60 FS213.94 TW215.20 FS215.86 TW215.25 FS215.86 TW214.56 FS215.86 TW214.63 FS215.86 TW214.39 FS214.72 TW214.39 FS215.54 TW213.45 FS213.78 TC1669101110212.26 FL212.90 TCMATCHEXISTING214.49 EG12A-A -LIMIT OF FEMA 100-YRFLOOD PLAIN (ZONE AE)FEMA ZONE AE 200'WATER SURFACEELEVATIONFEMA ZONE AE 201'WATER SURFACEELEVATIONFEMA ZONE AE 202'WATER SURFACEELEVATIONSURVEYCP 50SURVEY CONTROLPOINT CENTERLINE MONUMENTSEE HORIZONTAL CONTROL PLAN214.93FS215.01FS11ELECTRICAL BOX, SEEELECTRICAL PLANS.RESET ELECTRICAL BOX, TYP.;SEE CONSTRUCTION PLANS2.0%15158213.95FS214.37FS213.86FS214.29FSTWO STAIRRISERS (5")213.40 FS215.54 TW213.69FS1713141314TWO STAIRRISERS (5")170.6%8" PVC SEWER MAIN1.3%INV = 201.5718^^^^^^^^^^^^^^^^^^^^INV = 202.77ROWROW214.44 FS/LP214.77 TW2.0%18" CURB CUTOPENING TO ALLOWENCLOSUREDRAINAGE8INV = 212.53CONNECT TOEXISTING 8" PVCWATER MAINRESTROOM POINT OFCONNECTIONINV = 212.01CAPWATERLINE215.33 FS215.37FS215.27FS19215.50FS3.0%TG = 215.01INV = 213.65TG = 214.91INV = 213.37TG = 212.73INV = 212.23TG = 211.12INV = 210.56TG = 215.36INV = 214.04201314PERMEABLE PAVERS, SEELANDSCAPE PLAN FOR DETAILS20TG = 214.67INV = 213.68NDS POP UP EMITTER DETAIL-NTS-4" DRAIN ROCKMINIMUM DEPTH = 18 INCHESNDS POP UP EMITTEREXISTINGGRADE4" PVC STORMDRAIN PIPEU.N.O.13.5" OR 15" DIAMETERGRADING, DRAINAGE, & UTILITY PLANCG102RCNLSNLSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'10300.5% MIN.NTSSECTION (A-A)2% MAX2% MAX2'EXISTINGADOBE BUILDINGFFE = 215.35SOIL SUBGRADE, 5% SLOPEAWAY FROM BUILDING.PERMEABLE PAVERS ORGRANITECRETE PAVING SEE CONSTRUCTION PLANS60 MIL MIN.MOISTURE BARRIER12"16"Page 166 of 802 SAN LUIS OBISPOMUSEUM OF ART(NOT A PART)SSSSSSSSSSSSSSSSSSSSSSSSWL ELEUTLW W LIMIT OF WORKLIMIT OF WORKWWWWWWGBLIMIT OF WORKGB^^^^^^^^^^^^^^^^^^^^LIMIT OF WORKEEEEEEEEEEEEEEEEEEGBGBWMBFE212213214215216 214213212211210209208207206205210211212213213210205 200215214213212211210209207208206205215 215214214214WWWWWW213MONTEREY STREETBROAD STREETLIMITS OF FEMA ZONEAE 100-YR FLOOD43X X X XXXXXXXXXXXXXXXXXX44100-YR W S E L = 2 0 0' 100-YR WSEL = 201 '100-YR WSEL = 202'244ROWROWEROSION CONTROL PLANCG103NLSXXXNLSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'1030STORMWATER CONTROL BMPs#BMPSYMBOLNAME LEGENDSE-1SILT FENCESE-10STORM DRAIN INLET PROTECTION (SEE PHASING NOTES)WM-8 CONCRETE WASTE MANAGEMENTSC-6 GRAVEL BAGS1234XX1. PERIMETER CONTROL BMP AND STABILIZED CONSTRUCTION ENTRANCE(S) SHALL BE INPLACE PRIOR TO ANY GROUND DISTURBANCE.2. THE CONTRACTOR MAY UTILIZE RUMBLE PLATES IN LIEU OF RIP RAP AT THE CONSTRUCTIONENTRANCES AS LONG AS THEY ACCOMPLISH THE DESIRED RESULTS.3. CONSTRUCTION THAT INCLUDES DEMOLITION AND REPLACEMENT OF EXISTING ASPHALTSHALL BE COMPLETED WHEN THERE IS NO FORECAST RAIN EVENTS. AREAS THAT WILL BEIDLE FOR EXTENDED PERIODS OF TIME SHALL BE COVERED WITH TEMPORARY ASPHALTPATCHING, (COLD MIX).4. GRAVEL BAGS SHOWN IN THE CURB AND GUTTER FLOW LINES SHALL BE ORIENTED TOTEMPORARILY SLOW AND DAM THE FLOWING STORM WATER IN THE GUTTERS TO HELPFILTER OUT ANY SEDIMENT. THESE GRAVEL BAGS SHALL BE SPACED AT 50' O/C OR CLOSERAS CONDITIONS WARRANT.5. ANY SEDIMENT TRACKED OFFSITE SHALL BE CLEANED DAILY BY MEANS OF MOBILE STREETSWEEPERS.6. ANY GRADED AREAS THAT ARE GOING TO SIT IDLE FORM MORE THAN TWO WEEKS SHALLHAVE AN APPROPRIATE GROUND COVER BMP APPLIED.STORMWATER CONTROL NOTESINLETSANDBAGS2-BAGS HIGHSE-10 STORM DRAIN INLET PROTECTION TYPE-3-NTS-CURB & GUTTERGRAVEL BAGS 50' O/C TYP.IN FLOW LINES OF GUTTERSE-6 GRAVEL BAGS IN FLOW LINE DETAIL-NTS-FILTERFABRICOAKPOSTTOE-INDRAW CORDNETTINGOAK POSTFILTER FABRICTOE-INPRE-ASSEMBLED SILT FENCE-NTS-INSTALLATION PROCEDURES:1. DIG A 6" x 6" TRENCH AT DESIRED FENCE LOCATION2. UNROLL SILT FENCE ALONG TRENCH3. DRIVE STAKES INTO THE DOWNHILL SIDE OF TRENCH WITH NETTING AND STAKES FACING THE DOWNHILL SIDE.4. LAY THE BOTTOM 6" OF FABRIC INTO THE TRENCH AND FILL WITH TOP SOIL FOR PROPER TOE-IN.5. DRAW TENSION CORD AT TOP OF FENCE AND TIE TO END STAKES.Page 167 of 802 6)5(6752206)3/80%,1*&+$6(6)5(675220$6,01257+$552:/(9(/'(6,*1$7,21'2257$*:,1'2:7$**5,'5()(5(1&(6(&7,215()(5(1&(9,(:6+((7/2&$7,215()(5(1&(6+((7/2&$7,219,(:180%(56&$/(9,(:7,7/(/(9(/(/(9$7,21%8,/',1*(/(9$7,21'(7$,/5()(5(1&(&(17(5/,1(5(9,6,219LHZ1DPH $ $1DPH $6,06).,26.0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"GENERAL NOTES & FINISH SCHEDULEG-101KHDGKH05.11.23DG $5*5(675220),1,6+3/$1 9(17&$/&6$%%5(9,$7,216*(1(5$/127(66<0%2/6-67 -2,67-7 -2,17/$0 /$0,1$7(/$9 /$9$725</%6 3281'6/'* /$1',1*/7 /,*+70$; 0$;,0800(&+ 0(&+$1,&$/0(0% 0(0%5$1(0)5 0$18)$&785(50,1 0,1,0800,6& 0,6&(//$1(28602 0$6215<23(1,1*07' 02817('07/ 0(7$/11257+1,& 127,1&2175$&712 180%(5120 120,1$/176 127726&$/(23 29(5)/2:3,3(2$ 29(5$//2& 21&(17(52' 2876,'(',$0(7(52)) 2)),&(2+ 23326,7(+$1'23* 23(1,1*233 23326,7(3$57 3$57,7,213(50 3(5,0(7(53* 3$,17*5$'(3/$0 3/$67,&/$0,1$7(3/$6 3/$67(53/<:' 3/<:22'35 3$,537 3$,1737' 3$,17('5 5,6(55$' 5$',865&3 5()/(&7('&(,/,1*3/$15' 522)'5$,15( 5()(55() 5()5,*(5$7255(,1) 5(,1)25&('5(4' 5(48,5('5(6,/ 5(6,/,(1750 522052 528*+23(1,1*578 522)72381,70(&+66287+6$)% 6281'$77(18$7,21),%(5%$776& 6&833(56&+(' 6&+('8/(6($/ 6($/$176(&7 6(&7,216) 648$5()2276+7 6+((76,0 6,0,/$563(& 63(&,),&$7,2164 6485(66 67$,1/(6667((/67' 67$1'$5'67/ 67((/6725 6725$*(6758&7 6758&785$/6863 68363(1'('6<0 6<000(75,&$/775($'7 * 721*8( *5229(7(/ 7(/(3+21(7(5 7(55$==27+. 7+,&.7+5 7+5(6+2/'72 7232)7<3 7<3,&$/8& 81'(5&8781),1 81),1,6+('812 8/1(66127('27+(5:,6(821 81/(6627+(5:,6(127('87,/ 87,/,7<9&7 9,1</&20326,7,217,/(9(57 9(57,&$/9,) 9(5,)<,1),(/'975 9(177(50,1$7,213,3(9:& 9,1</:$//&29(5,1*: :(67: :,7+:2 :,7+287:& :$7(5&/26(7:,1 :,1'2::3 :$7(53522):6 :(767$&.:6&7 :$,16&27:7 :(,*+7$%9 $%29($&286 $&2867,&$/$&7 $&2867,&$/&(,/,1*7,/($' $5($'5$,1$'- $'-867$%/($)) $%29(),1,6+)/225$/7 $/7(51$7($/80 $/80,180$3352; $3352;,0$7($5&+ $5&+,7(&7%2 %277202)%$/& %$/&21<%' %2$5'%(7 %(7:((1%/'* %8,/'1*%/.* %/2&.,1*%/: %(/2:%0 %($0%27 %27720%5.7 %5$&.(7%8/.+' %8/.+($'%85 %8,/783522)&* &251(5*8$5'&$% &$%,1(7&$/. &$8/.,1*&(0 &(0(17&(5 &(5$0,&&- &21752/-2,17&/* &(,/,1*&/26 &/26(7&/5 &/($5&2 &$6('23(1,1*&2/ &2/801&21& &21&5(7(&217 &217,18286&37 &$53(7&7 &(5$0,&7,/(&75 &(17(5'%/ '28%/('(7 '(7$,/',$ ',$0(7(5',0 ',0(16,21'1 '2:1'5 '225'6 '2:163287': ',6+:$6+(5':* '5$:,1*(($67($ ($&+(,)6 (;7(5,25,168/$7,21 ),1,6+6<67(0(/(& (/(&75,&(/(9 (/(9$7,21(0(5 (0(5*(1&<(1&/ (1&/2685((26 ('*(2)6/$%(4 (48$/(48,3 (48,30(17(75 (;,67,1*725(0$,1(: ($&+:$<(;3-7 (;3$16,21-2,17(;67 (;,67,1*)2 )$&(2))$ ),5($/$50)$3 ),5($1181&,$7253$1(/)' )/225'5$,1)( ),5((;7,1*8,6+(5)(& ),5((;7,1*8,6+(53$1(/)* ),1,6+*5283)+ ),5(+<'5$17)+& ),5(+26(&$%,1(7),1 ),1,6+)/5 )/225)/825 )/285(6&(17)7 )22725)((7)85 )855,1**$/ *$//21*$/9 *$/9$1,=('*% *5$%%$5*& *(1(5$/&2175$&725*/ */$66*1' *5281'*:% *<3680%2$5'*<3 *<3680+:+ +27:$7(5+($7(5+':' +$5':22'+':5 +$5':$5(+0 +2//2:0(7$/+25,= +25,=217$/+5 +285+7 +(,*+7,' ,11(5',$0(7(5,1&$1 ,1&$1'(6&(17,168/ ,168/$7,21,17 ,17(5,25-$1 -$1,725 $33/,&$%/(&2'(6$1'67$1'$5'6 &$/,)251,$%8,/',1*&2'($1',76$33(1',&(6$1'67$1'$5'6 &$/,)251,$3/80%,1*&2'($1',76$33(1',&(6$1'67$1'$5'6 &$/,)251,$0(&+$1,&$/&2'($1',76$33(1',&(6$1'67$1'$5'6 &$/,)251,$),5(&2'($1',76$33(1',&(6$1'67$1'$5'6 &$/,)251,$(/(&75,&$/&2'($1',76$33(1',&(6$1'67$1'$5'6 &$/,)251,$%8,/',1*(1(5*<()),&,(1&<67$1'$5'6 &$/,)251,$*5((1%8,/',1*67$1'$5'6&2'($1',76$33(1',&,(6$1'67$1'$5'6 &855(17&,7<2)6$1/8,62%,632081,&,3$/&2'( $//:25.'(6&5,%(',17+('5$:,1*66+$//%(9(5,),(')25',0(16,21*5$'((;7(17$1'&203$7,%,/,7<:,7+(;,67,1*6,7(&21',7,216$1<',6&5(3$1&,(6$1'81(;3(&7('&21',7,2167+$7$))(&725&+$1*(7+(:25.'(6&5,%(',17+(&2175$&7'2&80(1766+$//%(%528*+7727+($5&+,7(&7¶6$77(17,21,00(',$7(/<'2127352&((':,7+7+(:25.,17+($5($2)',6&5(3$1&,(6817,/$//68&+',6&5(3$1&,(6$5(5(62/9(',)7+(&2175$&725&+226(672'262+(6+(6+$//%(35(&(',1*$7+,6+(52:15,6. ',0(16,2166+2:16+$//7$.(35(&('(1&(29(5'5$:,1*6&$/(253523257,21/$5*(56&$/('5$:,1*66+$//7$.(35(&('(1&(29(560$//(56&$/('5$:,1*6 ,17+((9(172)7+(81)25(6((1(1&2817(52)0$7(5,$/66863(&7('72%(2)$1$5&+$(2/2*,&$/253$/(2172/2*,&$/1$785($//*5$',1*$1'(;&$9$7,216+$//&($6(,17+(,00(',$7($5($$1'7+(7+(&2175$&7256+$//127,)<7+(2:1(57+(),1'6+$//%(/()781728&+('817,/$1(9$/8$7,21%<$48$/,),('$5&+$(2/2*,67253$/(2172/2*,67,60$'( &2175$&725,672%(5(63216,%/()25%(,1*)$0,/,$5:,7+7+(6('2&80(176,1&/8',1*$//&2175$&75(48,5(0(176 *5$',1*3/$16'5$,1$*(,03529(0(17652$'$1'$&&(665(48,5(0(176$1'(19,5210(17$/+($/7+&216,'(5$7,2166+$//&203/<:,7+$///2&$/25',1$1&(6 6+23:(/'60867%(3(5)250('%<$/,&(16(')$%5,&$725 66+23 26+$3(50,765(48,5(')259(57,&$/&876 2529(5 &2175$&725723529,'(&203/(7('(7$,/62)(1*,1((5('7(0325$5<6+25,1*256/27&877,1*352&('85(6213/$16&$//)25,163(&7,21%()25((;&$9$7,21%(*,16 7+(62,/6(1*,1((5,672$33529(7+(.(<25%27720$1'/($9($&(57,),&$7(217+(6,7()257+(*5$',1*,163(&7257+(*5$',1*,163(&725,672%(127,),('%()25($1<*5$',1*%(*,16$1')25%27720,163(&7,21%()25(),//,63/$&('),//0$<127%(3/$&(':,7+287$33529$/2)7+(*5$',1*,163(&725 &2175$&725725(9,(:&$/,)251,$*5((1&2'(5(48,5(0(176)25&2175$&7255(48,5(0(176 $&,7<(1&52$&+0(173(50,7$6(3(5$7(2)),&(5$&&(66($6(0(17$*5((0(17$1'255(&,35,&$/$&&(66($6(0(17$*5((0(170$<%(5(48,5('72,1685(7+$77+(352326('35,9$7($&&(6652$':$<:,//5(0$,123(1727+528*+75$)),&$1'(0(5*(1&<9(+,&/(635,2572),1$/2)%8,/',1*3(50,79(17,/$7,21&$/&65(675220$1'5(48,5('6,=(2)23(1,1*6)251$785$/9(17,$/7,213(5&%&$1'&0&0,1,0802)2&&83,$%/()/225$5($5(48,5('23(1,1*6 6)3529,'('75$16209(176 9(176 6) 6)$723(1$5($ 6)727$/9(17,/$7,213529,'(' 6)!6)),1,6+6&+('8/()/225 %$6(:$//6 &(,/,1*6($/('&21&5(7('5<6+$.(+$5'1(521&$67,13/$&(6/$%))/(*(1'%)/225%$6(&(5$0,&:$//7,/(::$//67281*($1'*5229(0(7$/62)),73$1(/&&(,/,1*(;326('&21&5(7(&85%+,*+5(6752205(6752203/80%,1*&+$6(.,26.5220&200(176):&7<3): &): &% : &5(675220%8,/',1*,1)250$7,21$//2:$%/(+(,*+7$1'$5($2&&83$1&<*5283 887,/,7<$1'0,6&(//$1(286'(6&5,37,21 38%/,&5(675220&216758&7,217<3( %$8720$7,&),5(635,1./(56 12$31 35232(' $//2:$%/(3(5&%&&+$37(5180%(52)6725,(6 %8,/',1*+(,*+7 %8,/',1*$5($ 6) 6)2&&83,$%/()/225$5($ 6)(*5(66$1$/<6,62&&83$17/2$')255(6752206,681'(),1(',1&%&7$%/( $5 *.,26.),1,6+3/$1 9(17&$/&6$//2:$%/(+(,*+7$1'$5($2&&83$1&<*5283 887,/,7<$1'0,6&(//$1(286'(6&5,37,21 38%/,&.,26.&216758&7,217<3( %$8720$7,&),5(635,1./(56 12$31 35232(' $//2:$%/(3(5&%&&+$37(5180%(52)6725,(6 %8,/',1*+(,*+7 %8,/',1*$5($ 6) 6)2&&83,$%/()/225$5($ 6)(*5(66$1$/<6,62&&83$17/2$')$&7253(5&%&7$%/(*526672$//2:)25)8785(0(5&+$1,7/(86(727$/2&&83$1766)6)3(5621 5281'723(562165(48,5('(;,763(5 3529,'('(;,76 .,26.5(48,5('6,=(2)23(1,1*6)251$785$/9(17,$/7,213(5&%&$1'&0&0,1,0802)2&&83,$%/()/225$5($5(48,5('23(1,1*6 6)3529,'('75$16209(176 9(176 6) 6)$723(1$5($ 6)727$/9(17,/$7,213529,'(' 6)!6))81),1,+6('(;326('0(7$/678'6:(;326('&083$,17:.,26.%8,/',1*,1)250$7,213/80%,1*&+$6(5(48,5('6,=(2)23(1,1*6)251$785$/9(17,$/7,212)$'-2,1,*163$&(3(5&%&$1'&0&0,1,0802)2&&83,$%/()/225$5($5(48,5('23(1,1*6 6)%87127/(667+$16)3529,'('3(5)25$7(':$//3$1(/ 6)($&+6,'( 6)$723(1$5($ 6)727$/9(17,/$7,213529,'(' 6)!6)81),1,6('6758&785($%29(&NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 168 of 802 .,&.3/$7(127(6:,1*,1*'225 *$7(685)$&(6:,7+,12)),1,6+)/2256+$//+$9($60227+685)$&(2)7+(386+6,'((;7(1',1*7+()8//:,'7+2)'22525*$7(3$576&5($7,1*+25,=217$/259(57,&$/-2,1766+$//%(:,7+,12)685)$&( 6+$//%()5((2)6+$5325$%5$6,9(('*(6&$9,7,(6&5($7('%<.,&.3/$7(66+$//%(&$33('))0,15()%'225&/26(56,)35(6(170867%(6(7627+$7,77$.(6'225$7/($676(&21'672&/26()520$123(1326,7,212)'(*5((672:,7+,12)/$7&+'225&/26(56$&&(37$%/('225+$5':$5($1'02817,1*+(,*+763$1,&/223/(9(5$))5()%7+()25&(7223(1'2256+$//127(;&(('/%67<3,&$/#,17(5,250$;0$;0,1%812%6758&7('6,'(5($&+&2%6758&7('+,*+6,'(5($&+'6+(/9(6!0$;0,10$;0$;0,10$;0,10$;0$;(&/26(7127(7+(6(',$*5$06,//8675$7(7+(63(&,),&5(48,5(0(1762)7+(6(5(*8/$7,216$1',6,17(1'('21/<$6$1$,')25%8,/',1*'(6,*1$1'&216758&7,210$;0$;5()%127(7+(5(48,5('&/($5)/22563$&(0$<12729(5/$37+(5(48,5('.1((63$&(%<025(7+$1.1((&/($5$1&(6$77$%/(6&2817(56 :25.685)$&(6,6$7/($67+,*+:,'($1''((30,10$;0,1&/50,10,10,10$;0,10,15()%3/$1(/(9$7,215()(572)/2253/$1)25:$//7<3(6:$//),1,6+ 5()(572),1,6+6&+('8/(&21&($/(')$67(1(56[66:60,1 0$;',$%/2&.,1*,1:$//0,172352-(&7,21$%29()256+2:(5&21752/625*5$%%$560,172352-(&7,21%(/2:%/2&.,1*0,10$;0,1&/50,1&/50,1&/572(&/50$;0,10,1.1((&/55(48,5('&/($563$&(5(48,5('&/($563$&(0$;)2)0,1&/50,16,'(9,(:3/$19,(:127(+27:$7(5$1''5$,13,3(681'(5$&&(66,%/(/$9$725,(66+$//%(,168/$7('2527+(5:,6(&29(5('7+(5(6+$//%(126+$325$%5$6,9(685)$&(681'(5/$9$725,(6127(7+(',32)7+(29(5)/2:6+$//127%(&216,'(5(',1'(7(50,1,1*.1(( 72(&/($5$1&(65()%0,55256($7&29(5',63(16(56$1,7$5<1$3.,1',63(16(572:(/',63(16(5(/(&75,&'5<(575$6+5(&(37$&/(&83',63(16(5127( &/($5)/22525*5281'63$&(5(48,5('72$//2:)25253$5$//(/$3352$&+72$&&(6625,(6 $//23(5$%/(3$5762)),;785(6$1'$&&(6625,(672%(/2&$7('0$;$)) &21752/6$1'23(5$7,1*0(&+$1,606086723(5$7(:,7+21(+$1'$1'1275(48,5(7,*+7*5$63,1*3,1&+,1*257:,67,1*2):5,67 0$;3281')25&(7223(5$7(&21752/6 /2&$7(&2$7+22.6$1'6+(/9,1*:,7+,1$335235,$7(5($&+5$1*(0$;$%29()/225 0,55256127/2&$7('$%29(/$9$725<72+$9(%27720('*(2)5()/(&7,1*685)$&(0$;$))0$;))5()%/$9$725<:+(5(2&&8567+,&.7+,&.0(1 :20(1 5(675220:$//6,*1$*(7<3'22502817('6,*1$*(7<3:$//02817('6,*1$*(72%(/2&$7('21/$7&+6,'(2)'225&/($52)'2256:,1*02817$70,172%5$,//($1'0$;)5207+(%$6(/,1(2)7+(+,*+(67/,1(2)5$,6('&+$5$&7(56'22502817('6,*1$*(:,7+,12)&(17(5/,1(2)'225/(77(5,1*5$,6('0,1833(5&$6(6$166(5,)&+$5$&7(56+(,*+72)/(77(5,1*0,1720$;0(10,1 0$;&/0,10$;&255(6321',1**5$'(,,%5$,//(:20(1',$0(1($/(*81,6(;',$3,&72*5$06$1'25/(77(5,1*$5(1275(48,5('21'22502817('6,*1$*(&+$5$&7(53523257,216&+$5$&7(566+$//%(6(/(&7(')520$)217:+(5(7+(:,'7+2)7+(833(5&$6(/(77(52,60,1,080$1'0$;,0802)7+(+(,*+72)7+(833(5&$6(,6,*16&217$,1,1*7$&7,/(&+$5$&7(566+$//%(/2&$7('627+$7$&/($5)/22563$&(2),1&+(60,1,080%<0,1,080&(17(5('217+(7$&7,/(&+$5$&7(56,63529,'('%(<21'7+($5&2)$1<'2256:,1*127(9(5,)<*(1'(5,'(17,7<6,*1$*()255(6752206:,7+&,7<$1'$5&+,7(&735,2572)$%5,&$7,21&/5220,'6,*1'(7$,/5220,'(17,),&$7,216,*16((5220,'6,*1'(7$,/5()% 5()%6<0%2/72&2175$67:,7+'22575,$1*/(6+$//&2175$67:,7+&,5&/(0$;0,1&/0,10,16,*16+$//%(/2&$7('&(17(5('$929($&/($5)/22563$&(%(<21'$5&2)'2252)$0,1,080;2502817('72$'-$&(17:$//&/5(6752200$;%(9(/('5()%9(57,&$/9(57,&$/0$; *.,&.3/$7($7'2256 *$&&'2255(48,5(0(176 *$&&5($&+5$1*(6 *72( .1((&/($5$1&(6 * *$&&*5$%%$5$77$&+0(17 *$&&/$9$725,(6 *$&&5(675220$&&(6625,(6 *$&&5(675220,'6<0%2/60,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedACCESSIBILITY DETAILSG-103KHDGKH05.11.23DG *$&&'2257+5(6+2/'6NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 169 of 802 0,10,1&/50,1&/50,1&/50,1&/50,10,1&/50,1&/5386+6,'()5217$3352$&+38//6,'(386+6,'(38//6,'(386+6,'(+,1*($3352$&+,1',&$7(6&/($5$1&($7'22560,1&/($538//6,'(0,1&/5/$7&+$3352$&+$7,17(5,25'22560,1&/($53529,'(7+,6$'',7,21$/63$&(,)'225,6(48,33(':,7+%27+$/$7&+$1'$&/26(50,1&/50,1&/5,)'225+$6%27+$/$7&+$1'$&/26(5127($//'2256,1$/&29(66+$/&203/<:,7+7+(&/($5$1&(6)25)5217$3352$&+(60,1&/5,)'225+$6%27+$/$7&+$1'$&/26(55()%0,1+-.)*'%&$$7(;7(5,256,'(2)(;7(5,25'22560,1[&/($5)/225/$1',1*$5($2876,'(6:,1*2)'2250,10,1'2253(50,77('7229(5/$3/$9&/($5)/225$5($3(5&%&%*7<3 0,10,10$;0,10,10$;0,172720$;0,1127($//',0(16,2167$.(1)520)$&(2)),1,6+:$7(5&/26(7)/86+9$/9(&21752/623(5$7,1*0(&+$160&21752/66+$//%(23(5$%/(:,7+21(+$1'6+$//1275(48,5(7,*+7*5$63,1*3,1&+,1*257:,67,1*2)7+(:5,67$1'6+$//%(02817('12025(7+$1$))7+()25&(5(48,5('72$&7,9$7(7+(:$7(5&/26(7$1'85,1$/)/86+9$/9(&21752/6 )$8&(7$1'23(5$7,1*0(&+$1,60&21752/66+$//%(12*5($7(57+$1/%)(/(&7521,&25$8720$7,&)/86+,1*&21752/6$5($&&(37$%/($1'35()(5$%/(6,'(9,(: )52179,(:72,/(73$3(5+2/'(5:,7+287672360,10,175$16)(56,'(0$;0,1#$0%8/$725<$&&(66,%/(*7<3&/6$1,7$5<',6326$/72287/(70,10$;7223(1,1*0,10,1&/50,1&/5&/5 &/5 0,1&/50,1&/5&21732,170$;0,1&/50,1&/5',$$,1&+(6',$0(7(563$&(&0,1,080&/($5:,'7+%76+$3('7851,1*63$&(127(0$<,1&/8'(72( .1((&/($5$1&(6 5()%0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedACCESSIBILITY DETAILSG-104KHDGKH05.11.23DG *&/($5$1&(6$7'2256 *$7(6 *6,1*/($&&202'$7,2172,/(7 *$&&72,/(76 *$&&7851,1*63$&(NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 170 of 802 0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2130CAL GREEN REQUIREMENTSG-105KATHRYN HICKSDAVID GIBBSKATHRYN HICKS10.21.2022DAVID GIBBS/80,1$,5(%$&.+(0,63+(5(,60+)5203523(57</,1(/80,1$,5(%$&.+(0,63+(5(,6/(667+$10+)5203523(57</,1(****1$****1$727$/180%(52)3$5.,1*63$&(67$%/(180%(52)5(48,5('63$&(6$1'29(5$7/($672)727$/ 727$/180%(52)$&78$/3$5.,1*63$&(67$%/(180%(52)5(48,5('(963$&(6$1'29(52)727$/ $//2:$%/(5$7,1*7$%/(>1@0$;,080$//2:$%/(%$&./,*+783/,*+7$1'*/$5(%8*5$7,1*/80,1$,5(*5($7(57+$102817,1*+(,*+760+)5203523(57</,1(0$;,080$//2:$%/(%$&./,*+75$7,1*%/,*+7,1*=21(/=12/,0,7/80,1$,5(%$&.+(0,63+(5(,60+)5203523(57</,1(/80,1$,5(%$&.+(0,63+(5(,60+)5203523(57</,1(/80,1$,5(%$&.+(0,63+(5(,6/(667+$10+)5203523(57</,1(12/,0,712/,0,712/,0,71$)25$5($/,*+7,1*0$;,080$//2:$%/(83/,*+75$7,1*8)25$//27+(5287'225/,*+7,1*,1&/8',1*'(&25$7,9(/80,1$,5(60$;,080$//2:$%/(*/$5(5$7,1**/80,1$,5(*5($7(57+$102817,1*+(,*+760+)5203523(57</,1(/80,1$,5(%$&.+(0,63+(5(,60+)5203523(57</,1(/,*+7,1*=21(/=/,*+7,1*=21(/=/,*+7,1*=21(/=/,*+7,1*=21(/=%%%%1$%%%%1$%%%%1$88881$88881$****1$****1$&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'(1215(6,'(17,$/0$1'$725<0($685(66+((7-$18$5<,1&/8'(6-8/<6833/(0(17',9,6,213/$11,1*$1''(6,*16,7('(9(/230(1767250:$7(532//87,21)25352-(&767+$7',6785%/(667+$121($&5(2)/$1'1(:/<&216758&7('352-(&76$1'$'',7,216:+,&+',6785%/(667+$121($&5(2)/$1'$1'$5(1273$572)$/$5*(5&200213/$12)'(9(/230(17256$/(6+$//35(9(177+(32//87,212)67250:$7(55812)))5207+(&216758&7,21$&7,9,7,(67+528*+21(25025(2)7+()2//2:,1*0($685(6/2&$/25',1$1&(&203/<:,7+$/$:)8//<(1$&7('67250:$7(50$1$*(0(17$1'25(526,21&21752/25',1$1&(%(670$1$*(0(1735$&7,&(6%03¶635(9(177+(/2662)62,/7+528*+:,1'25:$7(5(526,21%<,03/(0(17,1*$1())(&7,9(&20%,1$7,212)(526,21$1'6(',0(17&21752/$1'*22'+286(.((3,1*%03¶662,//266%03¶67+$76+28/'%(&216,'(5(')25,03/(0(17$7,21$6$335235,$7()25($&+352-(&7,1&/8'(%87$5(127/,0,7('727+()2//2:,1*D6&+('8/,1*&216758&7,21$&7,9,7<'85,1*'5<:($7+(5:+(13266,%/(E35(6(59$7,212)1$785$/)($785(69(*(7$7,2162,/$1'%8))(56$5281'685)$&(:$7(56F'5$,1$*(6:$/(625/,1('',7&+(672&21752/67250:$7(5)/2:G08/&+,1*25+<'526((',1*7267$%,/,=(',6785%('62,/6H(526,21&21752/723527(&76/23(6I3527(&7,212)67250'5$,1,1/(76*5$9(/%$*625&$7&+%$6,1,16(576J3(5,0(7(56(',0(17&21752/3(5,0(7(56,/7)(1&(),%(552//6K6(',0(1775$3256(',0(17%$6,1725(7$,16(',0(17216,7(L67$%,/,=('&216758&7,21(;,76M:,1'(526,21&21752/N27+(562,//266%03¶6$&&(37$%/(727+((1)25&,1*$*(1&<*22'+286(.((3,1*%03¶6720$1$*(&216758&7,21(48,30(10$7(5,$/612167250:$7(5',6&+$5*(6$1':$67(67+$76+28/'%(&216,'(5(')25,03/(0(17$7,21$6$335235,$7()25($&+352-(&7,1&/8'(%87$5(127/,0,7('727+()2//2:,1*D'(:$7(5,1*$&7,9,7,(6E0$7(5,$/+$1'/,1*$1':$67(0$1$*(0(17F%8,/',1*0$7(5,$/6672&.3,/(0$1$*(0(17G0$1$*(0(172):$6+287$5($6&21&5(7(3$,176678&&2(7&H&21752/2)9(+,&/((48,30(17)8(/,1*72&2175$&725¶667$*,1*$5($I9(+,&/($1'(48,30(17&/($1,1*3(5)250('2))6,7(J63,//35(9(17,21$1'&21752/K27+(5+286(.((3,1*%03¶6$&&(37$%/(727+((1)25&,1*$*(1&<67250:$7(532//87,2135(9(17,21)25352-(&767+$7',6785%21(25025($&5(62)/$1'&203/<:,7+$///$:)8//<(1$&7('67250:$7(5',6&+$5*(5(*8/$7,216)25352-(&767+$7',6785%21($&5(25025(2)/$1'25',6785%/(667+$121($&5(2)/$1'%87$5(3$572)$/$5*(5&200213/$12)'(9(/230(17256$/(127(352-(&767+$7',6785%21($&5(25025(2)/$1'25',6785%/(667+$121($&5(2)/$1'%87$5(3$572)$/$5*(5&200213/$12)'(9(/230(17256$/(0867&203/<:,7+7+(3267&216758&7,215(48,5(0(176'(7$,/(',17+($33/,&$%/(1$7,21$/32//87$17',6&+$5*((/,0,1$7,216<67(013'(6*(1(5$/3(50,7)2567250:$7(5',6&+$5*(6$662&,$7(':,7+&216758&7,21$1'/$1'',6785%$1&($&7,9,7,(6,668('%<7+(67$7(:$7(55(6285&(6&21752/%2$5'257+(/$+217$15(*,21$/:$7(548$/,7<&21752/%2$5')25352-(&76,17+(/$.(7$+2(+<'52/2*,&81,77+(13'(63(50,765(48,5(3267&216758&7,215812))3267352-(&7+<'52/2*<720$7&+7+(35(&216758&7,215812))35(352-(&7+<'52/2*<:,7+7+(,167$//$7,212)3267&216758&7,2167250:$7(50$1$*(0(170($685(67+(13'(63(50,76(03+$6,=(5812))5('8&7,217+528*+216,7(67250:$7(586(,17(5&(37,21(9$3275$163,5$7,21$1',1),/75$7,217+528*+1216758&785$/&21752/668&+$6/2:,03$&7'(9(/230(17/,'35$&7,&(6$1'&216(59$7,21'(6,*10($685(667250:$7(592/80(7+$7&$1127%($''5(66('86,1*1216758&785$/35$&7,&(6,65(48,5('72%(&$3785(',16758&785$/35$&7,&(6$1'%($33529('%<7+((1)25&,1*$*(1&<5()(5727+(&855(17$33/,&$%/(3(50,76217+(67$7(:$7(55(6285&(6&21752/%2$5':(%6,7($7::::$7(5%2$5'6&$*29&216758&7,2167250:$7(5&216,'(5$7,21727+(67250:$7(55812))0$1$*(0(170($685(66+28/'%(*,9(1'85,1*7+(,1,7,$/'(6,*1352&(66)25$335235,$7(,17(*5$7,21,1726,7('(9(/230(17%,&<&/(3$5.,1*)25%8,/',1*6:,7+,17+($87+25,7<2)&$/,)251,$%8,/',1*67$1'$5'6&200,66,21$663(&,),(',16(&7,21&203/<:,7+6(&7,21)25%8,/',1*6:,7+,17+($87+25,7<2)7+(',9,6,212)7+(67$7($5&+,7(&738568$17726(&7,21&203/<:,7+6(&7,21%,&<&/(3$5.,1*>%6&&*@&203/<:,7+6(&7,216$1'250((77+($33/,&$%/(/2&$/25',1$1&(:+,&+(9(5,6675,&7(56+2577(50%,&<&/(3$5.,1*,)7+(1(:352-(&725$1$'',7,2125$/7(5$7,21,6$17,&,3$7('72*(1(5$7(9,6,72575$)),&3529,'(3(50$1(17/<$1&+25('%,&<&/(5$&.6:,7+,1)((72)7+(9,6,7256¶(175$1&(5($',/<9,6,%/(723$66(56%<)253(5&(172)1(:9,6,72502725,=('9(+,&/(3$5.,1*63$&(6%(,1*$''(':,7+$0,1,0802)21(7:2%,.(&$3$&,7<5$&.&+$37(5 $'0,1,675$7,216(&7,21*(1(5$/7,7/(7+(6(5(*8/$7,2166+$//%(.12:1$67+(&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'($1'0$<%(&,7('$668&+$1':,//%(5()(55('72+(5(,1$6³7+,6&2'(´,7,6,17(1'('7+$7,76+$//$/62%(.12:1$67+(&$/*5((1&2'(7+(&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'(,63$572)7+,57((13$5762)7+(2)),&,$/&203,/$7,21$1'38%/,&$7,212)7+($'237,21$0(1'0(17$1'5(3($/2)%8,/',1*5(*8/$7,216727+(&$/,)251,$&2'(2)5(*8/$7,2167,7/($/625()(55('72$67+(&$/,)251,$%8,/',1*67$1'$5'6&2'(385326(7+(385326(2)7+,6&2'(,672,03529(38%/,&+($/7+6$)(7<$1'*(1(5$/:(/)$5(%<(1+$1&,1*7+('(6,*1$1'&216758&7,212)%8,/',1*67+528*+7+(86(2)%8,/',1*&21&(376+$9,1*$5('8&('1(*$7,9(,03$&725326,7,9((19,5210(17$/,03$&7$1'(1&285$*,1*6867$,1$%/(&216758&7,2135$&7,&(6,17+()2//2:,1*&$7(*25,(63/$11,1*$1''(6,*1(1(5*<()),&,(1&<:$7(5()),&,(1&<$1'&216(59$7,210$7(5,$/&216(59$7,21$1'5(6285&(()),&,(1&<(19,5210(17$/48$/,7<6&23(7+(3529,6,2162)7+,6&2'(6+$//$33/<727+(3/$11,1*'(6,*123(5$7,21&216758&7,2186($1'2&&83$1&<2)(9(5<1(:/<&216758&7('%8,/',1*256758&785(81/(6627+(5:,6(,1',&$7(',17+,6&2'(7+528*+2877+(67$7(2)&$/,)251,$,7,61277+(,17(177+$77+,6&2'(68%67,787(25%(,'(17,),('$60((7,1*7+(&(57,),&$7,215(48,5(0(1762)$1<*5((1%8,/',1*352*5$06(&7,21*(1(5$/6&23(%8,/',1*66+$//%('(6,*1('72,1&/8'(7+(*5((1%8,/',1*0($685(663(&,),('$60$1'$725<,17+($33/,&$7,21&+(&./,676&217$,1(',17+,6&2'(92/817$5<*5((1%8,/',1*0($685(6$5($/62,1&/8'(',17+($33/,&$7,21&+(&./,676$1'0$<%(,1&/8'(',17+('(6,*1$1'&216758&7,212)6758&785(6&29(5('%<7+,6&2'(%87$5(1275(48,5('81/(66$'237('%<$&,7<&2817<25&,7<$1'&2817<$663(&,),(',16(&7,211215(6,'(17,$/$'',7,216$1'$/7(5$7,216>%6&&*@7+(3529,6,2162),1',9,'8$/6(&7,2162)&+$37(5$33/<721(:/<&216758&7('%8,/',1*6%8,/',1*$'',7,2162)648$5()((725*5($7(5$1'25%8,/',1*$/7(5$7,216:,7+$3(50,79$/8$7,212)25$%29()252&&83$1&,(6:,7+,17+($87+25,7<2)&$/,)251,$%8,/',1*67$1'$5'6&200,66,21&2'(6(&7,2165(/(9$1772$'',7,216$1'$/7(5$7,2166+$//21/<$33/<727+(3257,2162)7+(%8,/',1*%(,1*$''('25$/7(5(':,7+,17+(6&23(2)7+(3(50,77(':25.$&2'(6(&7,21:,//%('(6,*1$7('%<$%$11(572,1',&$7(:+(5(7+(&2'(6(&7,2121/<$33/,(6721(:/<&216758&7('%8,/',1*6>1@2572$'',7,216$1'25$/7(5$7,216>$@:+(17+(&2'(6(&7,21$33/,(672%27+12%$11(5:,//%(86('1215(6,'(17,$/$'',7,216$1'$/7(5$7,2167+$7&$86(83'$7(6723/80%,1*),;785(621/<127(21$1'$)7(5-$18$5<&(57$,1&200(5&,$/5($/3523(57<$6'(),1(',1&,9,/&2'(6(&7,216+$//+$9(,76121&203/,$173/80%,1*),;785(65(3/$&(':,7+$335235,$7(:$7(5&216(59,1*3/80%,1*),;785(681'(563(&,),&&,5&8067$1&(66((&,9,/&2'(6(&7,21(76(4)25'(),1,7,2167<3(62)&200(5&,$/5($/3523(57<$))(&7('())(&7,9('$7(6&,5&8067$1&(61(&(66,7$7,1*5(3/$&(0(172)121&203/,$173/80%,1*),;785(6$1''87,(6$1'5(63216,%,/,7,(6)25(1685,1*&203/,$1&(:$67(',9(56,217+(5(48,5(0(1762)6(&7,216+$//%(5(48,5(')25$'',7,216$1'$/7(5$7,216:+(1(9(5$3(50,7,65(48,5(')25:25.38%/,&6&+22/6$1'&20081,7<&2//(*(66((*%6&+($/7+)$&,/,7,(66((*%6&6(&7,210,;('2&&83$1&<%8,/',1*60,;('2&&83$1&<%8,/',1*6,10,;('2&&83$1&<%8,/',1*6($&+3257,212)$%8,/',1*6+$//&203/<:,7+7+(63(&,),&*5((1%8,/',1*0($685(6$33/,&$%/(72($&+63(&,),&2&&83$1&<6(&7,21&216758&7,21'2&80(176$1',167$//$7,219(5,),&$7,2168%0,77$/'2&80(176&216758&7,21'2&80(176$1'27+(5'$7$6+$//%(68%0,77(',121(25025(6(76:,7+($&+$33/,&$7,21)25$3(50,7:+(5(63(&,$/&21',7,216(;,677+((1)25&,1*$*(1&<,6$87+25,=('725(48,5($'',7,21$/&216758&7,21'2&80(17672%(35(3$5('%<$/,&(16(''(6,*1352)(66,21$/$1'0$<%(68%0,77('6(3$5$7(/<(;&(37,217+((1)25&,1*$*(1&<,6$87+25,=('72:$,9(7+(68%0,66,212)&216758&7,21'2&80(176$1'27+(5'$7$1275(48,5('72%(35(3$5('%<$/,&(16(''(6,*1352)(66,21$/,1)250$7,2121&216758&7,21'2&80(176&216758&7,21'2&80(1766+$//%(2)68)),&,(17&/$5,7<72,1',&$7(7+(/2&$7,211$785($1'6&23(2)7+(352326('*5((1%8,/',1*)($785($1'6+2:7+$7,7:,//&21)250727+(3529,6,2162)7+,6&2'(7+(&$/,)251,$%8,/',1*67$1'$5'6&2'($1'27+(55(/(9$17/$:625',1$1&(658/(6$1'5(*8/$7,216$6'(7(50,1('%<7+((1)25&,1*$*(1&<9(5,),&$7,21'2&80(17$7,212)&21)250$1&()25$33/,&$%/(*5((1%8,/',1*0($685(66+$//%(3529,'('727+((1)25&,1*$*(1&<$/7(51$7(0(7+2'62)'2&80(17$7,216+$//%($&&(37$%/(:+(17+((1)25&,1*$*(1&<),1'67+$77+(352326('$/7(51$7('2&80(17$7,21,66$7,6)$&725<72'(021675$7(68%67$17,$/&21)250$1&(:,7+7+(,17(172)7+(352326('*5((1%8,/',1*0($685(&+$37(5 *5((1%8,/',1*&+$37(5 1215(6,'(17,$/0$1'$725<0($685(67+(5$&(:$<66+$//25,*,1$7($7$6(59,&(3$1(/25$68%3$1(/66(59,1*7+($5($$1'6+$//7(50,1$7(,1&/26(352;,0,7<727+(352326('/2&$7,212)7+(&+$5*,1*(48,30(17$1',172/,67('68,7$%/(&$%,1(76%2;(6(1&/2685(625(48,9$/(173/$1'(6,*16+$//%(%$6('8321$03(5(0,1,080%5$1&+&,5&8,76(/(&75,&$/&$/&8/$7,2166+$//68%67$17,$7(7+('(6,*12)7+((/(&75,&$/6<67(072,1&/8'(7+(5$7,1*2)(48,30(17$1'$1<216,7(',675,%87,2175$16)250(56$1'+$9(68)),&,(17&$3$&,7<726,08/7$1(286/<&+$5*($//5(48,5('(96$7,76)8//5$7('$03(5$*(7+(6(59,&(3$1(/2568%3$1(/66+$//+$9(68)),&,(17&$3$&,7<72$&&2002'$7(7+(5(48,5('180%(52)'(',&$7('%5$1&+&,5&8,76)257+()8785(,167$//$7,212)7+((96((9&+$5*,1*63$&(&$/&8/$7,21>1@7$%/(6+$//%(86('72'(7(50,1(,)6,1*/(2508/7,3/(&+$5*,1*63$&(5(48,5(0(176$33/<)257+()8785(,167$//$7,212)(96((;&(37,21621$&$6(%<&$6(%$6,6:+(5(7+(/2&$/(1)25&,1*$*(1&<+$6'(7(50,1('(9&+$5*,1*$1',1)5$6758&785(,6127)($6,%/(%$6('832121(25025(2)7+()2//2:,1*&21',7,216:+(5(7+(5(,6,168)),&,(17(/(&75,&$/6833/<:+(5(7+(5(,6(9,'(1&(68,7$%/(727+(/2&$/(1)25&,1*$*(1&<68%67$17,$7,1*7+$7$'',7,21$//2&$/87,/,7<,1)5$6758&785('(6,*15(48,5(0(176',5(&7/<5(/$7('727+(,03/(0(17$7,212)6(&7,210$<$'9(56(/<,03$&77+(&216758&7,21&2672)7+(352-(&7 &$/&8/$7,216)2563$&(66+$//%(5281'('83727+(1($5(67:+2/(180%(5>1@,'(17,),&$7,217+(6(59,&(3$1(/2568%3$1(/6&,5&8,7',5(&725<6+$//,'(17,)<7+(5(6(59('29(5&855(173527(&7,9('(9,&(63$&(6)25)8785((9&+$5*,1*$6³(9&$3$%/(´7+(5$&(:$<7(50,1$7,21/2&$7,216+$//%(3(50$1(17/<$1'9,6,%/<0$5.('$6³(9&$3$%/(´>1@)8785(&+$5*,1*63$&(648$/,)<$6'(6,*1$7('3$5.,1*$6'(6&5,%(',16(&7,21'(6,*1$7('3$5.,1*)25&/($1$,59(+,&/(6127()8785((/(&75,&9(+,&/(&+$5*,1*63$&(66+$//&2817<72:$5'7+(727$/3$5.,1*63$&(65(48,5('%<7+(/2&$/(1)25&,1*$*(1&,(6/,*+732//87,215('8&7,21>1@,287'225/,*+7,1*6<67(066+$//%('(6,*1('$1',167$//('72&203/<:,7+7+()2//2:,1*7+(0,1,0805(48,5(0(176,17+(&$/,)251,$(1(5*<&2'()25/,*+7,1*=21(6$6'(),1(',1&+$37(56(&7,212)7+(&$/,)251,$$'0,1,675$7,9(&2'($1'%$&./,*+7%5$7,1*6$6'(),1(',1,(6706+2:1,17$%/($,1&+$37(583/,*+7$1'*/$5(5$7,1*6$6'(),1(',1&$/,)251,$(1(5*<&2'(6+2:1,17$%/(6$$1'%,1&+$37(5$1'$//2:$%/(%8*5$7,1*6127(;&((',1*7+26(6+2:1,17$%/(>1@25&203/<:,7+$/2&$/25',1$1&(/$:)8//<(1$&7('38568$17726(&7,21:+,&+(9(5,6025(675,1*(17(;&(37,216>1@/80,1$,5(67+$748$/,)<$6(;&(37,216,16(&7,21%$1'2)7+(&$/,)251,$(1(5*<&2'((0(5*(1&</,*+7,1*%8,/',1*)$&$'(0((7,1*7+(5(48,5(0(176,17$%/(%2)7+(&$/,)251,$(1(5*<&2'(3$57&86720/,*+7,1*)($785(6$6$//2:('%<7+(/2&$/(1)25&,1*$*(1&<$63(50,77('%<6(&7,21$/7(51$7(0$7(5,$/6'(6,*16$1'0(7+2'62)&216758&7,21/80,1$,5(6:,7+/(667+$1,1,7,$//80,1$,5(/80(16127(6>1@6(($/62&$/,)251,$%8,/',1*&2'(&+$37(56(&7,21)25&2//(*(&$0386/,*+7,1*5(48,5(0(176)253$5.,1*)$&,/,7,(6$1':$/.:$<65()(572&+$37(5&203/,$1&()2506:25.6+((76$1'5()(5(1&(0$7(5,$/)25,(6707$%/($&$/,)251,$(1(5*<&2'(7$%/(6$$1'%5()(5727+(&$/,)251,$(1(5*<&2'()255(48,5(0(176)25$'',7,216$1'$/7(5$7,216(;&(37,21$'',7,21625$/7(5$7,216:+,&+$''1,1(25/(669,6,7259(+,&8/$53$5.,1*63$&(6/21*7(50%,&<&/(3$5.,1*)251(:%8,/',1*6:,7+7(1$1763$&(67+$7+$9(25025(7(1$172&&83$1763529,'(6(&85(%,&<&/(3$5.,1*)253(5&(172)7+(7(1$172&&83$179(+,&8/$53$5.,1*63$&(6:,7+$0,1,0802)21(%,&<&/(3$5.,1*)$&,/,7<)25$'',7,21625$/7(5$7,2167+$7$''25025(7(1$172&&83$179(+,&8/$53$5.,1*63$&(63529,'(6(&85(%,&<&/(3$5.,1*)253(5&(172)7+(7(1$179(+,&8/$53$5.,1*63$&(6%(,1*$''(':,7+$0,1,0802)21(%,&<&/(3$5.,1*)$&,/,7<)251(:6+(//%8,/',1*6,13+$6('352-(&763529,'(6(&85(%,&<&/(3$5.,1*)253(5&(172)7+($17,&,3$7('7(1$172&&83$179(+,&8/$53$5.,1*63$&(6:,7+$0,1,0802)21(%,&<&/(3$5.,1*)$&,/,7<$&&(37$%/(%,&<&/(3$5.,1*)$&,/,7<)256(&7,216$1'6+$//%(&219(1,(17)5207+(675((7$1'6+$//0((721(2)7+()2//2:,1*&29(5('/2&.$%/((1&/2685(6:,7+3(50$1(17/<$1&+25('5$&.6)25%,&<&/(6/2&.$%/(%,&<&/(52206:,7+3(50$1(17/<$1&+25('5$&.625/2&.$%/(3(50$1(17/<$1&+25('%,&<&/(/2&.(56127($'',7,21$/,1)250$7,21215(&200(1'('%,&<&/($&&2002'$7,2160$<%(2%7$,1(')5206$&5$0(172$5($%,&<&/($'92&$7(6%,&<&/(3$5.,1*>'6$@)2538%/,&6&+22/6$1'&20081,7<&2//(*(6&203/<:,7+6(&7,216$1'678'(17%,&<&/(3$5.,1*3529,'(3(50$1(17/<$1&+25('%,&<&/(5$&.6&219(1,(17/<$&&(66(':,7+$0,1,0802))2857:2%,.(&$3$&,7<5$&.63(51(:%8,/',1*67$))%,&<&/(3$5.,1*3529,'(3(50$1(176(&85(%,&<&/(3$5.,1*&219(1,(17/<$&&(66(':,7+$0,1,0802)7:267$))%,&<&/(3$5.,1*63$&(63(51(:%8,/',1*$&&(37$%/(%,&<&/(3$5.,1*)$&,/,7,(66+$//%(&219(1,(17)5207+(675((72567$))3$5.,1*$5($$1'6+$//0((721(2)7+()2//2:,1*&29(5('/2&.$%/((1&/2685(6:,7+3(50$1(17/<$1&+25('5$&.6)25%,&<&/(6/2&.$%/(%,&<&/(52206:,7+3(50$1(17/<$1&+25('5$&.625/2&.$%/(3(50$1(17/<$1&+25('%,&<&/(/2&.(56'(6,*1$7('3$5.,1*)25&/($1$,59(+,&/(6,11(:352-(&7625$'',7,21625$/7(5$7,2167+$7$''25025(9(+,&8/$53$5.,1*63$&(63529,'('(6,*1$7('3$5.,1*)25$1<&20%,1$7,212)/2:(0,77,1*)8(/()),&,(17$1'&$5322/9$1322/9(+,&/(6$6)2//2:6 &$/&8/$7,21)2563$&(66+$//%(5281'('83727+(1($5(67:+2/(180%(5127('(6,*1$7('3$5.,1*)25&/($1$,59(+,&/(66+$//&281772:$5'7+(727$/3$5.,1*63$&(65(48,5('%<7+(/2&$/(1)25&,1*$*(1&,(63$5.,1*67$//0$5.,1*3$,17,17+(3$,1786(')2567$//675,3,1*7+()2//2:,1*&+$5$&7(5668&+7+$77+(/2:(5('*(2)7+(/$67:25'$/,*16:,7+7+((1'2)7+(67$//675,3,1*$1',69,6,%/(%(1($7+$3$5.('9(+,&/(&/($1$,59$1322/(9127(9(+,&/(6%($5,1*&/($1$,59(+,&/(67,&.(56)520(;3,5('+29/$1(352*5$060$<%(&216,'(5('(/,*,%/()25'(6,*1$7('3$5.,1*63$&(6(/(&75,&9(+,&/((9&+$5*,1*>1@&216758&7,216+$//&203/<:,7+6(&7,21256(&7,2172)$&,/,7$7()8785(,167$//$7,212)(/(&75,&9(+,&/(6833/<(48,30(17(96(:+(1(96(6,6$5(,167$//(',76+$//%(,1$&&25'$1&(:,7+7+(&$/,)251,$%8,/',1*&2'(7+(&$/,)251,$(/(&75,&$/&2'($1'$6)2//2:66,1*/(&+$5*,1*63$&(5(48,5(0(176>1@:+(121/<$6,1*/(&+$5*,1*63$&(,65(48,5('3(57$%/($5$&(:$<,65(48,5('72%(,167$//('$77+(7,0(2)&216758&7,21$1'6+$//%(,167$//(',1$&&25'$1&(:,7+7+(&$/,)251,$(/(&75,&$/&2'(&216758&7,213/$16$1'63(&,),&$7,2166+$//,1&/8'(%87$5(127/,0,7('727+()2//2:,1*7+(7<3($1'/2&$7,212)7+((96($/,67('5$&(:$<&$3$%/(2)$&&2002'$7,1*$92/7'(',&$7('%5$1&+&,5&8,77+(5$&(:$<6+$//127%(/(667+$175$'(6,=(´7+(5$&(:$<6+$//25,*,1$7($7$6(59,&(3$1(/25$68%3$1(/6(59,1*7+($5($$1'6+$//7(50,1$7(,1&/26(352;,0,7<727+(352326('/2&$7,212)7+(&+$5*,1*(48,30(17$1',172$/,67('68,7$%/(&$%,1(7%2;(1&/2685(25(48,9$/(177+(6(59,&(3$1(/2568%3$1(/6+$//+$9(68)),&,(17&$3$&,7<72$&&2002'$7($0,1,080$03(5('(',&$7('%5$1&+&,5&8,7)257+()8785(,167$//$7,212)7+((96(08/7,3/(&+$5*,1*63$&(5(48,5(0(176>1@:+(108/7,3/(&+$5*,1*63$&(6$5(5(48,5('3(57$%/(5$&(:$<6,6$5(5(48,5('72%(,167$//('$77+(7,0(2)&216758&7,21$1'6+$//%(,167$//(',1$&&25'$1&(:,7+7+(&$/,)251,$(/(&75,&$/&2'(&216758&7,213/$16$1'63(&,),&$7,2166+$//,1&/8'(%87$5(127/,0,7('727+()2//2:,1*7+(7<3($1'/2&$7,212)7+((96(6(&7,213+$6('352-(&763+$6('352-(&76)256+(//%8,/',1*6$1'27+(56&216758&7(')25)8785(7(1$17,03529(0(17621/<7+26(&2'(0($685(65(/(9$17727+(%8,/',1*&20321(176$1'6<67(06&216,'(5('72%(1(:&216758&7,21251(:/<&216758&7('6+$//$33/<,1,7,$/7(1$17,03529(0(1767+(3529,6,2162)7+,6&2'(6+$//$33/<211/<727+(,1,7,$/7(1$17,03529(0(17672$352-(&768%6(48(177(1$17,03529(0(1766+$//&203/<:,7+7+(6&23,1*3529,6,216,16(&7,211215(6,'(17,$/$'',7,216$1'$/7(5$7,216 ,(61$/,*+7,1*=21(6$5(127$33/,&$%/(5()(572/,*+7,1*=21(6$6'(),1(',17+(&$/,)251,$(1(5*<&2'($1'&+$37(52)7+(&$/,)251,$$'0,1,675$7,9(&2'( )253523(57</,1(67+$7$%8738%/,&:$/.:$<6%,.(:$<63/$=$6$1'3$5.,1*/2767+(3523(57</,1(0$<%(&216,'(5('72%()((7%(<21'7+($&78$/3523(57</,1()25385326(2)'(7(50,1,1*&203/,$1&(:,7+7+,66(&7,21)253523(57</,1(67+$7$%8738%/,&52$':$<6$1'38%/,&75$16,7&255,'2567+(3523(57</,1(0$<%(&216,'(5('72%(7+(&(17(5/,1(2)7+(38%/,&52$':$<2538%/,&75$16,7&255,'25)257+(385326(2)'(7(50,1,1*&203/,$1&(:,7+7+,66(&7,21 *(1(5$//,*+7,1*/80,1$,5(6,1$5($668&+$6287'2253$5.,1*6$/(6256725$*(/2766+$//0((77+(6(5('8&('5$7,1*6'(&25$7,9(/80,1$,5(6/2&$7(',17+(6($5($66+$//0((789$/8(/,0,76)25$//27+(5287'225/,*+7,1*)$&,1*%$&./,*+7/80,1$,5(6:,7+,10+2)$3523(57</,1(6+$//%(25,(17('627+$77+(1($5(673523(57</,1(,6%(+,1'7+(),;785($1'6+$//&203/<:,7+7+(%$&./,*+75$7,1*63(&,),(',17$%/(%$6('217+(/,*+7,1*=21($1'',67$1&(727+(1($5(6732,172)7+$73523(57</,1((;&(37,21&251(56,)7:23523(57</,1(6257:26(*0(1762)7+(6$0(3523(57</,1(+$9((48,',67$1732,176727+(/80,1$,5(7+(17+(/80,1$,5(0$<%(25,(17('627+$77+(,17(56(&7,212)7+(7:2/,1(67+(&251(5,6',5(&7/<%(+,1'7+(/80,1$,5(7+(/80,1$,5(6+$//67,//86(7+(',67$1&(727+(1($5(6732,176217+(3523(57</,1(672'(7(50,1(7+(5(48,5('%$&./,*+75$7,1*)$&,1**/$5()25/80,1$,5(6&29(5('%<,)$3523(57</,1($/62(;,676:,7+,125(;7(1'6,1727+()5217+(0,63+(5(:,7+,10+2)7+(/80,1$,5(7+(17+(/80,1$,5(6+$//&203/<:,7+7+(025(675,*(17*/$5(5$7,1*63(&,),(',17$%/(%$6('217+(/,*+7,1*=21($1'',67$1&(727+(1($5(6732,17217+(1($5(673523(57</,1(:,7+,17+()5217+(0,63+(5(*5$',1*$1'3$9,1*&216758&7,213/$166+$//,1',&$7(+2:6,7(*5$',1*25$'5$,1$*(6<67(0:,//0$1$*($//685)$&(:$7(5)/2:672.((3:$7(5)520(17(5,1*%8,/',1*6(;$03/(62)0(7+2'6720$1$*(685)$&(:$7(5,1&/8'(%87$5(127/,0,7('727+()2//2:,1*6:$/(6:$7(5&2//(&7,21$1'',6326$/6<67(06)5(1&+'5$,16:$7(55(7(17,21*$5'(1627+(5:$7(50($685(6:+,&+.((3685)$&(:$7(5$:$<)520%8,/',1*6$1'$,',1*5281':$7(55(&+$5*((;&(37,21$'',7,216$1'$/7(5$7,216127$/7(5,1*7+('5$,1$*(3$7+6+$'(75((6>'6$66@6+$'(75((66+$//%(3/$17('72&203/<:,7+6(&7,216$1'3(5&(17$*(66+2:16+$//%(0($685('$71221217+(6800(562/67,&(/$1'6&$3(,55,*$7,211(&(66$5<72(67$%/,6+$1'0$,17$,175((+($/7+6+$//&203/<:,7+6(&7,21685)$&(3$5.,1*$5($66+$'(75((3/$17,1*60,1,080&217$,1(56,=(25(48$/6+$//%(,167$//('723529,'(6+$'(29(53(5&(172)7+(3$5.,1*$5($:,7+,1<($56(;&(37,2167+(685)$&(3$5.,1*$5($&29(5('%<62/$53+27292/7$,&6+$'(6758&785(6256+$'(6758&785(6:,7+522),1*0$7(5,$/67+$7&203/<:,7+7$%/($,1$33(1',;$$5(127,1&/8'(',17+(727$/$5($&$/&8/$7,216/$1'6&$3($5($66+$'(75(663/$17,1*60,1,080&217$,1(56,=(25(48$/6+$//%(,167$//('723529,'(6+$'(2)2)7+(/$1'6&$3($5($:,7+,1<($56(;&(37,2163/$<),(/'6)2525*$1,=('63257$&7,9,7<$5(127,1&/8'(',17+(727$/$5($&$/&8/$7,21+$5'6&$3($5($66+$'(75((3/$17,1*60,1,080&217$,1(56,=(25(48$/6+$//%(,167$//('723529,'(6+$'(29(52)7+(+$5'6&$3($5($:,7+,1<($56(;&(37,216:$/.6+$5'6&$3($5($6&29(5('%<62/$53+27292/7$,&6+$'(6758&785(6$1'+$5'6&$3($5($6&29(5('%<6+$'(6758&785(6:,7+522),1*0$7(5,$/67+$7&203/<:,7+7$%/($,1$33(1',;$$5(127,1&/8'(',17+(727$/$5($&$/&8/$7,21,1'225:$7(586(',9,6,21:$7(5()),&,(1&<$1'&216(59$7,210(7(566(3$5$7(68%0(7(56250(7(5,1*'(9,&(66+$//%(,167$//(')257+(86(6'(6&5,%(',16(&7,216$1'1(:%8,/',1*625$'',7,216,1(;&(662)648$5()((76(3$5$7(68%0(7(566+$//%(,167$//('$6)2//2:6)25($&+,1',9,'8$//($6('5(17('2527+(57(1$1763$&(:,7+,17+(%8,/',1*352-(&7('72&21680(025(7+$1*$/'$</'$<,1&/8',1*%87127/,0,7('7263$&(686(')25/$81'5<25&/($1(565(67$85$1725)22'6(59,&(0(',&$/25'(17$/2)),&(/$%25$725<25%($87<6$/2125%$5%(56+23:+(5(6(3$5$7(68%0(7(56)25,1',9,'8$/%8,/',1*7(1$176$5(81)($6,%/()25:$7(56833/,('727+()2//2:,1*68%6<67(06*(1(5$/',9,6,21(1(5*<()),&,(1&<6&23(&$/,)251,$(1(5*<&2'()257+(385326(62)0$1'$725<(1(5*<()),&,(1&<67$1'$5'6,17+,6&2'(7+(&$/,)251,$(1(5*<&200,66,21:,//&217,18(72$'2370$1'$725<%8,/',1*67$1'$5'6*(1(5$/6&23(7+(3529,6,2162)7+,6&+$37(56+$//(67$%/,6+7+(0($162)&216(59,1*:$7(586(',1'2256287'2256$1',1:$67(:$7(5&219(<$1&(NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE202505.11.23Page 171 of 802 0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2130CAL GREEN REQUIREMENTSG-106KATHRYN HICKSDAVID GIBBSKATHRYN HICKS10.21.2022DAVID GIBBS&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'(1215(6,'(17,$/0$1'$725<0($685(66+((7-$18$5<,1&/8'(6-8/<6833/(0(1785,1$/6:$//02817('85,1$/67+(())(&7,9()/86+92/80(2):$//02817('85,1$/66+$//127(;&(('*$//2163(5)/86+)/22502817('85,1$/67+(())(&7,9()/86+92/80(2))/22502817('2527+(585,1$/66+$//127(;&(('*$//2163(5)/86+6+2:(5+($'6>%6&&*@6,1*/(6+2:(5+($'6+2:(5+($'66+$//+$9($0$;,080)/2:5$7(2)127025(7+$1*$//2163(50,187($736,6+2:(5+($'66+$//%(&(57,),('727+(3(5)250$1&(&5,7(5,$2)7+(86(3$:$7(56(16(63(&,),&$7,21)256+2:(5+($'608/7,3/(6+2:(5+($'66(59,1*21(6+2:(5:+(1$6+2:(5,66(59('%<025(7+$121(6+2:(5+($'7+(&20%,1(')/2:5$7(2)$//6+2:(5+($'6$1'2527+(56+2:(5287/(76&21752//('%<$6,1*/(9$/9(6+$//127(;&(('*$//2163(50,187($736,257+(6+2:(56+$//%('(6,*1('72$//2:21/<21(6+2:(5287/(772%(,123(5$7,21$7$7,0(127($+$1'+(/'6+2:(56+$//%(&216,'(5('$6+2:(5+($')$8&(76$1')2817$,161215(6,'(17,$//$9$725<)$8&(76/$9$725<)$8&(766+$//+$9($0$;,080)/2:5$7(2)127025(7+$1*$//2163(50,187($736,.,7&+(1)$8&(76.,7&+(1)$8&(766+$//+$9($0$;,080)/2:5$7(2)127025(7+$1*$//2163(50,187($736,.,7&+(1)$8&(760$<7(0325$5,/<,1&5($6(7+()/2:$%29(7+(0$;,0805$7(%8712772(;&(('*$//2163(50,187($736,$1'0867'()$8/772$0$;,080)/2:5$7(2)*$//2163(50,187($736,:$6+)2817$,16:$6+)2817$,166+$//+$9($0$;,080)/2:5$7(2)127025(7+$1*$//2163(50,187(>5,063$&(,1&+(6$736,@0(7(5,1*)$8&(760(7(5,1*)$8&(766+$//127'(/,9(5025(7+$1*$//2163(5&<&/(0(7(5,1*)$8&(76)25:$6+)2817$,160(7(5,1*)$8&(76)25:$6+)2817$,166+$//+$9($0$;,080)/2:5$7(2)127025(7+$1*$//2163(5&<&/(>5,063$&(,1&+(6$736,@127(:+(5(&203/<,1*)$8&(76$5(81$9$,/$%/($(5$72562527+(50($160$<%(86('72$&+,(9(5('8&7,2135(5,16(635$<9$/9(:+(1,167$//('6+$//0((77+(5(48,5(0(176,17+(&$/,)251,$&2'(2)5(*8/$7,2167,7/($33/,$1&(()),&,(1&<5(*8/$7,2166(&7,21+7$%/(+6(&7,21+$$1'6(&7,21'$1'6+$//%((48,33(':,7+$1,17(*5$/$8720$7,&6+872))&200(5&,$/.,7&+(1(48,30(17)22':$67(',6326(56',6326(566+$//(,7+(502'8/$7(7+(86(2):$7(57212025(7+$1*30:+(17+(',6326(5,6127,186(127$&7,9(/<*5,1',1*)22':$67(12/2$'256+$//$8720$7,&$//<6+872))$)7(512025(7+$10,187(62),1$&7,9,7<',6326(566+$//86(12025(7+$1*302):$7(5127(7+,6&2'(6(&7,21'2(6127$))(&7/2&$/-85,6',&7,21$87+25,7<72352+,%,7255(48,5(',6326(5,167$//$7,21$5($62)$'',7,2125$/7(5$7,21)257+26(2&&83$1&,(6:,7+,17+($87+25,7<2)7+(&$/,)251,$%8,/',1*67$1'$5'6&200,66,21$663(&,),(',16(&7,217+(3529,6,2162)6(&7,216$1'6+$//$33/<721(:),;785(6,1$'',7,21625$5($62)$/7(5$7,21727+(%8,/',1*67$1'$5'6)253/80%,1*),;785(6$1'),77,1*63/80%,1*),;785(6$1'),77,1*66+$//%(,167$//(',1$&&25'$1&(:,7+7+(&$/,)251,$3/80%,1*&2'($1'6+$//0((77+($33/,&$%/(67$1'$5'65()(5(1&(',17$%/(2)7+(&$/,)251,$3/80%,1*&2'($1',1&+$37(52)7+,6&2'(:$7(55(6,67$1&($1'02,6785(0$1$*(0(17:($7+(53527(&7,213529,'($:($7+(55(6,67$17(;7(5,25:$//$1')281'$7,21(19(/23($65(48,5('%<&$/,)251,$%8,/',1*&2'(6(&7,21:($7+(53527(&7,210$18)$&785(5¶6,167$//$7,21,16758&7,21625/2&$/25',1$1&(:+,&+(9(5,6025(675,1*(1702,6785(&21752/(03/2<02,6785(&21752/0($685(6%<7+()2//2:,1*0(7+2'6635,1./(56'(6,*1$1'0$,17$,1/$1'6&$3(,55,*$7,216<67(067235(9(17635$<216758&785(6(175,(6$1'23(1,1*6'(6,*1(;7(5,25(175,(6$1'2523(1,1*668%-(&772)22775$)),&25:,1''5,9(15$,17235(9(17:$7(5,17586,21,172%8,/',1*6$6)2//2:6(;7(5,25'2253527(&7,2135,0$5<(;7(5,25(175,(66+$//%(&29(5('7235(9(17:$7(5,17586,21%<86,1*121$%625%(17)/225$1':$//),1,6+(6:,7+,1$7/($67)((7$5281'$1'3(53(1',&8/$57268&+23(1,1*63/86$7/($6721(2)7+()2//2:,1*$1,167$//('$:1,1*$7/($67)((7,1'(37+7+('225,63527(&7('%<$522)29(5+$1*$7/($67)((7,1'(37+7+('225,65(&(66('$7/($67)((727+(50(7+2'6:+,&+3529,'((48,9$/(173527(&7,21)/$6+,1*,167$//)/$6+,1*6,17(*5$7(':,7+$'5$,1$*(3/$1(6(&7,21&216758&7,21:$67(5('8&7,21',6326$/$1'5(&<&/,1*&216758&7,21:$67(0$1$*(0(175(&<&/($1'256$/9$*()255(86($0,1,0802)3(5&(172)7+(121+$=$5'286&216758&7,21$1''(02/,7,21:$67(,1$&&25'$1&(:,7+6(&7,2125250((7$/2&$/&216758&7,21$1''(02/,7,21:$67(0$1$*(0(1725',1$1&(:+,&+(9(5,6025(675,1*(17&216758&7,21:$67(0$1$*(0(173/$1:+(5($/2&$/-85,6',&7,21'2(6127+$9($&216758&7,21$1''(02/,7,21:$67(0$1$*(0(1725',1$1&(7+$7,6025(675,1*(1768%0,7$&216758&7,21:$67(0$1$*(0(173/$17+$7,'(17,),(67+(&216758&7,21$1''(02/,7,21:$67(0$7(5,$/672%(',9(57(')520',6326$/%<()),&,(1786$*(5(&<&/,1*5(86(217+(352-(&7256$/9$*()25)8785(86(256$/('(7(50,1(6,)&216758&7,21$1''(02/,7,21:$67(0$7(5,$/6:,//%(6257('216,7(6285&(6(3$5$7('25%8/.0,;('6,1*/(675($0,'(17,),(6',9(56,21)$&,/,7,(6:+(5(&216758&7,21$1''(02/,7,21:$67(0$7(5,$/&2//(&7(':,//%(7$.(163(&,),(67+$77+($028172)&216758&7,21$1''(02/,7,21:$67(0$7(5,$/6',9(57('6+$//%(&$/&8/$7('%<:(,*+72592/80(%87127%<%27+:$67(0$1$*(0(17&203$1<87,/,=($:$67(0$1$*(0(17&203$1<7+$7&$13529,'(9(5,),$%/('2&80(17$7,217+$77+(3(5&(17$*(2)&216758&7,21$1''(02/,7,21:$67(0$7(5,$/',9(57(')5207+(/$1'),//&203/,(6:,7+7+,66(&7,21127(7+(2:1(525&2175$&7256+$//0$.(7+('(7(50,1$7,21,)7+(&216758&7,21$1''(02/,7,21:$67(0$7(5,$/:,//%(',9(57('%<$:$67(0$1$*(0(17&203$1<(;&(37,216726(&7,216$1'(;&$9$7('62,/$1'/$1'&/($5,1*'(%5,6$/7(51$7(:$67(5('8&7,210(7+2'6'(9(/23('%<:25.,1*:,7+/2&$/$*(1&,(6,)',9(56,21255(&<&/()$&,/,7,(6&$3$%/(2)&203/,$1&(:,7+7+,6,7(0'2127(;,67'(02/,7,21:$67(0((7,1*/2&$/25',1$1&(25&$/&8/$7(',1&216,'(5$7,212)/2&$/5(&<&/,1*)$&,/,7,(6$1'0$5.(76:$67(675($05('8&7,21$/7(51$7,9(7+(&20%,1(':(,*+72)1(:&216758&7,21',6326$/7+$7'2(6127(;&(('7:23281'63(5648$5()2272)%8,/',1*$5($0$<%('((0('720((77+(3(5&(170,1,0805(48,5(0(17$6$33529('%<7+((1)25&,1*$*(1&<'2&80(17$7,21'2&80(17$7,216+$//%(3529,'('727+((1)25&,1*$*(1&<:+,&+'(021675$7(6&203/,$1&(:,7+6(&7,2167+528*+7+(:$67(0$1$*(0(173/$16+$//%(83'$7('$61(&(66$5<$1'6+$//%($&&(66,%/('85,1*&216758&7,21)25(;$0,1$7,21%<7+((1)25&,1*$*(1&<127(66$03/()2506)281',1³$*8,'(727+(&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'(1215(6,'(17,$/´/2&$7('$7287'225:$7(586(287'225327$%/(:$7(586(,1/$1'6&$3($5($61215(6,'(17,$/'(9(/230(1766+$//&203/<:,7+$/2&$/:$7(5()),&,(17/$1'6&$3(25',1$1&(257+(&855(17&$/,)251,$'(3$570(172):$7(55(6285&(6 02'(/:$7(5()),&,(17/$1'6&$3(25',1$1&(0:(/2:+,&+(9(5,6025(675,1*(17127(67+(02'(/:$7(5()),&,(17/$1'6&$3(25',1$1&(0:(/2,6/2&$7(',17+(&$/,)251,$&2'(2)5(*8/$7,2167,7/(&+$37(5',9,6,210:(/2$1'6833257,1*'2&80(176,1&/8',1*$:$7(5%8'*(7&$/&8/$725$5($9$,/$%/($7KWWSVZZZZDWHUFDJRY287'225327$%/(:$7(586(,1/$1'6&$3($5($6)2538%/,&6&+22/6$1'&20081,7<&2//(*(6/$1'6&$3(352-(&76$6'(6&5,%(',16(&7,216$1'6+$//&203/<:,7+7+(&$/,)251,$'(3$570(172):$7(55(6285&(602'(/:$7(5()),&,(17/$1'6&$3(25',1$1&(0:(/2&200(1&,1*:,7+6(&7,212)&+$37(5',9,6,217,7/(&$/,)251,$&2'(2)*(1(5$/6&23(7+(3529,6,2162)7+,6&+$37(56+$//287/,1(0($162)$&+,(9,1*0$7(5,$/&216(59$7,21$1'5(6285&(()),&,(1&<7+528*+3527(&7,212)%8,/',1*6)520(;7(5,2502,6785(&216758&7,21:$67(',9(56,21(03/2<0(172)7(&+1,48(6725('8&(32//87,217+528*+5(&<&/,1*2)0$7(5,$/6$1'%8,/',1*&200,66,21,1*257(67,1*$1'$'-867,1*',9,6,210$7(5,$/&216(59$7,21$1'5(6285&(()),&,(1&<127(6,)&217$0,1$7,21%<',6($6(253(67,1)(67$7,21,66863(&7('&217$&77+(&2817<$*5,&8/785$/&200,66,21(5$1')2//2:,76',5(&7,21)255(&<&/,1*25',6326$/2)7+(0$7(5,$/ZZZFGIDFDJRYH[HFFRXQW\FRXQW\BFRQWDFWVKWPO)25$0$32).12:13(67$1'25',6($6(48$5$17,1(=21(6&2168/7:,7+7+(&$/,)251,$'(3$570(172))22'$1'$*5,&8/785(ZZZFGIDFDJRY%8,/',1*0$,17(1$1&($1'23(5$7,2165(&<&/,1*%<2&&83$1763529,'(5($',/<$&&(66,%/($5($67+$76(59(7+((17,5(%8,/',1*$1'$5(,'(17,),(')257+('(326,7,1*6725$*($1'&2//(&7,212)121+$=$5'2860$7(5,$/6)255(&<&/,1*,1&/8',1*$7$0,1,0803$3(5&2558*$7('&$5'%2$5'*/$663/$67,&625*$1,&:$67($1'0(7$/6250((7$/$:)8//<(1$&7('/2&$/5(&<&/,1*25',1$1&(,)025(5(675,&7,9((;&(37,21585$/-85,6',&7,2167+$70((7$1'$33/<)257+((;(037,21,138%/,&5(6285&(6&2'($$(76(46+$//$/62%((;(037)5207+(25*$1,&:$67(3257,212)7+,66(&7,21$'',7,216$//$'',7,216&21'8&7(':,7+,1$0217+3(5,2'81'(56,1*/(2508/7,3/(3(50,765(68/7,1*,1$1,1&5($6(2)3(5&(1725025(,1)/225$5($6+$//3529,'(5(&<&/,1*$5($6216,7((;&(37,21$'',7,216:,7+,1$7(1$1763$&(5(68/7,1*,1/(667+$1$3(5&(17,1&5($6(,17+(7(1$1763$&()/225$5($6$03/(25',1$1&(63$&($//2&$7,21)255(&<&/,1*$5($66+$//&203/<:,7+&+$37(53$57',9,6,212)7+(38%/,&5(6285&(6&2'(&+$37(5,6.12:1$67+(&$/,)251,$62/,':$67(5(86($1'5(&<&/,1*$&&(66$&72)$&7127($6$03/(25',1$1&()2586(%</2&$/$*(1&,(60$<%()281',1$33(1',;$2)7+('2&80(17$77+(&$/5(&<&/(¶6:(%6,7(&200,66,21,1*>1@1(:%8,/',1*6648$5()((7$1'29(5)251(:%8,/',1*6648$5()((7$1'29(5%8,/',1*&200,66,21,1*6+$//%(,1&/8'(',17+('(6,*1$1'&216758&7,21352&(66(62)7+(%8,/',1*352-(&7729(5,)<7+$77+(%8,/',1*6<67(06$1'&20321(1760((77+(2:1(5¶6252:1(55(35(6(17$7,9(¶6352-(&75(48,5(0(176&200,66,21,1*6+$//%(3(5)250(',1$&&25'$1&(:,7+7+,66(&7,21%<75$,1('3(56211(/:,7+(;3(5,(1&(21352-(&762)&203$5$%/(6,=($1'&203/(;,7<)25,2&&83$1&,(67+$7$5(1275(*8/$7('%<26+3'25)25,2&&83$1&,(6$1'/2&&83$1&,(67+$7$5(1275(*8/$7('%<7+(&$/,)251,$(1(5*<&2'(6(&7,216&23($//5(48,5(0(176,16(&7,2167+528*+6+$//$33/<127()25(1(5*<5(/$7('6<67(0681'(57+(6&23(6(&7,212)7+(&$/,)251,$(1(5*<&2'(,1&/8',1*+($7,1*9(17,/$7,21$,5&21',7,21,1*+9$&6<67(06$1'&21752/6,1'225/,*+7,1*6<67(06$1'&21752/6$6:(//$6:$7(5+($7,1*6<67(06$1'&21752/65()(572&$/,)251,$(1(5*<&2'(6(&7,21)25&200,66,21,1*5(48,5(0(176&200,66,21,1*5(48,5(0(1766+$//,1&/8'(2:1(5¶6252:1(55(35(6(17$7,9(¶6352-(&75(48,5(0(176%$6,62)'(6,*1&200,66,21,1*0($685(66+2:1,17+(&216758&7,21'2&80(176&200,66,21,1*3/$1)81&7,21$/3(5)250$1&(7(67,1*'2&80(17$7,21$1'75$,1,1*&200,66,21,1*5(3257(;&(37,21681&21',7,21(':$5(+286(62)$1<6,=($5($6/(667+$1648$5()((786(')252)),&(62527+(5&21',7,21('$&&(6625<63$&(6:,7+,181&21',7,21(':$5(+286(67(1$17,03529(0(176/(667+$1648$5()((7$6'(6&5,%(',16(&7,2123(13$5.,1**$5$*(62)$1<6,=(2523(13$5.,1**$5$*($5($62)$1<6,=(:,7+,1$6758&785(127()257+(385326(62)7+,66(&7,2181&21',7,21('6+$//0($1$%8,/',1*$5($255220:+,&+'2(61273529,'(+($7,1*$1'25$,5&21',7,21,1*,1)250$7,21$/127(6,$6$&,6$1$&&5(',7$7,21&5,7(5,$)2525*$1,=$7,2163529,',1*75$,1,1*$1'25&(57,),&$7,212)&200,66,21,1*3(56211(/$&,6$9$,/$%/(727+($87+25,7<+$9,1*-85,6',&7,21$6$5()(5(1&()2548$/,),&$7,2162)&200,66,21,1*3(56211(/$&'2(6127&(57,)<,1',9,'8$/672&21'8&7)81&7,21$/3(5)250$1&(7(6762572$'-867$1'%$/$1&(6<67(06)81&7,21$/3(5)250$1&(7(67,1*)25+($7,1*9(17,/$7,21$,5&21',7,21,1*6<67(06$1'/,*+7,1*&21752/60867%(3(5)250(',1&203/,$1&(:,7+7+(&$/,)251,$(1(5*<&2'(2:1(5¶6252:1(55(35(6(17$7,9(¶6352-(&75(48,5(0(176235>1@7+((;3(&7$7,216$1'5(48,5(0(1762)7+(%8,/',1*$335235,$7(72,763+$6(6+$//%('2&80(17('%()25(7+('(6,*13+$6(2)7+(352-(&7%(*,167+,6'2&80(17$7,216+$//,1&/8'(7+()2//2:,1*(19,5210(17$/$1'6867$,1$%,/,7<*2$/6%8,/',1*6867$,1$%/(*2$/6,1'225(19,5210(17$/48$/,7<5(48,5(0(176352-(&7352*5$0,1&/8',1*)$&,/,7<)81&7,216$1'+28562)23(5$7,21$1'1((')25$)7(5+285623(5$7,21(48,30(17$1'6<67(06(;3(&7$7,216%8,/',1*2&&83$17$1'23(5$7,21$1'0$,17(1$1&(2 03(56211(/(;3(&7$7,216%$6,62)'(6,*1%2'>1@$:5,77(1(;3/$1$7,212)+2:7+('(6,*12)7+(%8,/',1*6<67(060((767+(2356+$//%(&203/(7('$77+('(6,*13+$6(2)7+(%8,/',1*352-(&77+(%$6,62)'(6,*1'2&80(176+$//&29(57+()2//2:,1*6<67(065(1(:$%/((1(5*<6<67(06/$1'6&$3(,55,*$7,216<67(06:$7(55(86(6<67(06&200,66,21,1*3/$1>1@35,25723(50,7,668$1&($&200,66,21,1*3/$16+$//%(&203/(7('72'2&80(17+2:7+(352-(&7:,//%(&200,66,21('7+(&200,66,21,1*3/$16+$//,1&/8'(7+()2//2:,1*$*(1(5$/352-(&7,1)250$7,21%&200,66,21,1**2$/6&6<67(0672%(&200,66,21('3/$16727(676<67(06$1'&20321(1766+$//,1&/8'(D$1(;3/$1$7,212)7+(25,*,1$/'(6,*1,17(17E(48,30(17$1'6<67(0672%(7(67(',1&/8',1*7+((;7(172)7(676F)81&7,21672%(7(67('G&21',7,21681'(5:+,&+7+(7(676+$//%(3(5)250('H0($685$%/(&5,7(5,$)25$&&(37$%/(3(5)250$1&('&200,66,21,1*7($0,1)250$7,21(&200,66,21,1*352&(66$&7,9,7,(66&+('8/(6$1'5(63216,%,/,7,(63/$16)257+(&203/(7,212)&200,66,21,1*6+$//%(,1&/8'(')81&7,21$/3(5)250$1&(7(67,1*>1@)81&7,21$/3(5)250$1&(7(6766+$//'(021675$7(7+(&255(&7,167$//$7,21$1'23(5$7,212)($&+&20321(176<67(0$1'6<67(0726<67(0,17(5)$&(,1$&&25'$1&(:,7+7+($33529('3/$16$1'63(&,),&$7,216)81&7,21$/3(5)250$1&(7(67,1*5(325766+$//&217$,1,1)250$7,21$''5(66,1*($&+2)7+(%8,/',1*&20321(1767(67('7+(7(67,1*0(7+2'687,/,=('$1',1&/8'($1<5($',1*6$1'$'-8670(1760$'('2&80(17$7,21$1'75$,1,1*>1@$6<67(060$18$/$1'6<67(0623(5$7,21675$,1,1*$5(5(48,5(',1&/8',1*2&&83$7,21$/6$)(7<$1'+($/7+$&726+$5(48,5(0(176,1&$/,)251,$&2'(2)5(*8/$7,216&&57,7/(6(&7,21$1'27+(55(/$7('5(*8/$7,2166<67(060$18$/>1@'2&80(17$7,212)7+(23(5$7,21$/$63(&762)7+(%8,/',1*6+$//%(&203/(7(':,7+,17+(6<67(060$18$/$1''(/,9(5('727+(%8,/',1*2:1(5255(35(6(17$7,9(7+(6<67(060$18$/6+$//,1&/8'(7+()2//2:,1*6,7(,1)250$7,21,1&/8',1*)$&,/,7<'(6&5,37,21+,6725<$1'&855(175(48,5(0(1766,7(&217$&7,1)250$7,21%$6,&23(5$7,216$1'0$,17(1$1&(,1&/8',1**(1(5$/6,7(23(5$7,1*352&('85(6%$6,&7528%/(6+227,1*5(&200(1'('0$,17(1$1&(5(48,5(0(1766,7((9(176/2*0$-256<67(066,7((48,30(17,19(1725<$1'0$,17(1$1&(127(6$&23<2)9(5,),&$7,2165(48,5('%<7+((1)25&,1*$*(1&<257+,6&2'(27+(55(6285&(6$1''2&80(17$7,21,)$33/,&$%/(6<67(0623(5$7,21675$,1,1*>1@$352*5$0)2575$,1,1*2)7+($335235,$7(0$,17(1$1&(67$)))25($&+(48,30(177<3($1'256<67(06+$//%('(9(/23('$1''2&80(17(',17+(&200,66,21,1*5(3257$1'6+$//,1&/8'(7+()2//2:,1*6<67(0(48,30(1729(59,(::+$7,7,6:+$7,7'2(6$1':,7+:+$727+(56<67(06$1'25(48,30(17,7,17(5)$&(65(9,(:$1''(021675$7,212)6(59,&,1*35(9(17,9(0$,17(1$1&(5(9,(:2)7+(,1)250$7,21,17+(6<67(060$18$/5(9,(:2)7+(5(&25''5$:,1*6217+(6<67(0(48,30(17&200,66,21,1*5(3257>1@$5(32572)&200,66,21,1*352&(66$&7,9,7,(681'(57$.(17+528*+7+('(6,*1$1'&216758&7,213+$6(62)7+(%8,/',1*352-(&76+$//%(&203/(7('$1'3529,'('727+(2:1(5255(35(6(17$7,9(7(67,1*$1'$'-867,1*1(:%8,/',1*6/(667+$1648$5()((77(67,1*$1'$'-867,1*2)6<67(066+$//%(5(48,5(')251(:%8,/',1*6/(667+$1648$5()((7251(:6<67(06726(59($1+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5'(),1,7,216$'',7,21$'',7,2125$/7(5$7,2168%-(&7726(&7,21+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5*5((1%8,/',1*5(6(59('127()25(1(5*<5(/$7('6<67(0681'(57+(6&23(6(&7,212)7+(+<3(5/,1.9,(:(5&$/,)251,$&$(1(5*<&2'(&$/,)251,$(1(5*<&2'(,1&/8',1*+($7,1*9(17,/$7,21$,5&21',7,21,1*+9$&6<67(06$1'&21752/6,1'225/,*+7,1*6<67(0$1'&21752/6$6:(//$6:$7(5+($7,1*6<67(06$1'&21752/65()(572&$/,)251,$+<3(5/,1.9,(:(5&$/,)251,$&$(1(5*<&2'((1(5*<&2'(6(&7,21)25&200,66,21,1*5(48,5(0(176$1'6(&7,216$1'%)25$'',7,21$/7(67,1*5(48,5(0(1762)63(&,),&6<67(066<67(06'(9(/23$:5,77(13/$12)352&('85(6)257(67,1*$1'$'-867,1*6<67(066<67(0672%(,1&/8'(')257(67,1*$1'$'-867,1*6+$//,1&/8'($6$33/,&$%/(727+(352-(&75(1(:$%/((1(5*<6<67(06/$1'6&$3(,55,*$7,216<67(06:$7(55(86(6<67(06*(1(5$/',9,6,21(19,5210(17$/48$/,7<6&23(7+(3529,6,2162)7+,6&+$37(56+$//287/,1(0($162)5('8&,1*7+(48$17,7<2)$,5&217$0,1$1767+$7$5(2'25286,55,7$7,1*$1'25+$50)8/727+(&20)257$1':(//%(,1*2)$%8,/',1*¶6,167$//(562&&83$176$1'1(,*+%256),5(3/$&(6),5(3/$&(6,167$//21/<$',5(&79(176($/('&20%867,21*$6256($/(':22'%851,1*),5(3/$&(25$6($/(':22'6729(253(//(76729($1'5()(5725(6,'(17,$/5(48,5(0(176,17+(&$/,)251,$(1(5*<&2'(7,7/(3$5768%&+$37(56(&7,21:22'6729(63(//(76729(6$1'),5(3/$&(66+$//&203/<:,7+$33/,&$%/(/2&$/25',1$1&(6:22'6729(6:22'6729($1'3(//(76729(66+$//&203/<:,7+86(3$1(:6285&(3(5)250$1&(67$1'$5'61636(0,66,21/,0,76$6$33/,&$%/($1'6+$//+$9($3(50$1(17/$%(/,1',&$7,1*7+(<$5(&(57,),('720((77+((0,66,21/,0,7632//87$17&21752/7(0325$5<9(17,/$7,217+(3(50$1(17+9$&6<67(06+$//21/<%(86(''85,1*&216758&7,21,)1(&(66$5<72&21',7,217+(%8,/',1*25$5($62)$'',7,2125$/7(5$7,21:,7+,17+(5(48,5('7(03(5$785(5$1*()250$7(5,$/$1'(48,30(17,167$//$7,21,)7+(+9$&6<67(0,686(''85,1*&216758&7,2186(5(7851$,5),/7(56:,7+$0,1,080()),&,(1&<5(3257,1*9$/8(0(592)%$6('21$6+5$(25$1$9(5$*(()),&,(1&<2)3(5&(17%$6('21$6+5$(5(3/$&($//),/7(56,00(',$7(/<35,25722&&83$1&<25,)7+(%8,/',1*,62&&83,(''85,1*$/7(5$7,21$77+(&21&/86,212)&216758&7,21&29(5,1*2)'8&723(1,1*6$1'3527(&7,212)0(&+$1,&$/(48,30(17'85,1*&216758&7,21$77+(7,0(2)528*+,167$//$7,21$1''85,1*6725$*(217+(&216758&7,216,7(817,/),1$/67$57832)7+(+($7,1*&22/,1*$1'9(17,/$7,1*(48,30(17$//'8&7$1'27+(55(/$7('$,5',675,%87,21&20321(1723(1,1*66+$//%(&29(5(':,7+7$3(3/$67,&6+((70(7$/2527+(50(7+2'6$&&(37$%/(727+((1)25&,1*$*(1&<725('8&(7+($028172)'867:$7(5$1''(%5,6:+,&+0$<(17(57+(6<67(0),1,6+0$7(5,$/32//87$17&21752/),1,6+0$7(5,$/66+$//&203/<:,7+6(&7,2167+528*+$'+(6,9(66($/$176$1'&$8/.6$'+(6,9(66($/$176$1'&$8/.686('217+(352-(&76+$//0((77+(5(48,5(0(1762)7+()2//2:,1*67$1'$5'6$'+(6,9(6$'+(6,9(%21',1*35,0(56$'+(6,9(35,0(566($/$1766($/$1735,0(56$1'&$8/.66+$//&203/<:,7+/2&$/255(*,21$/$,532//87,21&21752/25$,548$/,7<0$1$*(0(17',675,&758/(6:+(5($33/,&$%/(256&$40'58/(92&/,0,76$66+2:1,17$%/(6$1'68&+352'8&76$/626+$//&203/<:,7+7+(58/(352+,%,7,21217+(86(2)&(57$,172;,&&203281'6&+/252)250(7+</(1(',&+/25,'(0(7+</(1(&+/25,'(3(5&+/252(7+</(1($1'75,&+/252(7+</(1((;&(37)25$(5262/352'8&76$663(&,),(',168%6(&7,21%(/2:$(5262/$'+(6,9(6$1'60$//(581,76,=(62)$'+(6,9(6$1'6($/$1725&$8/.,1*&203281'6,181,762)352'8&7/(663$&.$*,1*:+,&+'2127:(,*+025(7+$121(3281'$1''2127&216,672)025(7+$1)/8,'281&(66+$//&203/<:,7+67$7(:,'(92&67$1'$5'6$1'27+(55(48,5(0(176,1&/8',1*352+,%,7,2162186(2)&(57$,172;,&&203281'62)&$/,)251,$&2'(2)5(*8/$7,2167,7/(&200(1&,1*:,7+6(&7,21D0$.(83:$7(5)25&22/,1*72:(56:+(5()/2:7+528*+,6*5($7(57+$1*30/6E0$.(83:$7(5)25(9$325$7,9(&22/(56*5($7(57+$1*30/6F67($0$1'+27:$7(5%2,/(56:,7+(1(5*<,1387025(7+$1%78+.:(;&(66&2168037,21$6(3$5$7(68%0(7(5250(7(5,1*'(9,&(6+$//%(3529,'(')25$1<7(1$17:,7+,1$1(:%8,/',1*25:,7+,1$1$'',7,217+$7,6352-(&7('72&21680(025(7+$1*$/'$<:$7(5&216(59,1*3/80%,1*),;785(6$1'),77,1*63/80%,1*),;785(6:$7(5&/26(76$1'85,1$/6$1'),77,1*6)$8&(76$1'6+2:(5+($'66+$//&203/<:,7+7+()2//2:,1*:$7(5&/26(767+(())(&7,9()/86+92/80(2)$//:$7(5&/26(766+$//127(;&(('*$//2163(5)/86+7$1.7<3(:$7(5&/26(766+$//%(&(57,),('727+(3(5)250$1&(&5,7(5,$2)7+(86(3$:$7(56(16(63(&,),&$7,21)257$1.7<3(72,/(76127(7+(())(&7,9()/86+92/80(2)'8$/)/86+72,/(76,6'(),1('$67+(&20326,7($9(5$*()/86+92/80(2)7:25('8&(')/86+(6$1'21()8//)/86+5(*8/$7,216(;&(377+$77+((9$3275$163,5$7,21$'-8670(17)$&725(7$)6+$//%(:,7+$1$'',7,21$/:$7(5$//2:$1&()2563(&,$//$1'6&$3($5($66/$2)(;&(37,21$1<352-(&7:,7+$1$**5(*$7(/$1'6&$3($5($2)648$5()((725/(660$<&203/<:,7+7+(35(6&5,37,9(0($685(6&217$,1(',1$33(1',;'2)7+(0:(/21(:/<&216758&7('/$1'6&$3(61(:&216758&7,21352-(&76:,7+$1$**5(*$7(/$1'6&$3($5($(48$/7225*5($7(57+$1648$5()((75(+$%,/,7$7('/$1'6&$3(65(+$%,/,7$7('/$1'6&$3(352-(&76:,7+$1$**5(*$7(/$1'6&$3($5($(48$/7225*5($7(57+$1648$5()((7KWWSVZZZGJVFDJRY%6&5HVRXUFHV3DJH&RQWHQW%XLOGLQJ6WDQGDUGV&RPPLVVLRQ5HVRXUFHV/LVW)ROGHU&$/*UHHQ0$<%(86('72$66,67,1'2&80(17,1*&203/,$1&(:,7+7+(:$67(0$1$*(0(173/$10,;('&216758&7,21$1''(02/,7,21'(%5,6& '352&(66256&$1%(/2&$7('$77+(&$/,)251,$'(3$570(172)5(6285&(65(&<&/,1*$1'5(&29(5<&$/5(&<&/(81,9(56$/:$67(>$@$'',7,216$1'$/7(5$7,21672$%8,/',1*257(1$1763$&(7+$70((77+(6&23,1*3529,6,216,16(&7,21)251215(6,'(17,$/$'',7,216$1'$/7(5$7,2166+$//5(48,5(9(5,),&$7,217+$781,9(56$/:$67(,7(0668&+$6)/825(6&(17/$036$1'%$//$67$1'0(5&85<&217$,1,1*7+(50267$76$6:(//$627+(5&$/,)251,$352+,%,7('81,9(56$/:$67(0$7(5,$/6$5(',6326('2)3523(5/<$1'$5(',9(57(')520/$1'),//6$/,672)352+,%,7('81,9(56$/:$67(0$7(5,$/66+$//%(,1&/8'(',17+(&216758&7,21'2&80(176127(5()(5727+(81,9(56$/:$67(58/(/,1.$7KWWSVGWVFFDJRYXQLYHUVDOZDVWH(;&$9$7('62,/$1'/$1'&/($5,1*'(%5,63(5&(172)75((667803652&.6$1'$662&,$7('9(*(7$7,21$1'62,/65(68/7,1*35,0$5,/<)520/$1'&/($5,1*6+$//%(5(86('255(&<&/(')25$3+$6('352-(&768&+0$7(5,$/0$<%(672&.3,/('216,7(817,/7+(6725$*(6,7(,6'(9(/23('(;&(37,215(86((,7+(521252))6,7(2)9(*(7$7,212562,/&217$0,1$7('%<',6($6(253(67,1)(67$7,21352&('85(63(5)2507(67,1*$1'$'-867,1*352&('85(6,1$&&25'$1&(:,7+0$18)$&785(5¶663(&,),&$7,216$1'$33/,&$%/(67$1'$5'621($&+6<67(0+9$&%$/$1&,1*,1$'',7,21727(67,1*$1'$'-867,1*%()25($1(:63$&(&21',7,21,1*6<67(06(59,1*$%8,/',1*2563$&(,623(5$7(')251250$/86(+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5'(),1,7,216%$/$1&(%$/$1&(7+(6<67(0,1$&&25'$1&(:,7+7+(352&('85(6'(),1('%<7+(7(67,1*$'-867,1*$1'%$/$1&,1*%85($81$7,21$/67$1'$5'67+(1$7,21$/(19,5210(17$/%$/$1&,1*%85($8352&('85$/67$1'$5'6$662&,$7('$,5+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5'(),1,7,216%$/$1&(%$/$1&(&281&,/1$7,21$/67$1'$5'625$6$33529('%<7+(+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5'(),1,7,216(1)25&,1*B$*(1&<(1)25&,1*$*(1&<5(3257,1*$)7(5&203/(7,212)7(67,1*$'-867,1*$1'%$/$1&,1*3529,'($),1$/5(32572)7(67,1*6,*1('%<7+(,1',9,'8$/5(63216,%/()253(5)250,1*7+(6(6(59,&(623(5$7,21$1'0$,17(1$1&(2 00$18$/3529,'(7+(%8,/',1*2:1(5255(35(6(17$7,9(:,7+'(7$,/('23(5$7,1*$1'0$,17(1$1&(,16758&7,216$1'&23,(62)*8$5$17,(6:$55$17,(6)25($&+6<67(02 0,16758&7,2166+$//%(&216,67(17:,7+26+$5(48,5(0(176,1&&57,7/(6(&7,21$1'27+(55(/$7('5(*8/$7,216,163(&7,216$1'5(32576,1&/8'($&23<2)$//,163(&7,219(5,),&$7,216$1'5(325765(48,5('%<7+(+<3(5/,1.9,(:(5&$/,)251,$&$*5((1&2'(&+$37(5'(),1,7,216(1)25&,1*B$*(1&<(1)25&,1*$*(1&<NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE202505.11.23Page 172 of 802 0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2130CAL GREEN REQUIREMENTSG-107KATHRYN HICKSDAVID GIBBSKATHRYN HICKS10.21.2022DAVID GIBBS0(7$//,&3,*0(17('&2$7,1*608/7,&2/25&2$7,1*635(75($70(17:$6+35,0(5635,0(566($/(56$1'81'(5&2$7(565($&7,9(3(1(75$7,1*6($/(565(&<&/('&2$7,1*6522)&2$7,1*6586735(9(17$7,9(&2$7,1*66+(//$&6&/($523$48(63(&,$/7<35,0(566($/(56$1'81'(5&2$7(5667$,166721(&2162/,'$1766:,00,1*322/&2$7,1*675$)),&0$5.,1*&2$7,1*678%$1'7,/(5(),1,6+&2$7,1*6:$7(53522),1*0(0%5$1(6:22'&2$7,1*6:22'35(6(59$7,9(6=,1&5,&+35,0(56*5$062)92&3(5/,7(52)&2$7,1*,1&/8',1*:$7(5$1',1&/8',1*(;(037&203281'67+(63(&,),('/,0,765(0$,1,1())(&7(1/(665(9,6('/,0,76$5(/,67(',168%6(48(17&2/8016,17+(7$%/(9$/8(6,17+,67$%/($5('(5,9(')5207+26(63(&,),('%<7+(&$/,)251,$$,55(6285&(6%2$5'$5&+,7(&785$/&2$7,1*668**(67('&21752/0($685()(%8$5<025(,1)250$7,21,6$9$,/$%/()5207+($,55(6285&(6%2$5'$5&+,7(&785$/$33/,&$7,2167$%/( $'+(6,9(92&/,0,7,1'225&$53(7$'+(6,9(6&$53(73$'$'+(6,9(6287'225&$53(7$'+(6,9(6:22')/225,1*$'+(6,9(658%%(5)/225,1*$'+(6,9(668%)/225$'+(6,9(6&(5$0,&7,/($'+(6,9(6&855(1792&/,0,7/(66:$7(5$1'/(66(;(037&203281'6,1*5$063(5/,7(59&7$1'$63+$/77,/($'+(6,9(6'5<:$//$1'3$1(/$'+(6,9(6&29(%$6($'+(6,9(608/7,385326(&216758&7,21$'+(6,9(66758&785$/*/$=,1*$'+(6,9(66,1*/(3/<522)0(0%5$1($'+(6,9(627+(5$'+(6,9(612763(&,),&$//</,67('63(&,$/7<$33/,&$7,21639&:(/',1*&39&:(/',1*$%':(/',1*3/$67,&&(0(17:(/',1*$'+(6,9(35,0(5)253/$67,&&217$&7$'+(6,9(63(&,$/385326(&217$&7$'+(6,9(6758&785$/:22'0(0%(5$'+(6,9(723$1'75,0$'+(6,9(668%675$7(63(&,),&$33/,&$7,2160(7$/720(7$/3/$67,&)2$063252860$7(5,$/(;&(37:22':22'),%(5*/$66,)$1$'+(6,9(,686('72%21'',66,0,/$568%675$7(672*(7+(57+($'+(6,9(:,7+7+(+,*+(6792&&217(176+$//%($//2:(')25$'',7,21$/,1)250$7,215(*$5',1*0(7+2'6720($685(7+(92&&217(1763(&,),(',17+,67$%/(6((6287+&2$67$,548$/,7<0$1$*(0(17',675,&758/(:::$5%&$*29'5'%6&&85+70/53')352'8&77$%/( )250$/'(+<'(/,0,76+$5':22'3/<:22'9(1((5&25(+$5':22'3/<:22'&20326,7(&25(3$57,&/(%2$5'0(',80'(16,7<),%(5%2$5'7+,10(',80'(16,7<),%(5%2$5'&855(17/,0,70$;,080)250$/'(+<'((0,66,216,13$5763(50,//,219$/8(6,17+,67$%/($5('(5,9(')5207+26(63(&,),('%<7+(&$/,)251,$$,55(6285&(6%2$5'$,572;,&6&21752/0($685()25&20326,7(:22'$67(67(',1$&&25'$1&(:,7+$670()25$'',7,21$/,1)250$7,216((&$/,)251,$&2'(2)5(*8/$7,2167,7/(6(&7,2167+528*+7+,10(',80'(16,7<),%(5%2$5'+$6$0$;,0807+,&.1(662),1&+00&2$7,1*&$7(*25<7$%/( 92&&217(17/,0,76)25$5&+,7(&785$/&2$7,1*6)/$7&2$7,1*6121)/$7&2$7,1*6121)/$7+,*+*/266&2$7,1*663(&,$/7<&2$7,1*6$/80,180522)&2$7,1*6%$6(0(1763(&,$/7<&2$7,1*6%,780,1286522)&2$7,1*6&855(1792&/,0,7*5$062)92&3(5/,7(52)&2$7,1*/(66:$7(5$1'/(66(;(037&203281'6%,780,1286522)35,0(56%21'%5($.(56&21&5(7(&85,1*&203281'6&21&5(7(0$6215<6($/(56'5,9(:$<6($/(56'5<)2*&2$7,1*6)$8;),1,6+,1*&2$7,1*6)/225&2$7,1*6)2505(/($6(&203281'6*5$3+,&$576&2$7,1*66,*13$,176+,*+7(03(5$785(&2$7,1*6,'8675,$/0$,17(1$1&(&2$7,1*6/2:62/,'6&2$7,1*60$*1(6,7(&(0(17&2$7,1*60$67,&7(;785(&2$7,1*6),5(5(6,67,9(&2$7,1*66($/$1767$%/( 6($/$1792&/,0,7$5&+,7(&785$/0$5,1('(&.1210(0%5$1(522)52$':$<6,1*/(3/<522)0(0%5$1(27+(5&855(1792&/,0,7/(66:$7(5$1'/(66(;(037&203281'6,1*5$063(5/,7(56($/$1735,0(56$5&+,7(&785$/12132528632528602',),('%,780,12860$5,1('(&.27+(5127()25$'',7,21$/,1)250$7,215(*$5',1*0(7+2'6720($685(7+(92&&217(1763(&,),(',17+(6(7$%/(66((6287+&2$67$,548$/,7<0$1$*(0(17',675,&758/(&$/,)251,$*5((1%8,/',1*67$1'$5'6&2'(1215(6,'(17,$/0$1'$725<0($685(66+((7-$18$5<,1&/8'(6-8/<6833/(0(173$,176$1'&2$7,1*6$5&+,7(&785$/3$,176$1'&2$7,1*66+$//&203/<:,7+92&/,0,76,17$%/(2)7+($5%$5&+,7(&785$/&2$7,1*668**(67('&21752/0($685($66+2:1,17$%/(81/(66025(675,1*(17/2&$//,0,76$33/<7+(92&&217(17/,0,7)25&2$7,1*67+$7'21270((77+('(),1,7,216)257+(63(&,$/7<&2$7,1*6&$7(*25,(6/,67(',17$%/(6+$//%('(7(50,1('%<&/$66,)<,1*7+(&2$7,1*$6$)/$7121)/$725121)/$7+,*+*/266&2$7,1*%$6('21,76*/266$6'(),1(',168%6(&7,216$1'2)7+(&$/,)251,$$,55(6285&(6%2$5'68**(67('&21752/0($685($1'7+(&255(6321',1*)/$7121)/$725121)/$7+,*+*/26692&/,0,7,17$%/(6+$//$33/<$(5262/3$,176$1'&2$7,1*6$(5262/3$,176$1'&2$7,1*66+$//0((77+(3:0,5/,0,76)2552&,16(&7,21$$1'27+(55(48,5(0(176,1&/8',1*352+,%,7,2162186(2)&(57$,172;,&&203281'6$1'2=21('(3/(7,1*68%67$1&(6,16(&7,216&$1''2)&$/,)251,$&2'(2)5(*8/$7,2167,7/(&200(1&,1*:,7+6(&7,21$1',1$5($681'(57+(-85,6',&7,212)7+(%$<$5($$,548$/,7<0$1$*(0(17',675,&7$'',7,21$//<&203/<:,7+7+(3(5&(1792&%<:(,*+72)352'8&7/,0,762)5(*8/$7,2158/(9(5,),&$7,219(5,),&$7,212)&203/,$1&(:,7+7+,66(&7,216+$//%(3529,'('$77+(5(48(672)7+((1)25&,1*$*(1&<'2&80(17$7,210$<,1&/8'(%87,6127/,0,7('727+()2//2:,1*0$18)$&785(5¶6352'8&763(&,),&$7,21),(/'9(5,),&$7,212)216,7(352'8&7&217$,1(56&$53(76<67(06$//&$53(7,167$//(',17+(%8,/',1*,17(5,256+$//0((77+(5(48,5(0(176)27+(&$/,)251,$'(3$570(172)38%/,&+($/7+67$1'$5'0(7+2')257+(7(67,1*$1'(9$/8$7,212)92/$7,/(25*$1,&&+(0,&$/(0,66,216)520,1'2256285&(686,1*(19,5210(17$/&+$0%(569(56,21-8$18$5<(0,66,217(67,1*0(7+2')25&$/,)251,$63(&,),&$7,216((&$/,)251,$'(3$570(172)38/,&+($/7+ 6:(%6,7()25&(57,),&$7,21352*5$06$1'7(67,1*/$%6+7736:::&'3+&$*29352*5$06&&'3+3'(2'&(+/%,$43$*(692&$63;0$7(5,$/&$53(7&86+,21$//&$53(7&86+,21,167$//(',17+(%8,/',1*,17(5,256+$//0((77+(5(48,5(0(1762)7+(&$/,)251,$'(3$570(172)38%/,&+($/7+67$1'$5'0(7+2')257+(7(67,1*$1'(9$/8$7,212)92/$7,/(25*$1,&&+(0,&$/(0,66,216)520,1'2256285&(686,1*(19,5210(17$/&+$0%(569(56,21-8$18$5<(0,66,217(67,1*0(7+2')25&$/,)251,$63(&,),&$7,216((&$/,)251,$'(3$570(172)38/,&+($/7+ 6:(%6,7()25&(57,),&$7,21352*5$06$1'7(67,1*/$%6+7736:::&'3+&$*29352*5$06&&'3+3'(2'&(+/%,$43$*(692&$63;0$7(5,$/&$53(7$'+(6,9($//&$53(7$'+(6,9(6+$//0((77+(5(48,5(0(1762)7$%/(&20326,7(:22'352'8&76+$5':22'3/<:22'3$57,&/(%2$5'$1'0(',80'(16,7<),%(5%2$5'&20326,7(:22'352'8&7686('217+(,17(5,2525(;7(5,252)7+(%8,/',1*6+$//0((77+(5(48,5(0(176)25)250$/'(+<'($663(&,),(',1$5%¶6$,572;,&6&21752/0($685($7&0)25&20326,7(:22'&&5(76(47+26(0$7(5,$/6127(;(037('81'(57+($7&008670((77+(63(&,),('(0,66,21/,0,76$66+2:1,17$%/('2&80(17$7,219(5,),&$7,212)&203/,$1&(:,7+7+,66(&7,216+$//%(3529,'('$65(48(67('%<7+((1)25&,1*$*(1&<'2&80(17$7,216+$//,1&/8'($7/($6721(2)7+()2//2:,1*352'8&7&(57,),&$7,216$1'63(&,),&$7,216&+$,12)&8672'<&(57,),&$7,216352'8&7/$%(/('$1',192,&('$60((7,1*7+(&20326,7(:22'352'8&765(*8/$7,216((&&57,7/(6(&7,21(76(4(;7(5,25*5$'(352'8&760$5.('$60((7,1*7+(36253667$1'$5'62)7+((1*,1((5(':22'$662&,$7,217+($8675$/,$1$61=625(8523($1667$1'$5'627+(50(7+2'6$&&(37$%/(727+((1)25&,1*$*(1&<5(6,/,(17)/2256<67(06:+(5(5(6,/,(17)/225,1*,6,167$//('$7/($672))/225$5($5(&(,9,1*5(6,/,(17)/225,1*6+$//0((77+(5(48,5(0(1762)7+(&$/,)251,$'(3$570(172)38%/,&+($/7+67$1'$5'0(7+2')257+(7(67,1*$1'(9$/8$7,212)92/$7,/(25*$1,&&+(0,&$/(0,66,216)520,1'2256285&(686,1*(19,5210(17$/&+$0%(569(56,21-8$18$5<(0,66,217(67,1*0(7+2')25&$/,)251,$63(&,),&$7,216((&$/,)251,$'(3$570(172)38/,&+($/7+ 6:(%6,7()25&(57,),&$7,21352*5$06$1'7(67,1*/$%6+7736:::&'3+&$*29352*5$06&&'3+3'(2'&(+/%,$43$*(692&$63;0$7(5,$/5(6,/,(17)/225,1*6<67(06)253(5&(172))/225$5($5(&(,9,1*5(6,/,(17)/225,1*,167$//('5(6,/,(17)/225,1*6+$//0((7$7/($6721(2)7+()2//2:,1*&(57,),('81'(57+(5(6,/,(17)/225&29(5,1*,167,787(5)&,)/2256&25(352*5$0&203/,$17:,7+7+(92&(0,66,21/,0,76$1'7(67,1*5(48,5(0(17663(&,),(',17+(&$/,)251,$'(3$570(172)38%/,&+($/7+¶667$1'$5'0(7+2')257+(7(67,1*$1'(9$/8$7,21&+$0%(569(56,21)(%58$5<&203/,$17:,7+7+(&2//$%25$7,9()25+,*+3(5)250$1&(6&+22/6&$/,)251,$&$&+36&5,7(5,$,17(535(7$7,21)25(4$1'(4)250(5/<(4'$7('-8/<$1'/,67(',17+(&+36+,*+3(5)250$1&(352'8&7'$7$%$6(25352'8&76&(57,),('81'(58/*5((1*8$5'*2/')250(5/<7+(*5((1*8$5'&+,/'5(1¶6 6&+22/6352*5$09(5,),&$7,212)&203/,$1&('2&80(17$7,216+$//%(3529,'('9(5,)<,1*7+$75(6,/,(17)/225,1*0$7(5,$/60((77+(32//87$17(0,66,21/,0,76),/7(56,10(&+$1,&$//<9(17,/$7('%8,/',1*63529,'(5(*8/$5/<2&&83,('$5($62)7+(%8,/',1*:,7+$,5),/75$7,210(',$)252876,'($1'5(7851$,57+$73529,'(6$7/($67$0,1,080()),&,(1&<5(3257,1*9$/8(0(592)0(59),/7(566+$//%(,167$//('35,25722&&83$1&<$1'5(&200(1'$7,216)250$,17(1$1&(:,7+),/7(562)7+(6$0(9$/8(6+$//%(,1&/8'(',17+(23(5$7,21$1'0$,17(1$1&(0$18$/(;&(37,21(;,67,1*0(&+$1,&$/(48,30(17/$%(/,1*,167$//('),/7(566+$//%(&/($5/</$%(/('%<7+(0$18)$&785(5,1',&$7,1*7+(0(595$7,1*(19,5210(17$/72%$&&2602.((76&21752/:+(5(287'225$5($6$5(3529,'(')25602.,1*352+,%,7602.,1*:,7+,1)((72)%8,/',1*(175,(6287'225$,5,17$.(6$1'23(5$%/(:,1'2:6$1':,7+,17+(%8,/',1*$6$/5($'<352+,%,7('%<27+(5/$:6255(*8/$7,21625$6(1)25&('%<25',1$1&(65(*8/$7,2162532/,&,(62)$1<&,7<&2817<&,7<$1'&2817<&$/,)251,$&20081,7<&2//(*(&$03862)7+(&$/,)251,$67$7(81,9(56,7<25&$03862)7+(81,9(56,7<2)&$/,)251,$:+,&+(9(5$5(025(675,1*(17:+(125',1$1&(65(*8/$7,2162532/,&,(6$5(127,13/$&(32676,*1$*(72,1)250%8,/',1*2&&83$1762)7+(352+,%,7,216,1'22502,6785(&21752/%8,/',1*66+$//0((725(;&(('7+(3529,6,2162)&$/,)251,$%8,/',1*&2'(&&57,7/(3$576(&7,2169(17,/$7,21$1'&+$37(5(;7(5,25:$//6)25$'',7,21$/0($685(66((6(&7,212)7+,6&2'(,1'22502,6785(&21752/2876,'($,5'(/,9(5<)250(&+$1,&$//<251$785$//<9(17,/$7('63$&(6,1%8,/',1*60((77+(0,1,0805(48,5(0(1762)6(&7,215(48,5(0(176)259(17,/$7,212)7+(&$/,)251,$(1(5*<&2'(257+($33/,&$%/(/2&$/&2'(:+,&+(9(5,6025(675,1*(17$1'',9,6,21&+$37(52)&&57,7/(&$5%21',2;,'(&2021,725,1*)25%8,/',1*625$'',7,216(48,33(':,7+'(0$1'&21752/9(17,/$7,21&26(16256$1'9(17,/$7,21&21752/66+$//%(63(&,),('$1',167$//(',1$&&25'$1&(:,7+7+(5(48,5(0(1762)7+(&$/,)251,$(1(5*<&2'(6(&7,21&,1'225$,548$/,7<$&2867,&$/&21752/(03/2<%8,/',1*$66(0%/,(6$1'&20321(176:,7+6281'75$160,66,21&/$6667&9$/8(6'(7(50,1(',1$&&25'$1&(:,7+$670($1'$670(25287'225,1'2256281'75$160,66,21&/$662,7&'(7(50,1(',1$&&25'$1&(:,7+$670(86,1*(,7+(57+(35(6&5,37,9(253(5)250$1&(0(7+2',16(&7,2125(;&(37,21%8,/',1*6:,7+)(:25122&&83$17625:+(5(2&&83$176$5(127/,.(/<72%($))(&7('%<(;7(5,2512,6($6'(7(50,1('%<7+((1)25&(0(17$87+25,7<68&+$6)$&725,(667$',8066725$*((1&/26('3$5.,1*6758&785(6$1'87,/,7<%8,/',1*6(;&(37,21>'6$66@)2538%/,&6&+22/6$1'&20081,7<&2//(*(67+(5(48,5(0(1762)7+,66(&7,21$1'$//68%6(&7,216$33/<21/<721(:&216758&7,21(;7(5,2512,6(75$160,66,2135(6&5,37,9(0(7+2':$//$1'522)&(,/,1*$66(0%/,(6(;326('727+(12,6(6285&(0$.,1*837+(%8,/',1*25$'',7,21(19(/23(25$/7(5('(19(/23(6+$//0((7$&20326,7(67&5$7,1*2)$7/($6725$&20326,7(2,7&5$7,1*2)12/(667+$1:,7+(;7(5,25:,1'2:62)$0,1,08067&2)252,7&2),17+()2//2:,1*/2&$7,216:,7+,17+(&1(/12,6(&2172852)$1$,53257(;&(37,216/'125&1(/)250,/,7$5<$,5325766+$//%('(7(50,1('%<7+()$&,/,7<$,5,167$//$7,21&203$7,%/(/$1'86(=21($,&8=3/$1/'125&1(/)2527+(5$,532576$1'+(/,32576)25:+,&+$/$1'86(3/$1+$6127%((1'(9(/23('6+$//%('(7(50,1('%<7+(/2&$/*(1(5$/3/$112,6((/(0(17:,7+,17+(&1(/25/'112,6(&2172852)$)5((:$<25(;35(66:$<5$,/52$',1'8675,$/6285&(25),;('*8,'(:$<6285&($6'(7(50,1('%<7+(12,6((/(0(172)7+(*(1(5$/3/$112,6((;32685(:+(5(12,6(&2172856$5(1275($',/<$9$,/$%/(%8,/',1*6(;326('72$12,6(/(9(/2)'%/(4+5'85,1*$1<+2852)23(5$7,216+$//+$9(%8,/',1*$'',7,2125$/7(5$7,21(;7(5,25:$//$1'522)&(,/,1*$66(0%/,(6(;326('727+(12,6(6285&(0((7,1*$&20326,7(67&5$7,1*2)$7/($67252,7&:,7+(;7(5,25:,1'2:62)$0,1,08067&2)252,7&(19,5210(17$/&20)257,167$//(575$,1,1*+9$&6<67(0,167$//(566+$//%(75$,1('$1'&(57,),(',17+(3523(5,167$//$7,212)+9$&6<67(06,1&/8',1*'8&76$1'(48,30(17%<$1$7,21$//<255(*,21$//<5(&2*1,=('75$,1,1*25&(57,),&$7,21352*5$081&(57,),('3(562160$<3(5)250+9$&,167$//$7,216:+(181'(57+(',5(&7683(59,6,21$1'5(63216,%,/,7<2)$3(562175$,1('$1'&(57,),('72,167$//+9$&6<67(0625&2175$&725/,&(16('72,167$//+9$&6<67(06(;$03/(62)$&&(37$%/(+9$&75$,1,1*$1'&(57,),&$7,21352*5$06,1&/8'(%87$5(127/,0,7('727+()2//2:,1*67$7(&(57,),('$335(17,&(6+,3352*5$0638%/,&87,/,7<75$,1,1*352*5$0675$,1,1*352*5$066321625('%<75$'(/$%252567$7(:,'((1(5*<&2168/7,1*259(5,),&$7,2125*$1,=$7,216352*5$066321625('%<0$18)$&785,1*25*$1,=$7,21627+(5352*5$06$&&(37$%/(727+((1)25&,1*$*(1&<63(&,$/,163(&7,21>+&'@:+(15(48,5('%<7+((1)25&,1*$*(1&<7+(2:1(5257+(5(63216,%/((17,7<$&7,1*$67+(2:1(5 6$*(176+$//(03/2<21(25025(63(&,$/,163(&7256723529,'(,163(&7,212527+(5'87,(61(&(66$5<7268%67$17,$7(&203/,$1&(:,7+7+,6&2'(63(&,$/,163(&72566+$//'(021675$7(&203(7(1&(727+(6$7,6)$&7,212)7+((1)25&,1*$*(1&<)257+(3$57,&8/$57<3(2),163(&7,21257$6.72%(3(5)250(',1$'',7,217227+(5&(57,),&$7,2162548$/,),&$7,216$&&(37$%/(727+((1)25&,1*$*(1&<7+()2//2:,1*&(57,),&$7,21625('8&$7,210$<%(&216,'(5('%<7+((1)25&,1*$*(1&<:+(1(9$/8$7,1*7+(48$/,),&$7,2162)$63(&,$/,163(&725&(57,),&$7,21%<$1$7,21$/255(*,21$/*5((1%8,/',1*352*5$02567$1'$5'38%/,6+(5&(57,),&$7,21%<$67$7(:,'((1(5*<&2168/7,1*259(5,),&$7,2125*$1,=$7,2168&+$6+(565$7(56%8,/',1*3(5)250$1&(&2175$&7256$1'+20((1(5*<$8',725668&&(66)8/&203/(7,212)$7+,5'3$57<$335(17,&(75$,1,1*352*5$0,17+($335235,$7(75$'(27+(5352*5$06$&&(37$%/(727+((1)25&,1*$*(1&<127(663(&,$/,163(&72566+$//%(,1'(3(1'(17(17,7,(6:,7+12),1$1&,$/,17(5(67,17+(0$7(5,$/6257+(352-(&77+(<$5(,163(&7,1*)25&203/,$1&(:,7+7+,6&2'(+(565$7(56$5(63(&,$/,163(&7256&(57,),('%<7+(&$/,)251,$(1(5*<&200,66,21&(&725$7(+20(6,1&$/,)251,$$&&25',1*727+(+20((1(5*<5$7,1*6<67(0+(56>%6&&*@:+(15(48,5('%<7+((1)25&,1*$*(1&<7+(2:1(5257+(5(63216,%/((17,7<$&7,1*$67+(2:1(5 6$*(176+$//(03/2<21(25025(63(&,$/,163(&7256723529,'(,163(&7,212527+(5'87,(61(&(66$5<7268%67$17,$7(&203/,$1&(:,7+7+,6&2'(63(&,$/,163(&72566+$//'(021675$7(&203(7(1&(727+(6$7,6)$&7,212)7+((1)25&,1*$*(1&<)257+(3$57,&8/$57<3(2),163(&7,21257$6.72%(3(5)250(',1$'',7,217+(63(&,$/,163(&7256+$//+$9($&(57,),&$7,21)520$5(&2*1,=('67$7(1$7,21$/25,17(51$7,21$/$662&,$7,21$6'(7(50,1('%<7+(/2&$/$*(1&<7+($5($2)&(57,),&$7,216+$//%(&/26(/<5(/$7('727+(35,0$5<-2%)81&7,21$6'(7(50,1('%<7+(/2&$/$*(1&<127(63(&,$/,163(&72566+$//%(,1'(3(1'(17(17,7,(6:,7+12),1$1&,$/,17(5(67,17+(0$7(5,$/6257+(352-(&77+(<$5(,163(&7,1*)25&203/,$1&(:,7+7+,6&2'('2&80(17$7,21'2&80(17$7,2186('726+2:&203/,$1&(:,7+7+,6&2'(6+$//,1&/8'(%87,6127/,0,7('72&216758&7,21'2&80(1763/$1663(&,),&$7,216%8,/'(525,167$//(5&(57,),&$7,21,163(&7,215(325762527+(50(7+2'6$&&(37$%/(727+((1)25&,1*$*(1&<:+,&+'(021675$7(68%67$17,$/&21)250$1&(:+(163(&,),&'2&80(17$7,212563(&,$/,163(&7,21,61(&(66$5<729(5,)<&203/,$1&(7+$70(7+2'2)&203/,$1&(:,//%(63(&,),(',17+($335235,$7(6(&7,2125,'(17,),('$33/,&$%/(&+(&./,67&+$37(5 ,167$//(5 63(&,$/,163(&72548$/,),&$7,21648$/,),&$7,2169(5,),&$7,2165()5,*(5$173,3,1*3,3,1*&203/,$17:,7+7+(&$/,)251,$0(&+$1,&$/&2'(6+$//%(,167$//('72%($&&(66,%/()25/($.3527(&7,21$1'5(3$,563,3,1*581686,1*7+5($'('3,3(&233(578%,1*:,7+$12876,'(',$0(7(52'/(667+$1,1&+)/$5('78%,1*&211(&7,216$1'6+2575$',86(/%2:66+$//127%(86(',15()5,*(5$176<67(06(;&(37$6127('%(/2:7+5($'('3,3(7+5($'('&211(&7,216$5(3(50,77('$77+(&2035(66255$&.&233(53,3(&233(578%,1*:,7+$12'/(667+$1,1&+0$<%(86(',16<67(06:,7+$5()5,*(5$17&+$5*(2)3281'625/(66$1&+25$*(21()2857+,1&+2'78%,1*6+$//%(6(&85(/<&/$03('72$5,*,'%$6(72.((39,%5$7,21/(9(/6%(/2:0,/6)/$5('78%,1*&211(&7,216'28%/()/$5('78%,1*&211(&7,2160$<%(86(')2535(6685(&21752/69$/9(3,/27/,1(6$1'2,/(;&(37,216,1*/()/$5('78%,1*&211(&7,2160$<%(86(':,7+$08/7,5,1*6($/&2$7(':,7+,1'8675,$/6($/$1768,7$%/()2586(:,7+5()5,*(5$176$1'7,*+7(1(',1$&&25'$1&(:,7+0$18)$&785(5¶65(&200(1'$7,216(/%2:66+2575$',86(/%2:6$5(21/<3(50,77(':+(5(63$&(/,0,7$7,216352+,%,786(2)/21*5$',86(/%2:69$/9(69$/9(6$1'),77,1*66+$//&203/<:,7+7+(&$/,)251,$0(&+$1,&$/&2'($1'$6)2//2:635(6685(5(/,()9$/9(6)259(66(/6&217$,1,1*+,*+*:35()5,*(5$17$583785(',6&6+$//%(,167$//('%(7:((17+(287/(72)7+(9(66(/$1'7+(,1/(72)7+(35(6685(5(/,()9$/9(35(6685('(7(&7,21$35(6685(*$8*(35(6685(75$16'8&(52527+(5'(9,&(6+$//%(,167$//(',17+(63$&(%(7:((17+(583785(',6&$1'7+(5(/,()9$/9(,1/(772,1',&$7($',6&583785(25',6&+$5*(2)7+(5(/,()9$/9($&&(669$/9(621/<6&+5$'(5$&&(669$/9(6:,7+$%5$662567((/%2'<$5(3(50,77(')2586(9$/9(&$36)256<67(06:,7+$5()5,*(5$17&+$5*(2)3281'625025(9$/9(&$366+$//%(%5$662567((/$1'1273/$67,&6($/&$36,)'(6,*1(')25,77+(&$36+$//+$9($1(235(1(25,1*,13/$&(&+$,17(7+(56&+$,17(7+(5672),729(57+(67(0$5(5(48,5(')259$/9(6'(6,*1('72+$9(6($/&$36(;&(37,219$/9(6:,7+6($/&$367+$7$5(1275(029(')5207+(9$/9('85,1*67(023(5$7,215()5,*(5$7('6(59,&(&$6(65()5,*(5$7('6(59,&(&$6(6+2/',1*)22'352'8&76&217$,1,1*9,1(*$5$1'6$/76+$//+$9((9$325$725&2,/62)&25526,215(6,67$170$7(5,$/68&+$667$,1/(6667((/25%(&2$7('7235(9(17&25526,21)5207+(6(68%67$1&(62=21('(3/(7,21$1'*5((1+286(*$65('8&7,216,167$//$7,2162)+9$&5()5,*(5$7,21$1'),5(68335(66,21(48,30(176+$//&203/<:,7+6(&7,216$1'&+/252)/8252&$5%216&)&6,167$//+9$&5()5,*(5$7,21$1'),5(68335(66,21(48,30(177+$7'2127&217$,1&)&6+$/216,167$//+9$&5()5,*(5$7,21$1'),5(68335(66,21(48,30(177+$7'2127&217$,1+$/216683(50$5.(75()5,*(5$17/($.5('8&7,211(:&200(5&,$/5()5,*(5$7,216<67(066+$//&203/<:,7+7+(3529,6,2162)7+,66(&7,21:+(1,167$//(',15(7$,/)22'6725(6648$5()((725025(&21',7,21('$5($$1'7+$787,/,=((,7+(55()5,*(5$7('',63/$<&$6(625:$/.,1&22/(5625)5((=(56&211(&7('725(027(&2035(662581,7625&21'(16,1*81,767+(/($.5('8&7,210($685(6$33/<725()5,*(5$7,216<67(06&217$,1,1*+,*+*/2%$/:$50,1*327(17,$/+,*+*:35()5,*(5$176:,7+$*:32)25*5($7(51(:5()5,*(5$7,216<67(06,1&/8'(%27+1(:)$&,/,7,(6$1'7+(5(3/$&(0(172)(;,67,1*5()5,*(5$7,216<67(06,1(;,67,1*)$&,/,7,(6(;&(37,215()5,*(5$7,216<67(06&217$,1,1*/2:*/2%$/:$50,1*327(17,$//2:*:35()5,*(5$17:,7+$*:39$/8(/(667+$1$5(12768%-(&7727+,66(&7,21/2:*:35()5,*(5$176$5(1212=21('(3/(7,1*5()5,*(5$1767+$7,1&/8'($0021,$&$5%21',2;,'(&2$1'327(17,$//<27+(55()5,*(5$176287'225$,548$/,7<&2,/&2$7,1*&216,'(5$7,216+$//%(*,9(1727+(+($775$16)(5()),&,(1&<2)&2,/&2$7,1*720$;,0,=((1(5*<()),&,(1&<5()5,*(5$175(&(,9(565()5,*(5$175(&(,9(56:,7+&$3$&,7,(6*5($7(57+$13281'66+$//%(),77(':,7+$'(9,&(7+$7,1',&$7(67+(/(9(/2)5()5,*(5$17,17+(5(&(,9(535(6685(7(67,1*7+(6<67(06+$//%(35(6685(7(67(''85,1*,167$//$7,2135,2572(9$&8$7,21$1'&+$5*,1*0,1,08035(6685(7+(6<67(06+$//%(&+$5*(':,7+5(*8/$7(''5<1,752*(1$1'$335235,$7(75$&(5*$672%5,1*6<67(035(6685(837236,*0,1,080/($.6&+(&.7+(6<67(0)25/($.65(3$,5$1</($.6$1'5(7(67)2535(6685(86,1*7+(6$0(*$8*($//2:$%/(35(6685(&+$1*(7+(6<67(06+$//67$1'81$/7(5(')25+2856:,7+12025(7+$1$21(3281'35(6685(&+$1*()52036,*0($685(':,7+7+(6$0(*$8*((9$&8$7,217+(6<67(06+$//%((9$&8$7('$)7(535(6685(7(67,1*$1'35,2572&+$5*,1*),5679$&88038//$6<67(09$&880'2:172$7/($670,&52160,&5216$1'+2/')250,187(66(&21'9$&88038//$6(&21'6<67(09$&88072$0,1,0802)0,&5216$1'+2/')250,187(67+,5'9$&88038//$7+,5'9$&880'2:172$0,1,0802)0,&5216$1'+2/')25+2856:,7+$0$;,080'5,)72)0,&521629(5$+2853(5,2'3(5)250$1&(0(7+2')25%8,/',1*6/2&$7('$6'(),1(',16(&7,2125:$//$1'522)&(,/,1*$66(0%/,(6(;326('727+(12,6(6285&(0$.,1*837+(%8,/',1*25$'',7,21(19(/23(25$/7(5('(19(/23(6+$//%(&216758&7('723529,'($1,17(5,2512,6((19,5210(17$775,%87$%/(72(;7(5,256285&(67+$7'2(6127(;&(('$1+285/<(48,9$/(1712,6(/(9(//(4+52)'%$,12&&83,('$5($6'85,1*$1<+2852)23(5$7,216,7()($785(6(;7(5,25)($785(668&+$66281':$//625($57+%(5060$<%(87,/,=('$6$335235,$7(727+(%8,/',1*$'',7,2125$/7(5$7,21352-(&7720,7,*$7(6281'0,*5$7,21727+(,17(5,25'2&80(17$7,212)&203/,$1&($1$&2867,&$/$1$/<6,6'2&80(17,1*&203/<,1*,17(5,256281'/(9(/66+$//%(35(3$5('%<3(56211(/$33529('%<7+($5&+,7(&725(1*,1((52)5(&25',17(5,256281'75$160,66,21:$//$1')/225&(,/,1*$66(0%/,(66(3$5$7,1*7(1$1763$&(6$1'7(1$1763$&(6$1'38%/,&3/$&(66+$//+$9($167&2)$7/($67127((;$03/(62)$66(0%/,(6$1'7+(,59$5,28667&5$7,1*60$<%()281'$77+(&$/,)251,$2)),&(2)12,6(&21752/ZZZWRROEDVHRUJ3')&DVH6WXGLHVVWFBLFFBUDWLQJVSGINSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE202505.11.23Page 173 of 802 ,17(5,25 &08(;7(5,25 &08:%5,&.9(1((50(7$/3$1(/250(7$/3$1/(29(50(7$/)855,1*&+$11(/(;7(5,25 0(7$/678'81),1,6+(',17(5,250(7$/3$1(/25%5,&.9(1((5(;7(5,25$$((%%'' .,26. && 7 <3 $.$.$.$.$.$.$.$&)''1$0$;0$;0$;0$;7<37<37<3 7<3)%$$ $),;('%),;('0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"FLOOR PLAN & DOOR SCHEDULEAK101KHDGKH05.11.23DG$&&(66,%,/,7<127(65()(572'(7$,/*)25$&&/$9$725<5(48,5(0(1765()(572'(7$,/*)25$&&5(675220$&&(6625,(65()(572'(7$,/*)25$&&72,/(75(48,5(0(1765()(572'(7$,/*)25.,&.3/$7(5(48,5(0(1765()(572'(7$,/*)25$&&5(6752206<0%2/5(48,5(0(1765()(572'(7$,/*)25$&&5($&+5$1*(65()(572'(7$,/*)25$&&7851,1*63$&(5(48,5(0(1765()(572'(7$,/*)25$&&'2255(48,5(0(1765()(572'(7$,/*)25$&&'225(175<&/($5$1&(65()(572'(7$,/*)2572(.1((&/($5$1&(65()(572'(7$,/*)25&/($5$1&(6$7'2256 *$7(6 $5$.*5281')/2253/$1:$///(*(1'12 7<3(6,=(6,*1$*( +$5':$5(:,'7+ +(,*+7 $ $ % + 9(5,)<528*+23(1,1*6,=(:,7+'2250$18)$&785(563(&,),&$7,21635,2572&216758&7,21 &2175$&725729(5,)<$&78$/'2256,=(72),7),1,6+23(1,1*35,2572)$%5,&$7,212)'225$1'),1,6+23(1,1* $//'225+$5':$5(72+$9(/(9(5+$1'/(6$1'&203/<:,7+'(7$,/* 6(('2256&+('8/()256,*16&+('8/(5()(572'(7$,/6*)255220,'(17,),&$7,216<0%2//2&$7,21 $//7+5(6+2/'66+$//&203/<:,7+'(7$,/* (*5(66'22566+$//%(5($',/<23(1$%/()5207+((*5(666,'(:,7+2877+(86(2)$.(<2563(&,$/.12:/('*(25())257 7+(%277202)$//'22566+$//+$9($60227+81,17(55837('685)$&(72$//2:7+('22572%(23(1('%<$:+((/&+$,5)2275(67:,7+287&5($7,1*$75$325+$=$5'286&21',7,21 $//*/$=,1*:,7+,12)'225-$0%72%(7(03(5('3(5&%& 5(675220 $&&(66,%,/,7<6,*1$*( 0$,17(1$1&(:20(16 0(16'2256&+('8/('225127(6'2256,*1$*('225+$5':$5(5()(57263(&,),&$7,2122)25'225+$5':$5(*52836'2257<3(6% &21&5(7(6/$%5()(5726758&785$/$ 67((/&2/8015()(5726758&785$/'5$:,1*6$ &2,/,1*&2817(5'2251 6+((70(7$/&2817(5& *5($6(,17(5&(37255()(5723/80%,1*' )/225'5$,10,1,080 6/23(5()(5723/80%,1*) )/2256,1.5()(5723/80%,1*' (/(&75,&$/3$1(/5()(572(/(&75,&$/*(1(5$/127(6.(<127(6 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,21 5()(5720(&+$1,&$/3/$16)25)857+(5,1)250$7,21 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 $//)851,785($1'(48,30(17,6%<2:1(5$1',66+2:1)25&225',1$7,21385326(621/< 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),16+,1)250$7,21 ',0(16,216$5(72)$&(2)6+($7+,1*25&0881/(6663(&,),&$//<127('27+(5:,6( 3529,'($'(48$7(%/2&.,1*,1:$//6)25&$%,1(76$1'27+(5:$//02817('$&&(6625,(6,1&/8',1*%87127/,0,7('72+$1'5$,/66+(/9,1*$1'%$7+5220),;785(6 3529,'(),5(%/2&.,1*)25:$//&$9,7,(67+$7(;&(('&%&+(,*+7/,0,7$7,21 )/225726/23(72'5$,1$7 0$;6/23(12 7<3(6,=(+($'+(,*+7'(7$,/6127(6:,'7+ +(,*+7 +($' -$0% 6,// $ $ $ $ % % $ $ :,1'2:6&+('8/(:,1'2:7<3(6NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 174 of 802 $$((%%''&&$.$.$.$.$.$.)(.$.$$$$.$.6,07<32):+(,*+72)7232)522),1*685)$&(,1&/8',1*&5,&.(76$1',168/$7,21 522)6/23(67$1',1*6($0522),1:$//5$,1:$7(5/($'(56&+('8/(3,3(72&2:67281*(6&833(57+528*+522)'2:163287(;7(1'%(/2:62)),7'2:16328772522)%(/2:0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedROOF PLANAK102KHDGKH05.11.23DG $5$.522)3/$1 .,26. 5()(5726758&785$/3/$16)25522))5$0,1*,1)250$7,21,1&/8',1*0(0%(56,=(6$1'&211(&7,21+$5':$5( 5()(5723/80%,1*3/$16)25522)9(173(1(75$7,21*(1(5$/127(6/(*(1'.(<127(6( &8672029(5+$1*0(7$/'(7$,/. &867200(7$/),1($/) 67$1',1*6($00(7$/522)$ *877(5: 67$&.9(17/2&$7(216287+6/23(2)522)5()(5723/80%,1*NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 175 of 802 $$((%%''&&$.$.$.$.$.%$(*$&(,/,1*+(,*+7 /,1($50(7$/62)),7,1:$//'2:1632876&+('8/('3,3(72&2:67281*(6&833(57+528*+522)'2:163287(;7(1'%(/2:62)),7'2:16328772522)%(/2:0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedREFLECTED CEILING PLANAK103KHDGKH05.11.23DG $5$..,26.5()/(&7('&(,/,1*3/$1/(*(1'*(1(5$/127(6.(<127(6$ 67((/&2/8015()(5726758&785$/'5$:,1*6( &8672029(5+$1*0(7$/'(7$,/* &8672029(5+$1*0(7$/6833257%5$&.(7% /,1($50(7$/62)),73$1(/$ &2,/,1*&2817(5'225 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,21 5()(5720(&+$1,&$/3/$16)25)857+(5,1)250$7,21 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 ',0(16,216$5(72)$&(2)&25(81/(6663(&,),&$//<127('27+(5:,6(NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 176 of 802 *5281')/225 $(%'&7267((/ 72&2035,1* 72%($02+ 72%($0 $.$*($,$.-$)$10$;$)* *5281')/225 7267((/ 72&2035,1* 72%($02+ 72%($0 $0$;$)* $*5281')/225 $(%'&7267((/ 72&2035,1* 72%($02+ 72%($0 $.*5281')/225 7267((/ 72&2035,1* 72%($02+ 72%($0 0$;$)* *5281')/225 7267((/ 72&2035,1* 72%($02+ 72%($0 %5,&.9(1((50(7$/:$//3$1(/667$1',1*6($00(7$/522)0$77(),1,6+*5281')/225 7267((/ 72&2035,1* 72%($02+ 72%($0 $0$;$)* 0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"EXTERIOR ELEVATIONS & SECTIONAK301KHDGKH05.11.23DG 5()(5726758&785$/3/$16)25522))5$0,1*,1)250$7,21,1&/8',1*0(0%(56,=(6$1'&211(&7,21+$5':$5( 5()(5723/80%,1*3/$16)25522)9(173(1(75$7,21*(1(5$/127(6 $. $.($67(/(9$7,21 .,26. $. $.1257+(/(9$7,21 .,26. $. $.:(67(/(9$7,21 .,26. $. $.6287+(/(9$7,21 .,26. $. $..,26.6+2576,'(7<32))285/(*(1'.(<127(6$ 1(:%5,&.9(1((5$7)5$0(':$//( &8672029(5+$1*0(7$/'(7$,/* &8672029(5+$1*0(7$/6833257%5$&.(7- &867200(7$/9(176&5((1. &867200(7$/),1($/) 67$1',1*6($00(7$/522)$ (0%266('0(7$/:$//3$1(/, *877(5$ $/80,1806725()52176<67(05()(5726&+('8/(6$ :22':,1'2:5()(572:,1'2:6&+('8/(1 6+((70(7$/&2817(5 $. $.%8,/',1*6(&7,21 .,26.NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 177 of 802 6.(:('9,(:6.(:('9,(:$6.(:('9,(:6.(:('9,(:6.(:('9,(:6.(:('9,(:%6.(:('9,(:6.(:('9,(:-$+&083(5)25$7('0(7$/3$1(/3$,17('(;326('678'67<3127(678'612:6+2:1)25&/$5,7<7,/(3(5$0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"INTERIOR ELEVATIONSAK501KHDGKH05.11.23DG $. $.($67 .,26. $. $.1257+ .,26. $. $.6287+ .,26. $. $.:(67 .,26.*(1(5$/127(6/(*(1'.(<127(6+ &21&5(7(&85%3(56758&785$/- &867200(7$/9(176&5((1$ &2,/,1*&2817(5'225$ $/80,1806725()52176<67(05()(5726&+('8/(6% 685)$&(02817('3$1(/%2$5'5()(572(/(&75,&$/ 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 178 of 802 67$1'$5'%5,&.3/,17+0257$5$1'/$7+),1,6+)/225 0(7$/678':$// 6+($7+,1*5()(5726758&785$/)227,1* &85%3(56758&785$/'$033522),1*(;7(1'727232)'5,3('*(81,73$9(563(5/$1'6&$3(0$6215<7,(63$&,1*3(563(&,),&$7,210(7$/:$//3$1(/:($7+(5%$55,(5/$329(5'5,3('*('5,3('*(&21&5(7(75,0%$1'2)&21&5(7(75,0$))727239$325%$55,(53(563(&,),&$721$56,067$1',1*6($0522):($7+(5%$55,(56+($7+,1*522))5$0,1*3(56758&785$/0(7$/3$1(/6<67(0+66)5$00,1*3(56758&785$/:($7+(5%$55,(5/$329(5)/$6+,1*0(7$/:$//3$1(/35(),1,6+(')/$6+,1*720$7&+0(7$/:$//3$1(/'5,3)/$6+,1*0(7$/62)),73$1(/+66)5$0,1*3(56758&785$/0(7$/678')5$0,1*3(56758&785$/6+($7+,1* 726758&785( 23(1,1* 726 7266($/$17'(&25$7,9(0(7$/6&5((13(53529,'(,16(&76&5((1$7.,26.$'5,3)/$6+,1*35(),1,6+(')/$6+,1*720$7&+0(7$/:$//3$1(/6725()5217:,1'2:6<67(0*<3680:$//%2$5',167$//*<321/<%(+,1'52//,1*'22572$//2:)25)/86+,167$//$7,21$56,067$1',1*6($0522):($7+(5%$55,(56+($7+,1*522))5$0,1*3(56758&785$//,1($50(7$/3$1(/6<67(0+66)5$00,1*3(56758&785$/:($7+(5%$55,(5/$329(5)/$6+,1*0(7$/:$//3$1(/35(),1,6+(')/$6+,1*720$7&+0(7$/:$//3$1(/'(&25$7,9(0(7$/6&5((13(53529,'(,16(&76&5((1$7.,26.'5,3)/$6+,1*0(7$/62)),73$1(/+66)5$0,1*3(56758&785$/0(7$/678')5$0,1*3(56758&785$/6+($7+,1*(/$6720(5,&0(0%5$1(9$325%$55,(5 726758&785( 23(1,1* 726 726$0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011 1/2" = 1'-0"WALL SECTIONSAK601KHDGKH05.11.23DG $. $.)227,1*'(7$,/.,26. $. $.7<3:$//6(&7,21$7&2,/,1*&2817(5'225 $. $.7<3:$//6(&7,21$7.,26.NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 179 of 802 $5$5$5$5$5$5$5$5$$$''%%&& 5(6752203/80%,1*&+$6(5(6752205 5 '((3-$1,7256+(/9,1*$5&/($5$1&(3(5% $5,$%% ')2)72&/)520&0$;7<30$;7<30$;7<3%57<37<347<3-7<30,1 &/5 1 &&7<351,17(5,25 &08(;7(5,25 &08:%5,&.9(1((50(7$/3$1(/250(7$/3$1/(29(50(7$/)855,1*&+$11(/(;7(5,25 0(7$/678'81),1,6+(',17(5,250(7$/3$1(/25%5,&.9(1((5(;7(5,25$6/,',1*+2//2:0(7$/ %+2//2:0(7$/'225$1')5$0(0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"FLOOR PLAN & DOOR SCHEDULEAR101KHDGKH05.11.23DG $5$5*5281')/2253/$1$//$&&(66,%/(&/($5$1&(',0(16,216*,9(1)520)$&(2)),1,6+81/(66127('27+(5:,6(0((7,1*0,1,0805(48,5(0(172)%(;&(37,21:+(5(08/7,3/(6,1*/(86(572,/(752206$5(&/867(5('$7$6,1*/(/2&$7,213(5&(17%8712)(:(57+$121(2)7+(6,1*/(86(572,/(752206)25($&+86($7($&+&/867(56+$//&203/<:,7+6(&7,21%$&/867(5,6'(),1('$6$*52832)72,/(752206352;,0$7(7221($127+(5*(1(5$//<72,/(752206,1$&/867(5$5(:,7+,16,*+72)25$'-$&(177221($127+(57+,6'(,61$'+(56$1'0((767+('(),1,7,212)$&/867(5$1'$5(3529,',1*28767$//6720((7%$6127('$&&(66,%,/,7<127(6& 35,9$&<6&5((1+66)5$0(&/$',1(0%266('0(7$/:$//3$1(/& 72,/(73$57,7,21% 685)$&(02817('72,/(73$3(5',63(16(5- :$//02817('(/(&75,&+$1''5<(51 0,55254 :$//02817('*5$%%$55 6$1,7$5<1$3.,1',63(16(5% :$7(5+($7(55()(5723/80%,1*' )/225'5$,10,1,080 6/23(5()(5723/80%,1*, 0236,1.5()(5723/80%,1*5 :$//02817('72,/(75()(5723/80%,1*$ 685)$&(02817('(/(&75,&0(7(55()(572(/(&75,&$/% 685)$&(02817('3$1(/%2$5'5()(572(/(&75,&$/& :$//02817(''$7$&$%,1(75()(572(/(&75,&$/*(1(5$/127(6.(<127(612 7<3(6,=(6,*1$*( +$5':$5(:,'7+ +(,*+7 $ $ % + 9(5,)<528*+23(1,1*6,=(:,7+'2250$18)$&785(563(&,),&$7,21635,2572&216758&7,21 &2175$&725729(5,)<$&78$/'2256,=(72),7),1,6+23(1,1*35,2572)$%5,&$7,212)'225$1'),1,6+23(1,1* $//'225+$5':$5(72+$9(/(9(5+$1'/(6$1'&203/<:,7+'(7$,/* 6(('2256&+('8/()256,*16&+('8/(5()(572'(7$,/6*)255220,'(17,),&$7,216<0%2//2&$7,21 $//7+5(6+2/'66+$//&203/<:,7+'(7$,/* (*5(66'22566+$//%(5($',/<23(1$%/()5207+((*5(666,'(:,7+2877+(86(2)$.(<2563(&,$/.12:/('*(25())257 7+(%277202)$//'22566+$//+$9($60227+81,17(55837('685)$&(72$//2:7+('22572%(23(1('%<$:+((/&+$,5)2275(67:,7+287&5($7,1*$75$325+$=$5'286&21',7,21 $//*/$=,1*:,7+,12)'225-$0%72%(7(03(5('3(5&%& 5(675220 $&&(66,%,/,7<6,*1$*( 0$,17(1$1&(:20(16 0(16'2256&+('8/('225127(6'2256,*1$*('225+$5':$5(5()(57263(&,),&$7,2122)25'225+$5':$5(*52836127((;7(5,25'2257<3(6:$///(*(1' 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,21 5()(5720(&+$1,&$/3/$16)25)857+(5,1)250$7,21 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 $//)851,785($1'(48,30(17,6%<2:1(5$1',66+2:1)25&225',1$7,21385326(621/< 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),16+,1)250$7,21 ',0(16,216$5(72)$&(2)6+($7+,1*25&0881/(6663(&,),&$//<127('27+(5:,6( 3529,'($'(48$7(%/2&.,1*,1:$//6)25&$%,1(76$1'27+(5:$//02817('$&&(6625,(6,1&/8',1*%87127/,0,7('72+$1'5$,/66+(/9,1*$1'%$7+5220),;785(6 3529,'(),5(%/2&.,1*)25:$//&$9,7,(67+$7(;&(('&%&+(,*+7/,0,7$7,21 )/225726/23(72'5$,1$7 0$;6/23(5()(572'(7$,/*)25$&&/$9$725<5(48,5(0(1765()(572'(7$,/*)25$&&5(675220$&&(6625,(65()(572'(7$,/*)25$&&72,/(75(48,5(0(1765()(572'(7$,/*)25.,&.3/$7(5(48,5(0(1765()(572'(7$,/*)25$&&5(6752206<0%2/5(48,5(0(1765()(572'(7$,/*)25$&&5($&+5$1*(65()(572'(7$,/*)25$&&7851,1*63$&(5(48,5(0(1765()(572'(7$,/*)25$&&'2255(48,5(0(1765()(572'(7$,/*)25$&&'225(175<&/($5$1&(65()(572'(7$,/*)2572(.1((&/($5$1&(65()(572'(7$,/*)25&/($5$1&(6$7'2256 *$7(6127(9(5,)<'2256,*1$*(:25',1*:,7+&,7<$1'$5&+,7(&735,257225'(5,1*$1',167$//$7,21NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 180 of 802 $5$5$5$5$5$5$$''%%&&$5 $$)::$5$$$% +(,*+72)7232)522),1*685)$&(,1&/8',1*&5,&.(76$1',168/$7,21 522)6/23(67$1',1*6($0522),1:$//5$,1:$7(5/($'(56&+('8/(3,3(72&2:67281*(6&833(57+528*+522)'2:163287(;7(1'%(/2:62)),7'2:16328772522)%(/2:0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedROOF PLANAR102KHDGKH05.11.23DG) 67$1',1*6($00(7$/522)$ *877(5% ,17(51$/*877(5$ 0(7$/)5$0('6.</,*+7: 67$&.9(17/2&$7(216287+6/23(2)522)5()(5723/80%,1* $5$5522)3/$1 5(675220/(*(1'*(1(5$/127(6.(<127(6 5()(5726758&785$/3/$16)25522))5$0,1*,1)250$7,21,1&/8',1*0(0%(56,=(6$1'&211(&7,21+$5':$5( 5()(5723/80%,1*3/$16)25522)9(173(1(75$7,21NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 181 of 802 $5$5$5$5$5$5$5$$''%%&& $$-(*$ $5%%&(,/,1*+(,*+7 /,1($50(7$/62)),7,1:$//'2:1632876&+('8/('3,3(72&2:67281*(6&833(57+528*+522)'2:163287(;7(1'%(/2:62)),7'2:16328772522)%(/2:0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedREFLECTED CEILING PLANAR103KHDGKH05.11.23DG $5$55(6752205()/(&7('&(,/,1*3/$1 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220/(*(1'*(1(5$/127(6.(<127(6$ 67((/&2/8015()(5726758&785$/'5$:,1*6( &8672029(5+$1*0(7$/'(7$,/* &8672029(5+$1*0(7$/6833257%5$&.(7- &867200(7$/9(176&5((1% /,1($50(7$/62)),73$1(/$ 0(7$/)5$0('6.</,*+7NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 182 of 802 *5281')/225 723&08 $'%&%2&$123< 726522) $$)$ $*5281')/225 723&08 $'%&%2&$123< 726522) $5$$$ %5,&.9(1((50(7$/:$//3$1(/667$1',1*6($00(7$/522)0$77(),1,6+*5281')/225 723&08 $5%2&$123< 726522) 0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"EXTERIOR ELEVATIONSAR301KHDGKH05.11.23DG $5$51257+(/(9$7,21 5(675220:35,9$&<6&5((1 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220 $5$51257+(/(9$7,21 5(675220 $5$5($67(/(9$7,21 5(675220:75$6+(1&/2685(/(*(1'*(1(5$/127(6.(<127(6) 67$1',1*6($00(7$/522)$ (0%266('0(7$/:$//3$1(/$ *877(5$ 0(7$/)5$0('6.</,*+7NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 183 of 802 *5281')/225 723&08 $5%2&$123< 726522) $$$$5/2&$7,21)25)8785(38%/,&$57)*5281')/225 723&08 $5%2&$123< 726522) $5*5281')/225 723&08 $'%&%2&$123< 726522) $5$5$5 $$5%5,&.9(1((50(7$/:$//3$1(/667$1',1*6($00(7$/522)0$77(),1,6+0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"EXTERIOR ELEVATIONSAR302KHDGKH05.11.23DG $5$5:(67(/(9$7,21 5(675220 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220 $5$5($67(/(9$7,21 5(675220 $5$56287+(/(9$7,21 5(675220/(*(1'*(1(5$/127(6.(<127(6) 67$1',1*6($00(7$/522)$ (0%266('0(7$/:$//3$1(/$ *877(5$ 0(7$/)5$0('6.</,*+7$ 685)$&(02817('(/(&75,&0(7(55()(572(/(&75,&$/NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 184 of 802 *5281')/225 723&08 %2&$123< 726522) )$($%%*5281')/225 723&08 %2&$123< 726522) %- %$$*5281')/225 723&08 $'%&%2&$123< 726522) $5$523(123(10(7$/678'&21&5(7(0$6215<81,76&08:$//)$&(3(5:$//7<3(3(5)25$7('0(7$/3$1(/7,/(3(5$0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"BUILDING SECTIONSAR401KHDGKH05.11.23DG $5$5%8,/',1*6(&7,21 $5$5%8,/',1*6(&7,21 $5$5%8,/',1*6(&7,21 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220/(*(1'*(1(5$/127(6.(<127(6% &21&5(7(6/$%5()(5726758&785$/$ 67((/&2/8015()(5726758&785$/'5$:,1*6( &8672029(5+$1*0(7$/'(7$,/- &867200(7$/9(176&5((1) 67$1',1*6($00(7$/522)$ *877(5$ &(5$0,&7,/(:$//$33/,&$7,21%$ )/22502817('72,/(73$57,7,21% :$7(5+($7(55()(5723/80%,1*% 685)$&(02817('3$1(/%2$5'5()(572(/(&75,&$/NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 185 of 802 5()/(&7,1*685)$&(0$;72%23$1(/$)) &%%&083(5)25$7('0(7$/3$1(/3$,17('(;326('678'67<3127(678'612:6+2:1)25&/$5,7<7,/(3(5$0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-011/4" = 1'-0"INTERIOR ELEVATIONSAR501KHDGKH05.11.23DG $5$55(675220 ($67 $5$55(675220 6287+ $5$55(675220 :(67 $5$55(675220 1257+ 5()(5726758&785$/3/$16)25)857+(5,1)250$7,21 5()(572(/(&75,&$/3/$16)25)857+(5,1)250$7,2121(/(&75,&$/(48,30(17/,*+7,1*),;785(6$1'/2&$7,2162)(/(&75,&$/287/(76 5()(5723/80%,1*3/$16)25)857+(5,1)250$7,21 5()(572),1,6+3/$1$1'6&+('8/()25,17(5,25:$//&(,/,1*$1')/225),1,6+,1)250$7,21 3529,'(%/2&.,1*)25$//:$//6:+(5(:$//+81*(48,30(17$1'),;785(62&&85 67$1'$5'02817,1*+(,*+762)5(675220$&&(6625,(6$1'3/80%,1*),;785(672)2//2:7+($&&(66,%,/,7<67$1'$5'6 5()(572$&&(66,%,/,7<'(7$,/6)25$&&(66,%,/,7<5(48,5(0(176$738%/,&5(675220 $5$5&+$6( 6287+ $5$5&+$6(($67 $5$5&+$6(1257+ $5$5&+$6( :(67127(5(675220 6,0,/$523326,7(+$1'/(*(1'*(1(5$/127(6.(<127(6% :$7(5+($7(55()(5723/80%,1*% 685)$&(02817('3$1(/%2$5'5()(572(/(&75,&$/& :$//02817(''$7$&$%,1(75()(572(/(&75,&$/NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 186 of 802 $56,067$1',1*6($0522):($7+(5%$55,(56+($7+,1*522))5$0,1*3(56758&785$/0(7$/3$1(/6<67(0&;&217,18286:,7+',$02&)/$6+,1*720$7&+'(&25$7,9(0(7$/6&5((1'(&25$7,9(6&5((15()(572$/80,180&$3:,7+&/($77+,1%5,&.9(1((56$,/25&2856(7+,1%5,&.9(1((5%21'3$77(513(5(/(9$7,2160257$5%(':,7+/$7+&(5$0,&7,/(3(5(/(9$7,216$*$%(173/&217,18286:(,7+6(/)7$33,1*6&5(:6#2&72:$//3/0(7$/3$1(/6<67(0&21&5(7(0$6215<%/2&.:($7+(5%$55,(5/$329(5$77$&+0(17&+$11(/)250(7$/3$1(/6<67(0)250('*877(5/$3)/$6+,1*7$3(29(5)/$6+,1*3$1(/&/,3:,7+)$67(1(566($/$1772&/26((1'3$1(/&87$1'),(/'%(1'3$1(/(1')/$6+,1*:,7+'5,3('*(*5287%('3/;&217:',$0&(17(5('%(7:((1-2,676 0$;)520(1'62)3/ 6$'+(5('&21&5(7(%$1'&2856((0%('))(558/(,16(5725(4$7($&+$1&+25)$67(1(5',$0%2/77+,1%5,&.9(1((5%21'3$77(513(5(/(9$7,216$/80,180)/$6+,1*:,7++(00(''5,3('*(67$1'$5'%5,&.3/,17+0257$5$1'/$7+:$//3(53/$17+,1%5,&.9(1((5%21'3$77(513(5(/(9$7,2163(5(/(9$7,2163(5(/(9$7,216&(5$0,&7,/(29(50257$5$1'/$7+$56,067$1',1*6($0522):($7+(5%$55,(56+($7+,1*522))5$0,1*3(56758&785$/0(7$/3$1(/6<67(0&;&217,18286:,7+',$02&)/$6+,1*:,7+'5,3('*(7+,1%5,&.9(1((56$,/25&2856(7+,1%5,&.9(1((5%21'3$77(513(5(/(9$7,2160257$5%(':,7+/$7+&(5$0,&7,/(&$6,1*%($'-75,0&/2685(3$1(/),(/''5,//:((3'(&25$7,9(0(7$/3$1(/6<67(0&+$11(/%5$66$&&(17)/$6+,1*+(0('*(%5$66$&&(17)/$6+,1*/,1($50(7$/62)),7'2:1632873(5(/(9$7,216)250('0(7$/*877(5'(&25$7,9(0(7$/3$1(/'(&25$7,9(6&5((1+666/23(6/23(&678')5$0,1*%5$66$&&(17)/$6+,1*$/80,180)/$6+,1*:,7++(00(''5,3('*()8//%5,&.3/,17+0257$5$1'/$7+&(5$0,&7,/(29(50257$5$1'/$7+),1,6+)/225 '$033522),1*(;7(1'727232)'5,3('*(%(+,1'%5,&.9(1((5&08:$//3(56758&785$/)227,1*3(56758&785$/&$3,/$5<%5($.'5,3('*(3529,'(:((39(17$72&:($7+(5%$55,(5/$329(5'5,3('*(0$6215<7,(63$&,1*3(563(&,),&$7,21&21&5(7(75,0%$1'0$18)5(40,1$)*#3/$17(59$325%$55,(53(563(&,),&$7210,1$73/$17(50,1$7/$1'6&$3($/80,180)/$6+,1*:,7++(00(''5,3('*(7+,1%5,&.9(1((529(50257$5$1'/$7+&(5$0,&7,/(29(50257$5$1'/$7+),1,6+)/225 '$033522),1*(;7(1'727232)'5,3('*(%(+,1'%5,&.9(1((5&08:$//3(56758&785$/)227,1*3(56758&785$/&$3,/$5<%5($.'5,3('*(3529,'(:((39(17$72&:($7+(5%$55,(5/$329(5'5,3('*(&21&5(7(75,0%$1' 127($71257+(/(9$7,21%5,&.9(1((5$1'&21&5(7(75,0%(+,1'6/,',1*'2256+$//127(;&((',17+,&.1(667+,1.%5,&.9(1((5250(7$/3$1(/$%29(0,1$73$9(569$325%$55,(53(563(&,),&$7210,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedWALL SECTIONSAR601KHDGKH05.11.23DG $5$57<3:$//6(&7,21:6&5((1 $.$5*877(5 $5$53/,17+'(7$,/ $5$5:$//6(&7,21:0(7$/3$1(/ $.$5&$123<)5$0,1* $5$5)227,1*'(7$,/5(675220 $5$5)227,1*'(7$,/$7)52172)5(675220NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 187 of 802 67$1',1*6($029(5522),1*81'(5/$<0(17)5$0,1*3(56758&785$/7<3522)6+($7+,1*3(56758&785$/5,'*(&$3:)/$6+,1*/2:352),/(6(/))/$6+,1*6.</,*+75()(5,167$//3(50$18)$&785(5 6'(7$,/65()(5720(7$/522)0$18)$&785(565(&200(1'$7,21)25)/$6+,1*5(48,5(0(17667$1',1*6($00(7$/522)6<67(0522),1*81'(5/$<0(1729(56+($7+,1*)/$6+,1*&5,.(7)25326,7,9('5$,1$*&225',1$(:,7+5(48,5(0(7162)6.</,*+7$1'522),1*0$18)$&785(5:$//7,/(29(5&08:$//3(563(&,),&$7,216&21&5(7()/2256/$%+6632673(56758&85$/%(<21'&+$11(/)5$0,1**$3(5)25$7('0(7$/3$1(/:,7+('*(75,03$1(/72%(0,123(1$5($3$77(53(563(&,),&$7,216=)/$6+,1*67$1',1*6($00(7$/522))5$0,1*3(56758&785$/81'(5/$<0(173(563(&,),&$7,216*$%(17&+$11(/= )/$6+,1*720$7&+67$1',1*6($00(7$/522)*$&+$11(/$77$&+:,7+6(/)7$33,1*6&5(:6$72&)520($&+(1'35()250('0(7$/5,'*(&$36+($7+,1*3(56758&785$/)) [),(/'&2/25$&&(17),1,6+[),(/'&2/25[),(/'&2/25$&&(17),1,6+[),(/'&2/25[),(/'&2/250,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedDETAILSA-901KHDGKH05.11.23DG $.$522)5,'*( 67$1',1*6($0 $5 $6.</,*+7 67$1',1*6($0 $&(5$0,&7,/()/225$1':$,16&27 $5 $522)5,'*('(7$,/ $7,/(:$,16&273$77(51NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 188 of 802 6$''/(7+5(6+2/''5$)76723:+(5(5(48,5(''225)5$0(%(<21'+2//2:0(7$/'2253(563(&,),&$7,21+2//2:0(7$/'2253(563(&62/,'*528770$6215<$1&+25#-$0%7<3&08:$//&08:$//+2//2:0(7$/'225)5$0(62/,'*52877+5(6+2/'-$0%+($'(4(40(7$/:$//3$1(/0(7$/:$//3$1(/75,035(),1,6+(')/$6+,1*&$8/.$7-2,17'225)5$0(%(<21'+2//2:0(7$/'2253(563(&[+66&2/801;+66%($00(7$/:$//3$1(/;+66%($03,/(&$30(7$/:$//3$1(/&$3)/$6+,1*720$7&+0(7$/:$//3$1(/;+663267&/5 &21&5(7()227,1*3(56758&785$/3/$16;+66&2/8016&$30(7$/3$1(/%27+6,'(6;+66723$1'%27720127(3$,17$//(;326('67((/685)$&(6$$3$9(565()(572/$1'6&$3(3/$16 35(),1,6+(')/$6+,1*7$//'(&25$7,9(6&5((1:,'7+3(53/$10,123(1$5($35(),1,6+('&$3)/$6+,1*:,7+&/($7[%$567((/),1,6+720$7&+'(&25$7,9(0(7$/6&5((1)$67(172/$1*/(:,7+7$03(55(6,67$17)$671(56[[%$567((/),1,6+720$7&+'(&25$7,9(0(7$/6&5(($1&+25$72&0$;0(7$/62)),73$1(/35(),1,6+(')/$6+,1*7$//'(&25$7,9(6&5((1:,'7+3(53/$10,123(1$5($35(),1,6+('0(7$/:$//3$1(/%$567((/),1,6+720$7&+'(&25$7,9(0(7$/6&5(($1&+25$72&0$;&$8/.$7-2,17:$//7,/(&08:$//3(53/$135(),1,6+(')/$6+,1*6/,',1*'22575$&.5()(57263(&,),&$7,210(7$/62)),73$1(/35(),1,6+(')/$6+,1*0(7$/:$//3$1(/0(7$/:$//3$1(35(),1,6+(')/$6+,1*+(0(;326('('*(635(),1,6+(')/$6+,1*'2253(56&+('8/(6/,',1*'22575$&.5()(57263(&,),&$7,210(7$/62)),73$1(/7<39(173(50(7$/:$//3$1(/$35(),1,6+(')/$6+,1*+(0(;326('('*(6;+665()(5726758&785$/'2253(56&+('8/(6/,',1*'22575$&.5()(57263(&,),&$7,210(7$/:$//3$1(/%(<21'0(7$/62)),73$1(/7<3$1&+25$*(3(56758&785$/67((/3/$7(3(56758&785$/9(173(5$0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedDETAILSA-902KHDGKH05.11.23DG $7<3'225#&08:$// $ $35,9$&<6&5((1+25,=217$/6(&7,21 $ $35,9$&<6&5((19(57,&$/6(&7,21 $35,9$&<6&5((1(/(9$7,21 $9(176&5((1 $9(176&5((1-$0% $5 $9(176&5((1#0(7$/3$1(/6 $5 $9(176&5((1#%5,&.:$// $5 $9(176&5((1#'225NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 189 of 802 &08(;7(5,25:$//5()(5726758&785$/$$%%&%5,&.9(1((529(5&(0(173/$67(56<67(0:($7+(5%$55,(53/$67(56&5(('35(),1,6+(')/$6+,1*720$7&+0(7$/:$//3$1(/6<67(00(7$/:$//3$1(/6<67(00(7$/678'5()(5726758&785$/3,3(5$,1:$7(5/($'(5:+(5(2&&565()(572522)3/$16($/$170(7$/:$//3$1(/&251(575,00(7$/:$//3$1(/:($7+(5%$55,(5)5$0,1*$1'6+($7+,1*3(56758&785$/6($/$1735(),1,6+(')/$6+,1*720$7&+0(7$/:$//3$1(/6<67(0(/$6720(5,&0(0%5$1(:5$3,17223(1,1*)$&(2)&85%%(/2:*$67$,1/(6667((/0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-013" = 1'-0"DETAILSA-903KHDGKH05.11.23DG $5 $%8,/',1*&251(5 $. $%8,/',1*&251(5 .,26.NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 190 of 802 7+,&./,0(3/$67(521($'2%(%/2&.:$//(6721(58%%/()281'$7,21%5,&.3$9,1*3(5/$1'6&$3(68%*5$'(3(5/$1'6&$3(*(27(;7,/()$%5,&29(5/$3$7723),//::$6+('*5$9(/7$03('/,*+7/<'5$,1$*(%2$5'29(56+((7:$7(53522),1*(62,/),//%(/2:68%*5$'(5281'3(5)25$7('3/$67,&3,3(6(721%('2)*5$9(/6/23('2:172,167$//(1'&$3$7%855,('(1' 127(&/($175(1&+2)('(%5,67+(16(7$6,'($//(;&$9$7('62,/)25$5&+$(2/2*,&$/(;$0,1$7,21'2127',6785%6721(58%%/()281'$7,216/23(/,0(3/$67(5:,7+),%(55(,1)25&,1*/$7+29(5($'2%(*$8*(&233(5)/$6+,1*(;7(1'%(<21':,1'2:)5$0(#-$0%[5(':22')5$0(/(;$1*/$=,1*(32;<$1&+253(5$(32;<$1&+25:+(5(2&&856/,0(3/$67(5:,7+),%(55(,1)25&,1*/$7+29(5($'2%(5$',86(;326('('*([5(':22')5$0(/(;$1*/$=,1*(32;<$1&+253(5$(32;<$1&+25:+(5(2&&8560,1$%29(()/$6+,1* 0,1$)*6/23((522)3527(&7,13/$&(352326('9,(:,1*3$1(3(5$(:,1'2:3527(&7,13/$&(),1,6+*5$'(()281'$7,21(75(//,6$1'$:1,1*72%(5(029('5(029(()/$6+,1*$1'5(029((3/$67(50,1%(<21'()/$6+,1*$//6,'(6('2253527(&7,13/$&(,167$///,0(3/$67(53(563(&,),&$7,2165(029((3/$67(568%*5$'($65(48,5('72&203/(7(7+(:25.5(029((3('(67$/6,*1$*(6$/9$*(72&,7<6,7(:$//3(5/$1'6&$3($$$127(&225',1$7(),1$/6,=($1'3/$&(0(172)9,(:,1*3$1(:&,7<$5&+,7(&7$1'$'2%(+,6725,$13523572)$%5,&$7,21$1',167$//$7,21&217,18(68%*5$'($1'$%29(*5$'(3/$67(55(3/$&(0(17$5281'&251(52)%/'* '$</,*+7'5$,1$*(3,3(3(5&,9,/':*67+,&./,0(3/$67(521($'2%(%/2&.:$//(6721(58%%/()281'$7,21%5,&.62/',(5&2856(*5$1,7(&5(7(3$9,1*3(5/$1'6&$3(*(27(;7,/()$%5,&29(5/$3$7723),//::$6+('*5$9(/7$03('/,*+7/<'5$,1$*(%2$5'29(56+((7:$7(53522),1*(62,/),//%(/2:68%*5$'(5281'3(5)25$7('3/$67,&3,3(6(721%('2)*5$9(/6/23('2:172,167$//(1'&$3 6&833(5%855,('$76287+(1' 127(&/($175(1&+2)('(%5,67+(16(7$6,'($//(;&$9$7('62,/)25$5&+$(2/2*,&$/(;$0,1$7,21'2127',6785%6721(58%%/()281'$7,2168%*5$'(3(5/$1'6&$3(6/23( /(;$1*/$=,1*(32;<$1&+25',$7+5($'('%2/7:6,036216(7;3(32;<(65:,7+0,1(0%(',172$'2%(%/2&.25',$7+5($'('%2/7:+,/7,+,75(9(32;<(65:,7+0,1(0%(',172$'2%(%/2&.,167$//3(5(655(3257$1'3529,'(63(&,$/,163(&7,21$65(48,5(%<7+((655(3257&225',1$7(3/$&(0(172)(32;<$1&+256:,7+$5&+,7(&7$1'$'2%(+,6725,$135,2572,167$//$7,210,10$;7<35(':22')5$0(127(&225',1$7(),1$/6,=($1'3/$&(0(172)9,(:,1*3$1(:&,7<$5&+,7(&7$1'$'2%(+,6725,$13523572)$%5,&$7,21$1',167$//$7,216/23( ('2253527(&7,13/$&(,167$///,0(3/$67(53(563(&,),&$7,2165(029((3/$67(568%*5$'($65(48,5('72&203/(7(7+(:25.(:,1'2:3527(&7,13/$&(),1,6+*5$'(&217,18(68%*5$'($1'$%29(*5$'(3/$67(55(3/$&(0(17$5281'&251(52)%/'*3,3(:,7+6/23($0,1$)*7+,&./,0(3/$67(521($'2%(%/2&.:$//(6721(58%%/()281'$7,21*(27(;7,/()$%5,&29(5/$3$7723),//::$6+('*5$9(/7$03('/,*+7/<'5$,1$*(%2$5'29(56+((7:$7(53522),1*(62,/),//%(/2:68%*5$'(5281'3(5)25$7('3/$67,&3,3(6(721%('2)*5$9(/6/23('2:172,167$//(1'&$3$7%855,('(1' 127(&/($175(1&+2)('(%5,67+(16(7$6,'($//(;&$9$7('62,/)25$5&+$(2/2*,&$/(;$0,1$7,21'2127',6785%6721(58%%/()281'$7,21/$1'6&$3(3/$17(56/23(0,16/23( ,167$///,0(3/$67(53(563(&,),&$7,2165(029((3/$67(568%*5$'($65(48,5('72&203/(7(7+(:25.),1,6+*5$'(3(5&,9,/&217,18(68%*5$'($1'$%29(*5$'(3/$67(55(3/$&(0(17$5281'&251(52)%/'*'5$,1$*(3,3((:,1'2:3527(&7,13/$&(0,1$)*#)52172)$'2%(0,66,213/$=$5(675220 &$)(&,7<63(&,),&$7,2112'$7(352-(&77,7/(6+((77,7/(6+((712'(6,*1('%<'5$:1%<&+(&.('%<$33529('%<6&$/(3/$1),/(12/2&$7,2191439-01As indicatedADOBE DETAILSA-911KHDGKH05.11.23DG $ $$'2%()'1'5$,1$*(#%5,&.3$9(56 $ $$'2%(:,1'2:)5$0( +($' $ $$'2%(:,1'2:)5$0( -$0% $$'2%(:$//:(67(/(9$7,21 $ $$'2%()'1'5$,1$*(#*5$1,&5(7(3$9,1* $$'2%(:,1'2:)5$0( (32;<$1&+256 $$'2%(:$//1257+(/(9$7,21 $$'2%()'1'5$,1$*(#3/$17(5 $$'2%(:$//6287+(/(9$7,21NSEDARCHIS T AT TAAEOFCALIFORNIAKKAKKTAAHRYRNANNEHICK SS C-3807CC902 - 28 - 2021RENEWALDATE2025Page 191 of 802 SYMBOL LEGENDSYMBOLDESCRIPTIONLIMIT OF WORKEXISTING TREE TO REMAINRIGHT OF WAYROWLIMIT OF WORKEXISTING TREE DRIPLINEEXISTING TREE TO BE REMOVEDEXISTING TREE TO BE RELOCATEDTREE DISPOSITION TABLEQUANTITY DESCRIPTIONTOTAL EXISTING TREESEXISTING TREES TO BE REMOVEDEXISTING TREES TO BE RELOCATEDEXISTING TREES TO REMAINPROPOSED TREESTREE REPLACEMENT RATIOTREE PROTECTION ZONETREE PROTECTION FENCINGOODETAIL2-------WLWL UTLW W MONTEREY ST.BROAD ST.MISSIONSAN LUIS OBISPODE TOLOSAMURRAYADOBEROWROWLIMIT OF WORKMIT OF WORKSAN LUIS OBISPO COUNTYHISTORICAL MUSEUMROWLIMIT OF WORKLIMIT OF WORKOO OO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OO OOOOOOOOOOOOOOOOOOOOOOOO OO OO OOOOOOOOOOOOOOOOOOOOO OOOOOOOOOOOO OO OO OOOOOOOOOOOOOOOOOOOOO O O O OO OO OO OO OO OO OO OOOOOOOOOOOOOOOOOOOOOOOOTREE TRUNK PROTECTION11TREE TRUNK PROTECTIONCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'-0"1030JMJAKE MINNICKMPMPTREE PROTECTION PLANTP101Page 192 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSJMJAKE MINNICKMPMPTREE PROTECTION DETAILS AND NOTESTREE PROTECTION AREA,SEE PLANS FOR LIMITS6 INCHES OF BARK MULCH WITHINTREE PROTECTION AREAEXISTING TREE TOREMAINF.G.NOTES:1. TREE PROTECTION FENCING SHALL BE ERECTED AT THE EDGE OF THE TREE PROTECTION ZONE OR FOLLOWINGEXISTING HARDSCAPE SURFACES TO REMAIN PRIOR TO THE START OF ANY CLEARING, GRADING OR OTHERCONSTRUCTION ACTIVITY.2. FENCE SHALL BE MINIMUM 5 FEET TALL CONSTRUCTED OF STURDY MATERIAL (CHAIN-LINK OR EQUIVALENTSTRENGTH/ DURABILITY).3. FENCE SHALL BE SUPPORTED BY VERTICAL POSTS SUPPORTED BY STABILIZED SURFACE MOUNT TEMPORARY FENCEPANEL STANDS AND SPACED NOT MORE THAN 10 FEET APART.4. AN ALL WEATHER SIGN THAT INCLUDES THE WORDS, “WARNING: TREE PROTECTION ZONE. PLEASE CONTACT THEPROJECT ARBORIST WITH 48-HOURS NOTICE PRIOR TO RELOCATING OR REMOVING FENCING,” SHALL BESECURELY ATTACHED TO THE FENCE IN A VISUALLY PROMINENT LOCATIONCHAIN-LINK FENCINGTREE PROTECTION FENCING1/2" = 1'-0"STABILIZED SURFACE MOUNTTEMPORARY FENCE PANEL STAND2RRM-MI1-51TREE TRUNK PROTECTION1/4" = 1'-0"6'-0"MAINTAIN EXISTING GRADEWITHIN THE TREE PROTECTIONAREA UNLESS OTHERWISEINDICATED ON THE PLANS6 INCHES OF BARK MULCH OUTSIDEOF FENCING, WITHIN THE TREEPROTECTION AREANOTES:1. SEE SPECIFICATIONS FOR ADDITIONAL TREE PROTECTION REQUIREMENTS.2. NO EQUIPMENT SHALL OPERATE OR BE STORED INSIDE THE TREE PROTECTION AREA.3. AN ALL WEATHER SIGN THAT INCLUDES THE WORDS, “WARNING: TREE PROTECTIONZONE. PLEASE CONTACT THE PROJECT ARBORIST WITH 48-HOURS NOTICE PRIOR TORELOCATING OR REMOVING FENCING,” SHALL BE SECURELY ATTACHED TO THEFENCE IN A VISUALLY PROMINENT LOCATIONTREE PROTECTIONAREA, SEE PLANSFOR LIMITSSTRAW WADDLE WRAPPED TIGHTLY AROUNDTRUNK TO A HEIGHT OF 6'WOOD 2x4" SPACED 6" O.C. MAX. PLACEOVER TOP OF STRAW WADDLEHIGH DENSITY POLYETHYLENE SNOW FENCINGWITH 3.5" x 1.5" OPENINGS WRAPPED TIGHTLYWITH A MINIMUM OF 4 LAYERS; COLOR:ORANGE. PLACE OVER TOP OF WOOD TOFULL 6'-0" HEIGHT1RRM-MI1-501.EXISTING TREES IDENTIFIED TO REMAIN SHALL BE PRESERVED, PROTECTED, AND MAINTAINED.2.PRIOR TO COMMENCEMENT OF CONSTRUCTION, TREE PROTECTION FENCING OR TREE TRUNK PROTECTION SHALL BE PLACEDAROUND EXISTING TREES TO REMAIN AS SHOWN ON SHEET TP101. FOR TREE PROTECTION MEASURES, SEE DETAILS 1 AND 2, THIS SHEET.3.NO CONSTRUCTION PARKING, STORAGE OF HEAVY EQUIPMENT OR MATERIALS SHALL OCCUR WITHIN THE TREE PROTECTION ZONESOF ANY EXISTING TREES TO REMAIN.4.DEMOLITION AND GRADING WITHIN THE TREE PROTECTION ZONES OF EXISTING TREES TO REMAIN SHALL BE MINIMIZED AND SHALL BEDONE UNDER THE DIRECT SUPERVISION OF THE CITY OF SAN LUIS OBISPO CITY ARBORIST OR THE PROJECT ARBORIST. THIS TYPE OFWORK SHALL BE PERFORMED USING HAND TOOLS OR, WHEN NECESSARY, WITH LIGHT (ONE TON OR LESS) RUBBER-TIRED EQUIPMENT.5.PRUNING OF EXISTING TREES IDENTIFIED TO REMAIN SHALL BE KEPT TO A MINIMUM AND MUST FOLLOW CITY OF SAN LUIS OBISPOSTANDARDS.6.ROOT OR CROWN PRUNING SHALL BE PERFORMED UNDER THE DIRECT SUPERVISION OF THE CITY OF SAN LUIS OBISPO CITY ARBORISTOR THE PROJECT ARBORIST. NOTIFY THE PROJECT ARBORIST AT LEAST 48 HOURS IN ADVANCE OF ANY ROOT OR CROWN PRUNINGACTIVITY TO COORDINATE A SITE VISIT. CONTACT JAKE MINNICK (ISA CERTIFIED ARBORIST WE-11830, ISA TRAQ,) AT (805) 543-1794 ORJRMINNICK@RRMDESIGN.COM.7.ANY TREE ROOTS ENCOUNTERED WITHIN THE TREE PROTECTION ZONE OVER 1" IN DIAMETER SHALL BE CLEANLY SEVERED WITH A HANDOR RECIPROCATING SAW PERPENDICULAR TO THE DIRECTION OF GROWTH TO MINIMIZE THE SURFACE AREA OF THE WOUND.SEVERED ROOTS SHALL BE COVERED WITH SOIL IN THE FINAL GRADING CONDITION AND NO SEVERED ROOTS SHALL BE EXPOSED TOAIR OR SUNLIGHT FOR MORE THAN 48 HOURS.8.PRIOR TO COMMENCEMENT OF CONSTRUCTION, CONTRACTOR SHALL OBTAIN TREE REMOVAL PERMIT AS REQUIRED BY THE CITY OFSAN LUIS OBISPO.9.TREE REMOVAL SHALL COMPLY WITH ALL PROVISIONS OF SLOMC 12.24.090.TREE PROTECTION NOTESDIG ALERTDIAL TOLL FREEAT LEAST 2 DAYSBEFORE YOU DIGTP501Page 193 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPGENERAL CONSTRUCTION NOTES1. PRIOR TO BEGINNING CONSTRUCTION, THE CONTRACTOR SHALLVERIFY ALL JOIN CONDITIONS FOR GRADING, DRAINAGE, ANDUNDERGROUND FACILITIES, INCLUDING LOCATION AND ELEVATIONOF EXISTING FACILITIES AT CROSSINGS WITH PROPOSEDUNDERGROUND FACILITIES. IF CONDITIONS DIFFER FROM THOSESHOWN ON THE PLANS, THE CONTRACTOR SHALL NOTIFY THE CITYAND SHALL NOT BEGIN CONSTRUCTION UNTIL THE CHANGEDCONDITIONS HAVE BEEN EVALUATED AND RESOLVED.2. THE CONTRACTOR SHALL BECOME FAMILIAR WITH THE PLANS ANDSITE CONDITIONS PRIOR TO BEGINNING WORK. SHOULDCONFLICTING INFORMATION BE FOUND ON THE PLANS, THECONTRACTOR SHALL NOTIFY AND RECEIVE DIRECTION FROM THECITY BEFORE PROCEEDING WITH THE WORK IN QUESTION.3. ONLY "APPROVED" STAMPED AND SIGNED DRAWINGS SHALL BE USEDFOR THE CONSTRUCTION OF THIS PROJECT.4. NO CHANGES OR MODIFICATIONS TO THE PLANS SHALL BE MADEWITHOUT THE PRIOR WRITTEN APPROVAL OF THE CITY.5. CONSULT WITH WITH THE CITY'S ARBORIST PRIOR TO PRUNING ORWORKING WITHIN THE DRIPLINE OF ANY TREE. ALL PRUNING OF TREESSHALL BE KEPT TO A MINIMUM AND MUST FOLLOW CITY OF SAN LUISOBISPO STANDARDS.6. NO TREES, OTHER THAN THOSE INDICATED ON THE DRAWINGS, SHALLBE REMOVED WITHOUT PRIOR APPROVAL OF THE CITY.7. NO MATERIALS OR EQUIPMENT SHALL BE STORED WITHIN THEDRIPLINE OF ANY TREE.8. ALL NUMERIC AND WRITTEN DIMENSIONS SHALL HAVE PRECEDENCEOVER ALL SCALE DIMENSIONS.9. DETAILS AND NOTES ON THE DRAWINGS TAKE PRECEDENCE OVERTYPICAL DETAILS AND GENERAL NOTES. WRITTEN SPECIFICATIONSTAKE PRECEDENCE OVER DRAWINGS.10. ALL CONSTRUCTION SHALL CONFORM TO THE APPROVED PLANSAND SPECIFICATIONS. IN THE ABSENCE OF A SPECIFIED STANDARDOR SPECIFICATION, WORK SHALL CONFORM TO THE CURRENT CITYOF SAN LUIS OBISPO STANDARDS. IF NONE EXISTS, STANDARDSPECIFICATIONS FOR PUBLIC WORKS CONSTRUCTION (GREENBOOK),SHALL APPLY.11. CONTRACTOR SHALL USE PRECAUTION TO PREVENT DISRUPTION OFPROJECT SITE IN AREAS OUTSIDE CONSTRUCTION ZONE. DAMAGESSHALL BE REPLACED OR REPAIRED BY CONTRACTOR. CONTRACTORSHALL SUBMIT VIDEO LOG OF CONSTRUCTION SITE THROUGHOUTDURATION OF PROJECT.12. THE CONTRACTOR SHALL NOTIFY THE CITY AT LEAST 48 HOURSBEFORE COMMENCING WORK.13. PROPOSED DEVIATIONS FROM THE PLANS MUST BE SUBMITTED TO THECITY FOR REVIEW AND APPROVAL, INCLUDING FIELD REVISIONSREQUESTED BY THE CITY INSPECTOR.14. THE CONTRACTOR SHALL EMPLOY ALL LABOR, EQUIPMENT, ANDMETHODS REQUIRED TO PREVENT THEIR OPERATIONS FROMPRODUCING DUST IN AMOUNTS DAMAGING TO PROPERTY,CULTIVATED OR NATIVE VEGETATION, AND DOMESTIC ANDNON-DOMESTIC ANIMALS OR CAUSING A NUISANCE TO PERSONSOCCUPYING BUILDINGS IN THE VICINITY OF THE JOB SITE. THECONTRACTOR SHALL BE RESPONSIBLE FOR ANY DAMAGE CAUSEDBY DUST RESULTING FROM THEIR OPERATIONS.15. CONSTRUCTION LINE AND GRADE STAKES SHALL BE SET BY A CIVILENGINEER OR SURVEYOR LICENSED IN THE STATE OF CALIFORNIA.16. CONTRACTOR IS RESPONSIBLE FOR THE PROTECTION OR PROPERRESETTING OF ALL EXISTING MONUMENTS AND OTHER SURVEYMARKERS.¬ ANY SURVEY MONUMENTS DESTROYED BY THECONTRACTOR SHALL BE REPLACED IN ACCORDANCE WITH THESTATE LAND SURVEYORS ACT AT THE CONTRACTOR'S EXPENSE.17. ALL PROTECTIVE DEVICES TO BE INSTALLED BY THE CONTRACTOR,SHALL BE IN PLACE AT THE END OF EACH WORK DAY. A SAFEPEDESTRIAN PATH OF TRAVEL SHALL BE PROVIDED AT ALL TIMES TOAND FROM BUILDING ENTRANCES TO PARKING FACILITIES.COORDINATE PEDESTRIAN WALK CLOSURES WITH OWNER PRIOR TOCONSTRUCTION.18. CONTRACTOR SHALL REFER TO MATERIALS SPECIFICATIONSTHROUGHOUT THE APPROVED PLAN SET AND SPECIFICATIONS. ANYSUBSTITUTIONS OF THE MATERIALS SPECIFIED IN THESE DOCUMENTSSHALL REQUIRE WRITTEN APPROVAL FROM THE CITY.19. DURING THE COURSE OF WORK, THE CONTRACTOR SHALL BERESPONSIBLE FOR CALLING THE CITY OF SAN LUIS OBISPO FORTESTING AND INSPECTION 48 HOURS IN ADVANCE. WORK NOTPROPERLY TESTED AND INSPECTED WILL BE SUBJECT TO REJECTION.20. WORK IN AND ALONG PUBLIC STREETS AND PARKING LOTS, ONCEBEGUN, SHALL PROCEED TO COMPLETION WITHOUT DELAY SO AS TOPROVIDE MINIMUM INCONVENIENCE TO THE PUBLIC.21. SUBSURFACE UTILITY DATA IS DEPICTED TO LEVEL C OF CI/ASCE 38-02AS DEFINED IN THE GUIDANCE OF THE EXISTING UTILITY DATA.CONTRACTOR SHALL BE RESPONSIBLE FOR THE VERIFICATION OFLOCATION OF ALL EXISTING UTILITIES IN THE FIELD PRIOR TOCONSTRUCTION. ALL UTILITIES SHALL BE PROTECTED AND REPAIREDBY THE CONTRACTOR IF DAMAGED. CONTRACTOR SHALL BERESPONSIBLE FOR NOTIFICATION OF ALL UTILITY COMPANIES 48HOURS PRIOR TO THE BEGINNING OF WORK. BRING ANY CONFLICTSWITH NEW IMPROVEMENTS IMMEDIATELY TO THE ATTENTION OF THECITY.¬22. ENTRANCE TO THE SITE AND LAY DOWN AREA DURINGCONSTRUCTION SHALL BE SPECIFIED BY THE CITY.23. CONTRACTOR SHALL PROVIDE A LEGIBLE AND COMPLETE SET OFPLANS IDENTIFYING ALL MODIFICATIONS MADE DURINGCONSTRUCTION TO THE CITY FOR THE PREPARATION OF RECORDDRAWINGS.24. ALL CONSTRUCTION SHALL CONFORM TO LATEST EDITION OFCALIFORNIA BUILDING CODE TITLE 24.25. CONTRACTOR SHALL CONFORM TO THE WORKING HOURS FROM8AM - 5PM. NO WORK SHALL BE DONE DURING CITY HOLIDAYS,WEEKENDS, SPECIAL EVENTS OR OTHER PEAK SEASON TIMES PER THECITY OF SAN LUIS OBISPO.26. CONTRACTOR SHALL NOTIFY BUSINESSES OF WORK PRIOR TOCOMMENCEMENT OF CONSTRUCTION. COORDINATE NOTIFICATIONEFFORTS WITH CITY OF SAN LUIS OBISPO.27. THIS PROJECT SHALL COMPLY WITH THE 2019 EDITIONS OF THECALIFORNIA BUILDING CODE (CBC), CALIFORNIA MECHANICALCODE (CMC), CALIFORNIA PLUMBING CODE (CPC), CALIFORNIAELECTRICAL CODE (CEC), CALIFORNIA GREEN BUILDING STANDARDSCODE (CGBS), AND THE CALIFORNIA ENERGY CODE (CENC), ALLAMENDMENTS TO THE CA CODES ADOPTED BY THE CITY OF SAN LUISOBISPO, AND ALL OTHER CODES, REGULATIONS, AND APPROVALSESTABLISHED BY THE CITY OF SAN LUIS OBISPO.28. PRIOR TO START OF CONSTRUCTION, THE CONTRACTOR SHALLSCHEDULE A PRECONSTRUCTION CONFERENCE WITH ALL PARTIESINVOLVED AT THE PROJECT SITE TO REVIEW THE SPECIAL INSPECTIONREQUIREMENTS, PROCEDURES, AND INDIVIDUAL SPECIAL INSPECTORSTHAT WILL BE ASSIGNED TO THE PROJECT, AS WELL AS REQUIREMENTSFOR STRUCTURAL OBSERVATION. CONTRACTOR SHALL CONTACTTHE CITY OF SAN LUIS OBISPO BUILDING DIVISION TO CONFIRM ANACCEPTABLE MEETING DATE AND TIME.CONSTRUCTION NOTESLC001DIG ALERTDIAL TOLL FREEAT LEAST 2 DAYSBEFORE YOU DIG1OCCUPANT LOAD ANALYSIS FOR PATIOTOTAL PATIO AREA: 955 SFOCCUPANT LOAD FACTOR PER CBC 1004.5:5 SF / PERSONTOTAL OCCUPANT LOAD: 191 PERSONS191 PERSONS x .2" /PERSON REQ WIDTH = 38.2" 76" PROVIDED OKPER CBC1007.1.1:MAXIMUM DIAGONAL DIMENSION OF PATIO 45 FTALLOWABLE DISTANCE APART OF TWO EXITS: NOT LESS THAN 1/2 OF 45 FTDISTANCE APART OF CENTER OF TWO EXITS: 22.6 FT OKPage 194 of 802 MATERIALS LEGENDSYMBOLDESCRIPTIONBRICK PAVING TYPE 1PATTERN: HERRINGBONECOLOR: OLD TOWN REDBRICK PAVING TYPE 3PATTERN: HERRINGBONECOLOR: DUSTY ROSEBRICK PAVING TYPE 4PATTERN: HERRINGBONECOLOR: SUMMER WHEATBRICK PAVING TYPE 2PATTERN: HERRINGBONECOLOR: MOUNTAIN ROSESYMBOL LEGENDSYMBOL DESCRIPTIONBENCH MOVEABLE BISTRO TABLE(OWNER FURNISHED, N.I.C.)PLANTER POT TYPE BTRIPLE STREAM WASTE RECEPTACLES.SEE NOTE 5. POLE LIGHTBIKE RACKPLANTING AREALIMIT OF WORKSAWCUT LINEDRINKING FOUNTAIN/BOTTLE FILLERGRANITECRETECOLOR: NATURAL GOLDBRICK PAVING TYPE 5PATTERN: HERRINGBONECOLOR: SUTTER GOLDPLANTER POT TYPE AEXISTING TREE, SEE TP101RIGHT OF WAYROWLIMIT OF WORKBA12345BRICK EDGE BANDCOLOR: BURNT ROSE(SHADING DELINEATES PERMEABLE PAVING)ROOT BARRIER*ACCESSIBLE SEATING AT BAR COUNTERMONTEREY ST.BROAD ST.MISSIONSAN LUIS OBISPODE TOLOSAMURRAYADOBEROWROWLIMIT OF WORKLIMIT OF WORKSAN LUIS OBISPO COUNTYHISTORICAL MUSEUMROWGBLIMIT OF WORKGBLIMIT OF WORKEEEEEEEEEEEEEEEEEEGBGBWMBFEEX. LAWNAREABRICK PAVINGMISSION STYLE RAILINGEX. REDWOOD TREE"MOON TREE"56613552LANDSCAPE BOULDERS2BRICK EDGE BANDTYP. 5END NEW RAILINGP/AP/AP/AP/AP/AP/AEX. SIDEWALKBEGIN NEWRAILING7BRICK PAVINGCOLOR TRANSITION3GRANITECRETE PAVINGEXISTING RAILINGBRICK PAVINGTRANSITION PANELREPLACE/REPAIR IN- KINDV-GUTTER DAMAGED BYCONSTRUCTION2TREE UPLIGHTS PERELECTRICAL SHEETS,2 PER TREE, TYP.1DECORATIVE PICKET FENCE6BRONZE PLAQUE3TREE PLANTING AT GRANITECRETESTRING LIGHT POST46DECORATIVEPICKET FENCE4SEE CG101 FOR PAVING ADJACENT TO ADOBE6DECORATIVEPICKET FENCEEX. REDWOOD TREE2BAR COUNTERPLANTER FENCE(DASHED LINE ASSHOWN, TYP.)525KIOSKRESTROOMEX. SIDEWALKEX. REDWOOD TREER31'-9"R22'-6"R10'-6"R15'-6"APPROX. RADII OF BRICK COLORS.DASHED LINE FOR REFERENCEONLY. SEE DETAIL 4/LC501.515ENDWALL2GRANITE PLANTER CURB15'14'-3"7'-3"BAAPOT IRRIGATIONLANDSCAPE BOULDER265P/A543211122345TREE UPLIGHTS PER ELECTRICAL. 2 PER TREE, TYP.ASPHALT PAVINGSEE CG1017STAIR HANDRAILTRENCH DRAINPER CG1012GRANITE PLANTERCURB5PLANTER FENCE(DASHED LINE ASSHOWN, TYP.)UTILITY LID, TYP.SEE NOTE 1.7STAIR HANDRAIL4TYP. BOTH SIDES.LCLC1EQ.EQ.TRASH ENCLOSUREFENCE/GATE PERARCHITECTURE SHEETSRELOCATED "AUTHORIZED VEHICLES" +ARROW SIGN. FINAL LOCATION TO BEDETERMINED BY CITY TRAFFIC ENGINEER.INSTALL PER CITY STANDARD DETAIL 7210. TOPOF FOOTING SHALL BEGIN BENEATH BRICK.ABCABACBCBACBABABTYP. 4. SEE NOTE 4 BELOW.UTILITY LID, TYP. SEE NOTE 1.ROLLING WASTERECEPTACLES1FURNISHINGS AT BRICKPAVING43BRICK PAVING - PERMEABLE14SEE NOTES 2 & 7DRINKINGFOUNTAIN3*KIOSK FOOTING4EX. LAWN AREABB4CAMERA POLEPER E-003(E) ARTSCULPTURELAWNAREACITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'-0"1030MPMARISA PELTIERLMMPCONSTRUCTION PLANLC101NOTES1. CONTRACTOR TO COORDINATE FINAL PLACEMENT OF ALL UTILITYLIDS (ELECTRICAL, WATER, SEWER, ETC.) WITH ASSOCIATEDSUBCONTRACTOR AND LANDSCAPE ARCHITECT PRIOR TOINSTALLATION.2. REFER TO SHEET A-911 FOR PRESERVATION WORK TO BE COMPLETEDAT THE EXISTING ADOBE.3. REFER TO SHEET TP101 AND TP501 FOR CONSTRUCTION PRACTICESAT EXISTING/RELOCATED TREES.4. PROPOSED LARGE BOX SPECIMEN TREES AT GRANITECRETE PATIOSHALL BE INSTALLED PRIOR TO IRRIGATION PIPE AND ELECTRICALCONDUIT. AFTER INSTALLATION OF TREES CONTRACTOR SHALLCONSULT WITH PROJECT ARBORIST TO CONDUCT AIR SPADE ROOTEXCAVATION TO IDENTIFY ROOTS TO BE PRESERVED. PIPE ANDCONDUIT SHALL BE HAND TRENCHED AND NO ROOTS OVER 1" INDIAMETER SHALL BE SEVERED WITHOUT PERMISSION OF THE PROJECTARBORIST.5. PERMANENT TRIPLE STREAM WASTE RECEPTACLES AS SHOWN IN THELEGEND AND LISTED IN THE TECHNICAL SPECIFICATIONS SHALL BECOLLECTED BY PARKS MAINTENANCE. ROLLING TRIPLE WASTE BINSADJACENT TO THE RESTROOM SHALL BE COLLECTED BY SAN LUISGARBAGE.6. A QUALIFIED HISTORIC ARCHITECT OR ARCHITECTURAL HISTORIANWITH DEMONSTRATED EXPERIENCE WORKING WITH ADOBESTRUCTURES SHALL BE RETAINED TO MONITOR AND PROVIDEPROTECTION GUIDANCE FOR ANY WORK IN THE IMMEDIATE VICINITYOF THE PERIMETER OF THE MURRAY ADOBE.111Page 195 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPCONSTRUCTION DETAILSBRICK PAVING1 1/2" = 1'-0"PROVIDE POLYMERIC SAND TO FILL INIRREGULARITIES IN JOINTS, TYP.CLAY BRICK PAVER. BUTT JOINTS TIGHTLY.GEOTEXTILE FABRICWASHED CONCRETESAND SETTING BEDCLASS 2 AGGREGATEBASE @ 95% RELATIVECOMPACTIONRIP AND COMPACT TO6" OF SUBGRADE TO 90%RELATIVE COMPACTIONPLAN VIEWHERRINGBONE PATTERNNOTES:1. TREAT EXISTING SOIL AND BACKFILL PRIORTO PAVER INSTALLATION WITH GROWTHINHIBITOR.2. SEAL ALL BRICK PAVING SURFACES WITHSEALER PER SPECIFICATIONS.1RRM-MI1-42BRICK EDGE BAND 3" = 1'-0"1BRICK PAVINGPLAN VIEWP.C. CONCRETE FOOTER1/2" MORTARSETTING BEDBRICK EDGEBANDSOLDIER COURSEBRICK EDGE BANDADJACENTSURFACE PERPLAN8"3/8" MORTAR JOINT(1)#4 REBAR, CONT. HORIZ.,CENTERED IN CURB.2RRM-MI1-881'-0"CORE DRILL HOLE W/DIA. 1/2" LARGERTHAN POST AND FILLW/ EPOXY, TYP. ALLPOSTS.BRONZE HANDRAILMOULDING6BRICK STEPSNOTES:1. HANDRAIL COMPONENTS ARE A MIX OF BRONZE AND STEEL. FOR COMPONENTSTHAT HAVE BRONZE ACCENTS MECHANICALLY ATTACHED, BRONZE SHALL BESEPARATED PRIOR TO SHOP PRIMING. REATTACH PRIOR TO WELDING.2. PROVIDE CONTINUOUS WELDS ON ALL COMPONENT CONNECTIONS. REMOVEEXCESS SLAG AND GRIND ALL CORNERS SMOOTH.3. ALL HANDRAIL COMPONENTS THAT ARE STEEL ONLY SHALL BE PAINTED BLACK.4. CONTRACTOR TO PROVIDE SHOP DRAWINGS SHOWING ALL HANDRAILCOMPONENTS AND LAYOUT PRIOR TO FABRICATION.5. ALL HANDRAIL COMPONENTS ARE AVAILABLE FROM WWW.JULIUSBLUM.COM.SEE SPECIFICATIONS FOR ITEM NUMBERS.HANDRAILCROSS-SECTION3/4" = 1'-0"STAIR HANDRAIL1 14"STEEL HANDRAIL MOULDING38" x 1 14" FLAT BARNON-CIRCULAR PERIMETER: 5 58"1'-0"1'-4"9" LAMB'S TONGUE1" ROUND STEEL POST W/BRONZE CENTER, TYP.ROUND POST BASE4"LATERAL SCROLL.SEE PLAN TOPRIGHT.LATERAL SCROLL PLANSCROLL FACESOUTWARD1 1516"MAX7RRM-MI1-73LC501BRICK PAVING - PERMEABLE1 1/2" = 1'-0"GEOTEXTILE ONBOTTOM AND SIDES OFOPEN-GRADED BASE. MIRAFIRS380i OR APPROVED EQUALSOIL SUBGRADE -ZERO SLOPENO. 2 STONE SUBBASENO. 57 STONEOPEN-GRADED BASENO. 8 AGGREGATEBEDDING COURSEBRICK PAVERNO. 8 AGGREGATE IN 1/4" JOINT SPACING3RRM-MI1-116BRICK EDGE BAND AT PERMEABLE BRICK3" = 1'-0"P.C. CONCRETE FOOTER1/2" MORTARSETTING BEDBRICK EDGEBAND#4 REBAR, @ 12" O.C., BOTH WAYS8"3BRICK PAVING -PERMEABLE1BRICK PAVINGRRM-MI1-1174BRICK EDGE BANDMORTAR JOINTBRICK EDGE BAND CONDITIONS1 1/2" = 1'-0"EDGE BAND AT GRANITECRETEEDGE BAND AT PLANTINGBRICK EDGE BANDEDGE BAND AT EXISTING CONCRETEBRICK EDGE BANDEXISTING CONCRETE3GRANITECRETE PAVINGFLUSHBRICK PAVING PER PLANBRICK PAVING PER PLANBRICK PAVING PER PLANNOTE: CONCRETE FOOTING DEPTHBENEATH EDGE BAND VARIES PERPAVING TYPE.ROOT BARRIER PROTECTION,PER PLAN5RRM-MI1-871111BRICK PAVING3-5/8" X 3-5/8" X 2-1/4"BRICK PAVER7STAIR HANDRAIL11-5/8" x 3-5/8" x 2-1/4"BULLNOSE BRICK PAVER7-5/8" X 3-5/8" X 2-1/4" BRICK PAVER, TYP.CUT TO FIT RISER HEIGHT PER GRADING PLAN.3-5/8" X 3-5/8" X 2-1/4" BRICK PAVER1-1/4" MAX3/8" MORTAR, TYP.NOSINGENLARGEMENT3/4" = 1'-0"BRICK STEPS1/8" DEPTH SANDBLASTED AND STAINED CONSTRASTINGSTRIPE. SANDBLASTING SHALL CREATE A CONTRASTINGTEXTURE AND STAIN SHALL BE CONTRASTING IN COLOR.LANDSCAPE ARCHITECT TO APPROVE STAIN COLORPRIOR TO INSTALL.CONSTRASTING STRIPESHALL BE PARALLEL TOTHE NOSE OF THE STEPAND EXTEND THE FULLWIDTH OF THE STEP, ALLSTEPS, TYP.3"1'-4"9"1'-4"#3 REBAR, ASSHOWN#3 TIES @ 12" O.C.,TYP.HANDRAIL FOOTING,WHERE OCCURS.10"6RRM-MI1-71Page 196 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPCONSTRUCTION DETAILS2'-0"1BRICK PAVINGFGP.C. CONCRETE CURB WALL1/2" RADIUS, ALL EDGES6DECORATIVE PICKET FENCERETAINING CURB1 1/2" = 1'-0"2BRICK EDGEBANDNOTE:1. CONCRETE CURB WALL SHALL BEINTEGRAL COLORED, SMOOTH TROWELFINISH.2. INTEGRAL COLOR SHALL BE CITY OF SLOSTANDARD COLOR.#4 REBAR, @ 12" O.C.BOTH WAYSCOMPACTEDSUBGRADE @ 90%RELATIVE COMPACTIONFLUID APPLIEDWATERPROOFINGALONG BACK OF CURB8"RRM-MI1-401DECORATIVE PICKET FENCE1" = 1'-0"APPROX. 60" O.C.,POST LOCATIONS PER PLANFS3 34" TYP.FOOTING CONDITION 1STEEL POST TOP WITH BALL1" STEEL POST WITH BRONZE CENTER1/2" STEEL PICKET WITH BRONZE CENTERROUND POST BASEP.C. CONCRETE FOOTING, TYP. ALL POSTS1'-0" DIA.EDGE BAND CONCRETE FOOTERFOOTING CONDITION 21RETAINING CURB(4) #3 W/ #3 TIETOP AND BOTTOMMALLEABLE IRON VALANCE3/4" SQ. HORIZONTAL STEEL RAIL2BRICK EDGE BANDBRONZE HANDRAIL MOULDINGWITH 38" X 1 14" FLAT BAR BENEATHTERMINAL, CENTER ANDCORNER HANDRAIL PIECEAT POST TOP3/4" SQ. HORIZONTAL STEEL RAILNOTES:1. HANDRAIL COMPONENTS ARE A MIX OFBRONZE AND STEEL. FOR COMPONENTS THATHAVE BRONZE ACCENTS MECHANICALLYATTACHED, BRONZE SHALL BE SEPARATEDPRIOR TO SHOP PRIMING. REATTACH PRIOR TOWELDING.2. PROVIDE CONTINUOUS WELDS ON ALLCOMPONENT CONNECTIONS. REMOVEEXCESS SLAG AND GRIND ALL CORNERSSMOOTH.3. ALL HANDRAIL COMPONENTS THAT ARE STEELONLY SHALL BE PAINTED BLACK.4. CONTRACTOR TO PROVIDE SHOP DRAWINGSSHOWING ALL HANDRAIL COMPONENTS ANDLAYOUT PRIOR TO FABRICATION.5. ALL HANDRAIL COMPONENTS ARE AVAILABLEFROM WWW.JULIUSBLUM.COM. SEESPECIFICATIONS FOR ITEM NUMBERS.1/4HSS 1.5 x 1.5 x 1/4RRM-MI1-826GRANITECRETE PAVING 1 1/2" = 1'-0"CLASS II PERMEABLE AGGREGATEBASE COMPACTED TO 88% TO 92%GRANITECRETE: COMMERICAL 3 BAG MIXCOMPACTED 88%-92%COMPACTED SUBGRADE @ 95%RELATIVE COMPACTION4" PERFORATED PIPE,WHERE OCCURS. SEECIVIL PLANS.3RRM-MI1-26GRANITE PLANTER CURB1 1/2" = 1'-0"1BRICK PAVINGPLANTERAREA1/2" MORTAR BED6"2BRICK EDGE BAND1'-2"GRANITE CURB#5 x 8" DOWEL @ 24"O.C., DRILL ANDEPOXY TO CONCRETEP.C. CONCRETEFOOTERELEVATIONNTSCONCAVE GROUT JOINTGRANITE CURB, LENGTHSMAY VARY.BUTT JOINT AT CORNERS.8"UPLIGHT WHEREOCCURS. SEEELECTRICAL SHEETS.P.C. CONCRETEFOOTING AT EACHLIGHT. 2 LIGHTS PERTREE, AS SHOWN ONPLAN. AVOID LARGEROOTS.CONDUIT PERELECTRICAL SHEETSNOTES:1. GRANITE CURBS FOR THIS INSTALLATION ARE TOBE HISTORICAL CURBS LOCATED AT THE CITY CORPYARD. CURBS MAY DIFFER IN HEIGHT, LENGTH ANDWIDTH. CONTRACTOR TO WORK WITH LANDSCAPEARCHITECT TO SELECT APPROPRIATE PIECES.GRIND/CHIP/CUT CURBS AS NEEDED TO FORM ACOHESIVE CURB INSTALLATION.36" DEPTH ROOTBARRIER PROTECTION,PER PLAN.2RRM-MI1-856"8" MOW CURB1 1/2" = 1'-0"COMPACTED SUBGRADE @ 95%1/2" RADIUS, TYP.(1) #4 REBAR, CONT. HORIZ.,CENTERED IN CURB.PC CONCRETE WITH MEDIUMBROOM FINISH, PERP. TODIRECTION OF CURBNOTES:A. PROVIDE CONTRACTION JOINT EVERY 10' MAX.B. PROVIDE EXPANSION JOINT EVERY 20' MAX.C. SPACE JOINTS EVENLY BETWEEN BEGINNING AND END POINTS.D. TOP OF MOW CURB TO BE FLUSH WITH ADJACENT PAVING.FLUSH IN D.G. PAVING1" IN TURF2" IN PLANTING AREA8'RRM-MI1-614APPROX. 60" O.C.,POST LOCATIONS PER PLANFS3 1/2", TYP.1'-0" DIA.2BRICK EDGE BANDP.C. CONCRETE FOOTING,TYP. ALL POSTS.EDGE BAND CONCRETE FOOTERPLANTER FENCE1" = 1'-0"MALLEABLE IRONVALANCEPOST TOPWITH BALL1/2" SQ. STEEL PICKET3/4" SQ. HORIZONTAL STEEL RAIL(4) #3 W/ #3 TIETOP AND BOTTOM6DECORATIVE PICKET FENCEROUND POST BASE1" O.D. STEELPOSTBRONZE HANDRAILMOULDINGNOTES:1. HANDRAIL COMPONENTS ARE A MIX OFBRONZE AND STEEL. FOR COMPONENTS THATHAVE BRONZE ACCENTS MECHANICALLYATTACHED, BRONZE SHALL BE SEPARATEDPRIOR TO SHOP PRIMING. REATTACH PRIOR TOWELDING.2. PROVIDE CONTINUOUS WELDS ON ALLCOMPONENT CONNECTIONS. REMOVEEXCESS SLAG AND GRIND ALL CORNERSSMOOTH.3. ALL HANDRAIL COMPONENTS THAT ARE STEELONLY SHALL BE PAINTED BLACK.4. CONTRACTOR TO PROVIDE SHOP DRAWINGSSHOWING ALL HANDRAIL COMPONENTS ANDLAYOUT PRIOR TO FABRICATION.5. ALL HANDRAIL COMPONENTS ARE AVAILABLEFROM WWW.JULIUSBLUM.COM. SEESPECIFICATIONS FOR ITEM NUMBERS.1/4HSS 1.5 x 1.5 x 1/4RRM-MI1-1075LC502Page 197 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPCONSTRUCTION DETAILSBRONZE PLAQUE1 1/2" = 1'-0"8"x12"x1/2" THICK CAST BRONZEPLAQUE. INSTALL AT BRICK EDGE BANDPER PLAN. FINAL DESIGN OF PLAQUESHALL BE PROVIDED BY OWNER.3GRANITECRETE PAVINGFLUSH1'-0"3GRANITECRETE PAVING1BRICK PAVINGBRONZE PLAQUEPLAN8"2BRICK EDGE BANDBLIND STUD (4 TOTAL) MOUNTPLAQUE INTO CONCRETE. EPOXY INPLACE.P.C. CONCRETE FOOTER3RRM-MI1-105CITY STANDARD BENCH,PER PLANSURFACE MOUNT PERMANUFACTURER. TOP OFFOOTING SHALL BE 4"BELOW F.S., TYP.BRICKPAVERSFURNISHINGS AT BRICK PAVING3/4" = 1'-0"CONCRETEFOOTING. WIDTHPER FURNISHING.4" METAL SPACERINSTALL FOOTING ONCOMPACTED CLASS IIAGGREGATE BASE @ 95%COMPACTION30"RRM-MI1-431NOTES:A. SUBMIT PHOTOGRAPHS OF BOULDERSFOR APPROVAL FROM OWNER PRIORTO PURCHASING.B. OWNER SHALL APPROVE FINALPLACEMENT IN THE FIELD.LANDSCAPE BOULDER3/4" = 1'-0"SET 1/3 or 33% DEPTH OF BOULDERBENEATH FINISH GRADE.SUBGRADEADJACENT SURFACEPER PLANSBOULDER SIZING:PROVIDE QUANTITIES OF BOULDERS PER QUANTITIES SHOWNON PLANS. BOULDER SIZES ARE LABELED ON PLANS PER THESYMBOLS SHOWN BELOW.SYMBOLSIZE RANGE (H, L & W)36"ABC48"60"SET FACE UP WITH LEASTAMOUNT OF FISSURES, ORFAULTS.NATURAL BOULDER. SEESPECIFICATIONS FOR TYPE,SEE PLANS FOR SIZE ANDLOCATION.F.G.RRM-MI1-452BRICK AND CONCRETE WALL1" = 1'-0"BRICK CAP,ROWLOCK3/8" MORTARJOINTPLANTERAREABRICK CAP,ROWLOCK1/2" MORTAR BED6"INTEGRAL COLORED P.C.CONCRETE WALL. SMOOTHTROWEL FINISH ON ALLEXPOSED SURFACES.#4 REBAR @ 12 O.C.,BOTH WAYSCOMPACTEDSUBGRADE @ 90%COMPACTIONELEVATION A1BRICK PAVING2BRICK EDGE BAND7STAIR HANDRAILFLUID APPLIEDWATERPROOFINGCONCRETEWALL6BRICK STEPSA5RRM-MI1-111LC503TREE PLANTING AT GRANITECRETE1" = 1'-0"3GRANITECRETEPAVING8"2'-4' FROMEDGE OFTRUNKP.C. CONCRETE FOOTING ATEACH LIGHT. 2 LIGHTS PER TREE,AS SHOWN ON PLAN. AVOIDLARGE ROOTS.UPLIGHT PER ELECTRICAL SHEETSAND SPECIFICATIONS. FLUSHMOUNT.TOP OF CONCRETE SHALL BEFLUSH WITH GRANITECRETE.CONDUIT PERELECTRICAL SHEETSLARGE BOX TREE PERPLANTING PLANUNCOMPACTED NATIVE SOIL/AMENDMENTPER PLANTING SPECIFICATIONSCAREFULLY COMPACT STABILIZED DGAROUND ROOTS, BEING CAREFUL NOT TOSEVER OR DAMAGE ROOTS.NOTE:1. PROPOSED LARGE BOX SPECIMEN TREES AT GRANITECRETEPATIO SHALL BE INSTALLED PRIOR TO IRRIGATION PIPE ANDELECTRICAL CONDUIT. AFTER INSTALLATION OF TREESCONTRACTOR SHALL CONSULT WITH PROJECT ARBORIST TOCONDUCT AIR SPADE ROOT EXCAVATION TO IDENTIFY ROOTSTO BE PRESERVED. PIPE AND CONDUIT SHALL BE HANDTRENCHED AND NO ROOTS OVER 1" IN DIAMETER SHALL BESEVERED WITHOUT PERMISSION OF THE PROJECT ARBORIST.STABILIZED DECOMPOSED GRANITE PERSPECIFICATIONS. COLOR MATCH TOGRANITECRETE COLOR. INTERFACE BETWEENGRANITECRETE AND STABILIZED DG SHALLFORM ONE FLUSH CONTINUOUS SURFACE.CONTRACTOR TO INSTALL DG UNDERDIRECTION OF PROJECT ARBORIST TODETERMINE RADIUS NEEDED FOR EACH TREE.RRM-MI1-1084SOIL SEPARATOR FABRIC,WRAP UP 4" ON ALL SIDESOF POT AND ADHEREWITH SILICONE ADHESIVEPOT IRRIGATION1" = 1'-0"PVC LATERAL1BRICK PAVING1/2" SCH. 40 PVC PIPE2" DIA. PLASTIC DRAIN PIPE. SEALCONNECTION TO POT WITHSILICON SEALANT.3" LAYER OF WASHEDPEA GRAVEL1/2" FLEX PVC TUBING(LENGTH AS REQUIRED)PLANTER POT PERSPECIFICATIONS. DRILL BOTTOMTO ACCEPT PVC DRAIN PIPE.1/2" SCH 80 PVCFEMALE ADAPTER TxT1/2" SCH 80 PVC ELBOWPLANTER MIX.SEE SPECIFICATIONS.RAIN BIRD XERI-BUBBLERMODEL# SXB-3606RRM-MI1-48BRICK PAVING COLOR TRANSITION1/2" = 1'-0"BRICK PAVING COLOR 1FEATHER COLOR TRANSITION BETWEEN EACH BRICKCOLOR APPROXIMATELY 2FT FROM CENTERLINE,EACH SIDE, TYP. THERE SHALL BE NO CUTTING OFBRICKS TO ACHIEVE THIS LOOK, USE WHOLE BRICKSONLY.BRICK PAVING COLOR 2THIS SECTION SHOULD BE 75% COLOR 1AND 25% COLOR 2.THIS SECTION SHOULD BE 75% COLOR 2AND 25% COLOR 1.7RRM-MI1-10611Page 198 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPCONSTRUCTION DETAILSF.S.ELEVATIONBRICK WALL A1" = 1'-0"1BRICK PAVINGBRICK BAND PER PLAN, BOTH SIDES OF WALL.SUB SLAB SHALL BE INTEGRAL TO WALLFOOTING, TYP. ENTIRE LENGTH OF WALL.P.C. CONCRETE FOOTING10"1'-9"3/8" MORTAR JOINT, FLUSHBRICKCOMPACTED SUBGRADE @ 90%RELATIVE COMPACTIONWALL CAP PLANGALVANIZED MASONRY TIES FOR BRICKSUPPORT, FASTEN TO CONCRETE CORE,18" O.C., TYP. BOTH SIDES#4 REBAR, BOTH WAYS @ 12" O.C., TYP.3'-0"RRM-MI1-461BAR COUNTER1" = 1'-0"POST BASEHSS 1.5"x1.5"x1/4" STEEL POST4"APPROX. 5' O.C.2'1'-3"9"HSS 1.5"x1.5"x1/4"STEEL FRAME. MITERCORNERS AND WELD.34'-0"3BRICK WALL BELEVATION VIEW FROM PATIO1012"1012"CLHSS 1.5"x1.5"x1/4" STEEL CENTERBAR. WELD TO POSTS ANDFRAME.3'-0"ACCESSIBLESEATING AREA1/4" PERFORATEDSTEEL TABLE TOPNOTES:1. SUBMIT SHOP DRAWINGS INDICATING ALLWELDS, MATERIALS AND LAYOUT FORAPPROVAL PRIOR TO FINAL FABRICATION.2. ALL BAR COMPONENTS TO BE HOT ZIPPEDGALVANIZED AND PAINTED BLACK. GRIND ALLWELDS AND SHARP EDGES SMOOTH PRIOR TOGALVANIZING.4"1/4" PERFORATEDSTEEL TABLE TOP4"4"17"714"SECTION1/4HSS 2 x 2 x 1/41/42'-7"2RRM-MI1-114F.S.GALVANIZED MASONRY TIES FOR BRICKSUPPORT, FASTEN TO CONCRETE CORE,18" O.C., TYP. BOTH SIDES3'-0"CONCRETE MOW CURB PER PLAN. INTEGRALTO FOOTING, MED. BROOM FINISH ONEXPOSED CURB FACE, CONTRACTION JOINTSEVERY 10' O.C., ENTIRE LENGTH OF CURB.P.C. CONCRETE FOOTING#4 REBAR, BOTH WAYS @ 12" O.C., TYP.3/8" MORTAR JOINT, FLUSHBRICKCOMPACTED SUBGRADE @ 90%RELATIVE COMPACTION10"1'-9"BRICK WALL B1" = 1'-0"TURF PER PLAN2BAR COUNTER3BRICK EDGEBAND ATOPFOOTING, TYP.WATERPROOFINGAT BACK OFFOOTINGPROVIDE 1" PVC WEEP HOLES @3' O.C., ENTIRE LENGTH OF WALL.WEEP HOLE SHALL STOP BEHINDBRICK, PROVIDE OPENING INMORTAR FOR WEEP.3RRM-MI1-113LC504STONE SEATWALL1" = 1'-0"1'-6"2BRICK EDGE BAND4" MORTAR BASECLASS II COMPACTED BASE@ 95% COMPACTIONMORTAR AND STONE CHIP. HOLDBACK FROM EDGE TO MATCHEXISTING WALLS.SALVAGED STONE FROMEXISTING WALLSNOTE:1. IT IS THE INTENTION THAT THIS SEATWALL MATCHTHE EXISTING WALLS IN MISSION PLAZA. FINISHEDRESULT SHOULD BE CONSTRUCTED IN A MANNERTO SEAMLESSLY BLEND IN WITH EXISTING SITEWALLS.38"81RRM-MI1-495STRING LIGHT POST 3/4" = 1'-0"3" O.D. ACORN POST CAPHAND HOLE FOR RECEPTACLE WHEREOCCURS, SEE ELECTRICAL SHEETS.6STRING LIGHT ATTACHMENTDECORATIVE POST BASE3GRANITECRETE PAVING1'-0" DIA.4" BASE X 3" TOP O.D. X 0.125 THICKROUND TAPERED ALUMINUM POST.BLACK POWDER COAT FINISH.3/4" x 17" x 3' ANCHOR BOLT PER MFR.(4) #4 W/ #3 TIE TOP ANDBOTTOM & @ 18" O.C. MAX.3" CLR.(3) #3 TIES @ 1 1/2" O.C.ELECTRICALCONDUITRRM-MI1-1104SS 18" CABLESS 316" CABLE CLAMPSSS TURNBUCKLESS ELECTRICAL TIESS 18" CABLESTRING LIGHTSTRING LIGHT CABLECABLETHIMBLESTRING LIGHT ATTACHMENT1/4" = 1'-0"SS 1/2"X2" EYE BOLTCABLE THIMBLE4STRING LIGHT POSTNUTRRM-MI1-5361Page 199 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERLMMPCONSTRUCTION DETAILSCITDAPROJECT TITLE:DEDRCHAPSCPLLC505MISSION STYLE RAILING1" = 1'-0"RRM-MI1-831BRICK PAVING TRANSITION PANEL3" = 1'-0"BRICK PAVING RUNNING BONDPATTERN, REUSE EXISTING BRICKS.1BRICK PAVINGEDGE OF IMPROVEMENTS, JOIN FLUSH.FORM ONE CONTINUOUS PATTERNBETWEEN EXISTING AND REPLACEDBRICK PAVERS AND EDGE BAND.DO NOT CUT BRICKS.EXISTING BRICK PATHSLOPE PANEL TO MEETGRADE OF EXISTING PATHPER GRADING PLAN2BRICK EDGE BAND2RRM-MI1-104DRINKING FOUNTAIN1" = 1'-0"WATER SUPPLYBALL SHUTOFF VALVEVALVE BOX1 12" PVCDRAIN LINEREMOVABLE SS CAPPAVER EXTENSION AND BOLTS BYMANUFACTURERNOTES:1. INSTALLATION TO BE COMPLETE IN ACCORDANCE WITH MANUFACTURER SPECIFICATIONS.FURTHER INFORMATION FOUND AT; MOSTDEPENDABLE.COMBOLT CENTERED UNDER ADA ARM5"9"FILTERACCESS DOOR4' (W) X 2' (L) CONCRETEPAD BENEATH PAVERSPAVINGPER PLAN3RRM-MI1-1181KIOSK FOOTING1 1/2" = 1'-0"3BRICK PAVING -PERMEABLEKIOSK WIDTH, PERMANUFACTURER SPECSNOTES1. INSTALLATION TO BE COMPLETE IN ACCORDANCE WITH MANUFACTURERSPECIFICATIONS. FURTHER INFORMATION FOUND AT; TOUCHSOURE.COM OUTDOOR KIOSK#4 REBAR BOTHWAYS @ 12"O.C., TYP.P.C. CONCRETEFOOTINGCOMPACTED SUBGRADE@ 95% RELATIVECOMPACTIONANCHORING PERMANUFACTURER3'-0"4RRM-MI1-119Page 200 of 802 SYMBOLMANUFACTURER/MODELARCPSIGPMRADIUSDETAILHUNTER PROS-06-PRS30 04H 180 30 0.44'HUNTER PROS-06-PRS30 04Q90 30 0.24'HUNTER MP CORNER PROS-12-PRS40-CV TADJ4014'HUNTER MP STRIP PROS-12-PRS40-CV RST RCS 40 0.225'x15'HUNTER MP1000 PROS-12-PRS40-CV L 210-270 4014'HUNTER MP1000 PROS-12-PRS40-CV M 90-210 4014'HUNTER MP2000 PROS-12-PRS40-CV K 90-210 40 19'RAIN BIRD 1806-5 SERIES STREAM 5Q-B90 30 0.55'RAIN BIRD RWS-M-B-C 1402 360 40 0.5 3'SYMBOLMANUFACTURER/MODEL/DESCRIPTIONPSIGPMRADIUSDETAILHUNTER PGJ-06 2.0TURF ROTOR, 6IN. POP-UP. ADJUSTABLE AND FULL CIRCLE.301.724'SYMBOLMANUFACTURER/MODEL/DESCRIPTIONDETAILRAIN BIRD PEB1IN., 1-1/2IN., 2IN. PLASTIC INDUSTRIAL VALVES. LOW FLOWOPERATING CAPABILITY, GLOBE CONFIGURATION.RAIN BIRD 44-RC1" BRASS QUICK-COUPLING VALVE, WITHCORROSION-RESISTANT STAINLESS STEEL SPRING,THERMOPLASTIC RUBBER COVER, AND 2-PIECE BODY.LANDSCAPE PRODUCTS INC. BGV1/2", 3/4", 1", 1-1/4", 1-1/2", 2", 2-1/2", 3", 4" BRASS GATEVALVE. THREADED BONNET, NON-RISING STEM, PRESSURERATED TO 200 PSI. SAME SIZE AS MAINLINE.BUCKNER-SUPERIOR 3200 1"NORMALLY CLOSED BRASS MASTER VALVE THAT PROVIDESDIRTY WATER PROTECTION AND NO MINIMUM FLOWFEATURE, WHICH ENSURES RELIABLE OPENING AND CLOSINGOF THE VALVE IN EXTREME HIGH OR LOW FLOW SCENARIOS.AVAILABLE IN 3/4IN.,1IN.1-1/2IN.,2IN.,2-1/2IN. AND 3IN..FEBCO 825Y 2"REDUCED PRESSURE BACKFLOW PREVENTERCALSENSE WALL MOUNT CONTROLLEREXISTING CALSENSE CONTROLLER TO BE RELOCATED ANDREUSED.FLOW SENSORRAINMASTER BRASS/IMPELLER/PLASTIC FLOW SENSOR, CITYOF SLO SPECBACKFLOW ENCLOSURELOCKABLE ENCLOSURE, PER CITY SPECCAP FOR FUTURE USECAP AT THE MAINLINE OR LATERAL LINE FOR FUTURE USE. THEPRESSURE AND FLOW PROVIDED TO THAT LOCATION AREINDICATED NEXT TO THE CAP SYMBOL.POINT OF CONNECTION 2"EXISTING 2" MAINLINEIRRIGATION LATERAL LINE: PVC SCHEDULE 40IRRIGATION MAINLINE: PVC SCHEDULE 40PIPE SLEEVE: PVC SCHEDULE 40SLEEVE SIZE SHALL BE 2X THE PIPE DIAMETER. EXTEND 18"BEYOND EDGE OF PAVING. PROVIDE SEPARATE SLEEVES FORALL CONTROL WIRES.2.0MBFCENCLXX8650/LI5018550/LI5028650/LI5018650/LI5018650/LI5018650/LI5018650/LI5018650/LI5018650/LI5018670/LI5018670/LI5018620/LI5028630/LI5028520/LI5018550/LI502//////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// // / / / // / / / / / / / / / / / / / // // / / / / / / // / / / / / / //////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////UTLMONTEREY ST.BROAD ST.MISSIONSAN LUIS OBISPODE TOLOSAMURRAYADOBEROWLIMIT OF WORKLIMIT OF WORKSAN LUIS OBISPO COUNTYHISTORICAL MUSEUMROWLIMIT OF WORKLIMIT OF WORKWCBFENCLM2.02.02.02.02.0APPROXIMATELOCATION OF (E)MAINLINE, VERIFYLOCATION IN FIELD.REMOVE (E) HEAD ANDABANDON UNDERGROUNDPIPES IN PLACE, TYP.751"85.21"CONTROLLER LOCATION.PROVIDE 120V AC TOTHIS LOCATION. PULL ALLEXISTING VALVE WIRES TOREMAIN FROM EXISTINGSYSTEM AND NEW VALVEWIRES TO CONTROLLER.REMOVE (E) HEAD, TYP.APPROX. LOCATIONOF (E) MAINLINE,ABANDON IN PLACEINSTALL 2" PVC CONDUITAND PULL ALL (E) VALVEWIRES TO NEWCONTROLLER LOCATION.INSTALL WUNDERCOVERSVALVE BOX.P.O.C. - TIE INTO (E)MAINLINE2.01.51.51.52.0.75.75.75.753.211"221"431"341"59.11"69.861"CONTRACTOR TO PROVIDE TEMPORARYIRRIGATION TO (E) PLANTS AND TREESDURING CONSTRUCTION, TYP. ALL AREASAFFECTED OUTSIDE OF LIMIT OF WORK.(E) LAWN AREA.REPLACEMENT HEADSAND VALVES SHOWN.Generated: 2023-05-10 15:31P.O.C. NUMBER: 01Water Source Information: EXISTING 2" MAINLINEFLOW AVAILABLEPoint of Connection Size: 2"Flow Available 77.18 GPMPRESSURE AVAILABLEStatic Pressure at POC:75 PSIPressure Available: 75 PSIDESIGN ANALYSISMaximum Multi-valve Flow: 40 GPMFlow Available at POC:77.18 GPMResidual Flow Available: 37.18 GPMCritical Station: 6 Design Pressure: 45 PSI Friction Loss: 0.45 PSI Fittings Loss: 0.04 PSI Elevation Loss: 0 PSI Loss through Valve: 1.7 PSIPressure Req. at Critical Station: 47.2 PSILoss for Fittings: 0.17 PSILoss for Main Line: 1.72 PSILoss for POC to Valve Elevation: 0 PSILoss for Backflow: 11.9 PSILoss for Master Valve: 10 PSICritical Station Pressure at POC: 70.9 PSIPressure Available:75 PSIResidual Pressure Available: 4.05 PSICRITICAL ANALYSISCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'-0"1030JMMARISA PELTIERMPMPIRRIGATION PLAN1. CONTRACTOR SHALL SLEEVE UNDER PAVING PER PLANS AND SPECIFICATIONS. TWICE(2X) THE SIZE OF PIPEENCLOSED. EXTEND ALL SLEEVES 18" BEYOND EDGE OF PAVING2. IRRIGATION PLAN IS DIAGRAMMATIC. FINAL LOCATION OF PIPING WILL BE DETERMINED AT THE TIME OFINSTALLATION. MAINLINE AND LATERALS SHALL BE PLACED IN THE SAME TRENCH WHEN POSSIBLE. ALL Q.C.VALVES ARE TO BE LOCATED 12" FROM SIDEWALKS, CURBS, ASPHALT & CONCRETE SURFACES.3. ALL EQUIPMENT REQUIRED BUT NOT SPECIFIED ON THE DRAWING, TO COMPLETE THE WORK, SHALL BE PROVIDEDBY THE IRRIGATION CONTRACTOR.4. INSTALL ALL EQUIPMENT IN ACCORDANCE WITH MANUFACTURER'S INSTRUCTIONS AND/OR SPECIFICATIONS.5. CONTRACTOR SHALL COORDINATE POWER TO CONTROLLERS AND DEDICATE ONE (1) 20 AMP BREAKER FOREACH CONTROLLER. THE AUTHORIZED REPRESENTATIVE SHALL REVIEW CONTROLLER LOCATIONS PRIOR TOINSTALLATION. 120 VOLT SERVICE AND HOOK-UP TO THE CONTROLLER SHALL BE COMPLETED BY A LICENSEDELECTRICAL CONTRACTOR. THIS COST IS TO BE A PART OF THE LANDSCAPE CONTRACTOR'S BID.6. CONTRACTOR SHALL FAMILIARIZE THEMSELF WITH THE PLANS AND SITE CONDITIONS PRIOR TO BEGINNINGWORK. SHOULD CONFLICTING INFORMATION BE FOUND ON THE PLANS, THE CONTRACTOR SHALL NOTIFY THEPROJECT LANDSCAPE ARCHITECT BEFORE PROCEEDING WITH THE WORK IN QUESTION.7. DO NOT WILLFULLY INSTALL THE IRRIGATION SYSTEM AS SHOWN ON THE DRAWINGS WHEN IT IS OBVIOUS IN THEFIELD THAT OBSTRUCTIONS, GRADE DIFFERENCES OR DIFFERENCES IN THE AREA DIMENSIONS EXIST THAT MIGHTNOT HAVE BEEN CONSIDERED IN THE ENGINEERING. SUCH OBSTRUCTIONS OR DIFFERENCES SHOULD BEBROUGHT TO THE ATTENTION OF THE LANDSCAPE ARCHITECT. IN THE EVENT THIS NOTIFICATION IS NOTPERFORMED, THE CONTRACTOR SHALL ASSUME FULL RESPONSIBILITY FOR ANY REVISIONS NECESSARY AT NOEXPENSE TO THE OWNER.8. CONTRACTOR SHALL ADJUST HEADS AS NEEDED TO MINIMIZE OVERSPRAY ONTO HARDSCAPE AREAS.9. SPLICING OF 24 VOLT WIRES WILL NOT BE PERMITTED EXCEPT IN VALVE BOXES. LEAVE A 24" COIL OF EXCESSWIRE AT EACH SPLICE. LABEL ALL WIRES W/ WATERPROOF MARKERS AT ALL SPLICES AND VALVE MANIFOLDS.10. CONTRACTOR SHALL BE RESPONSIBLE FOR THE INSTALLATION OF ALL MATERIAL APPEARING ON PLAN.11. ALL EXISTING UTILITIES, WATER LINES AND FIRE HYDRANTS SHALL REMAIN CONNECTED AND IN FULL CONTINUOUSOPERATION DURING AND FOLLOWING ALL CONTRACT WORK.12. LANDSCAPE CONTRACTOR TO COORDINATE WITH GENERAL CONTRACTOR PRIOR TO DEMOLITION ORPROTECTION OF EXISTING MAINLINE AND CONTROLLER WIRE FOR FUTURE USE.13. IF THE INTENT IS TO DEMO ANY IRRIGATION EQUIPMENT IN NEW CONSTRUCTION AREA, LANDSCAPECONTRACTOR SHALL SUPPLY ALL NEW MAINLINE AND CONTROL WIRE TO NEW REMOTE CONTROL VALVE ASDESIGNED PER THIS PLAN, TYPICAL.14. ALL NEW IRRIGATION BOXES, AND ADDITIONAL BOXES NECESSARY FOR RETROFITS SHALL BE LOCATED INPLANTING AREAS 18" MIN. AWAY FROM ADJACENT PAVING AND 5' MIN. AWAY FROM IMMEDIATE BUILDINGENTRIES.15. CONTRACTOR SHALL NOT INSTALL ANY PLANTING UNTIL THE FOLLOWING ARE COMPLETED: 1. THE IRRIGATIONSYSTEM SHALL BE FULLY OPERATIONAL. 2. HYDROSTATIC PRESSURE TESTS SHALL BE PERFORMED ON MAIN ANDLATERAL LINES. 3. ALL ZONES SHALL PASS A COVERAGE TEST. 4. CONTROLLERS SHALL BE FULLY OPERATIONAL.16. CITY IRRIGATION CONTROLLER WIRES SHALL ALL BE LOCATED WITHIN ELECTRICAL CONDUIT AND NOT DIRECTBURIED, TYPICAL.IRRIGATION SCHEDULEIRRIGATION NOTESIRRIGATION SPECIFICATIONSREFER TO DIVISION III OF THE CURRENT CITY OF SAN LUISOBISPO STANDARD SPECIFICATIONS & ENGINEERINGSTANDARDS.LI1011Page 201 of 802 MONTEREY ST.BROAD ST.MISSIONSAN LUIS OBISPODE TOLOSAMURRAYADOBEROWLIMIT OF WORKLIMIT OF WORKSAN LUIS OBISPO COUNTYHISTORICAL MUSEUMROWGBLIMIT OF WORKGBLIMIT OF WORKGBGBWGBCBFENCLM2.02.02.02.02.02.01.51.51.52.0.75.75.75.75222020222022202222022202222022220222.2.02222.02.02.02011155111511151151115111511511.511.5111.5111.5515151515151515151.515.5151.51.55551551515151515151.51.51.51.5520202020202020202.02.02.02.02.07575757575757575.75.75.75.75.7577777777.77.7.77575757575757575.75.75.7555.7557575757575757575.75.75.75.75.75CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'-0"1030JMMARISA PELTIERMPMPHYDROZONE PLANHYDROZONE SCHEDULELI201LOW - SHRUBS AND TREES 1,676 SQ FT WATER USE CALCULATIONSMODERATE - SHRUBS AND TREES 238 SQ FT HIGH - TURF 757 SQ FTHPage 202 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSJMMARISA PELTIERMPMPIRRIGATION DETAILSCITY SDATE:PROJECT TITLE:SHEETDESIGDRAWNCHECKAPPROSCALEPLAN FCJMMAMPMPLI501Page 203 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSJMMARISA PELTIERMPMPIRRIGATION DETAILSLI502CITY SDATE:PROJECT TITLE:SHEETDESIGDRAWNCHECKAPPROSCALEPLAN FNCJMMAMPMPPage 204 of 802 TREESQTYBOTANICAL NAMECOMMON NAMECONTWUCOLS1 ALOE 'HERCULES' TREE ALOE 24"BOX LOW2 CERCIS CANADENSIS 'FOREST PANSY' FOREST PANSY EASTERN REDBUD 48"BOX MODERATE1 JACARANDA MIMOSIFOLIA JACARANDA MULTI-TRUNK 60"BOX MODERATE4 OLEA EUROPAEA 'SWAN HILL' TM MULTI-TRUNKED SWAN HILL OLIVE 108" BOX LOWSHRUBSQTYBOTANICAL NAMECOMMON NAMECONTWUCOLS5 ACACIA COGNATA 'COUSIN ITT' COUSIN ITT LITTLE RIVER WATTLE 5 GAL LOW3 AGAVE OVATIFOLIA WHALE'S TONGUE AGAVE 5 GAL LOW9 ANIGOZANTHOS 'BIG RED' RED KANGAROO PAW 5 GAL LOW3 BOUGAINVILLEA X 'BARBARA KARST' BARBARA KARST BOUGAINVILLEA 15GA STAKED LOW4 BOUGAINVILLEA X 'LA JOLLA' LA JOLLA BOUGAINVILLEA 5 GAL LOW9 BOUGAINVILLEA X 'ROSENKA' ROSENKA BOUGAINVILLEA 5 GAL LOW5 HESPERALOE PARVIFLORA 'PERPA' TM BRAKELIGHTS RED YUCCA 5 GAL LOW26 LOBELIA LAXIFLORA ANGUSTIFOLIA MEXICAN LOBELIA 5 GAL LOW3 LOMANDRA LONGIFOLIA 'PLATINUM BEAUTY' VARIEGATED RUSH 5 GAL LOW4 MAHONIA REPENS CREEPING MAHONIA 5 GAL LOW15 OLEA EUROPAEA 'MONTRA' TM LITTLE OLLIE OLIVE 15 GAL LOW6 ROSA FLORIBUNDA 'ICEBERG' ICEBERG ROSE 5 GAL LOWGROUND COVERSQTYBOTANICAL NAMECOMMON NAMECONTWUCOLS759 SF LOLIUM PERENNE PERENNIAL RYEGRASS SEED HIGHPLANTING NOTES1. PLANT LIST IS FOR CONVENIENCE OF CONTRACTOR ONLY. IN CASE OF DISCREPANCIES BETWEENTHE PLANS AND THE LIST, PLANS SHALL PREVAIL.2. PLANT LOCATIONS SHOWN ON THE PLANS ARE DIAGRAMMATIC. CONTRACTOR SHALL LOCATEALL PLANT MATERIAL UNDER THE DIRECTION OF THE CITY PRIOR TO PLANTING HOLE EXCAVATION.3. THE CITY RESERVES THE RIGHT TO MAKE SUBSTITUTIONS, ADDITIONS, AND DELETIONS TO THEPLANTING LAYOUT AS WORK PROGRESSES.4. CONTRACTOR SHALL INSTALL A 3" THICK LAYER OF MULCH IN ALL PLANTER AREAS PERSPECIFICATIONS.5. ALL TREES MUST BE APPROVED AND TAGGED AT NURSERY BY LANDSCAPE ARCHITECT.MONTEREY ST.BROAD ST.MISSIONSAN LUIS OBISPODE TOLOSAMURRAYADOBEROWLIMIT OF WORKLIMIT OF WORKSAN LUIS OBISPO COUNTYHISTORICAL MUSEUMROWLIMIT OF WORKLIMIT OF WORKEEEEEEEEEEEEEEEEEEWMBFEREPAIR IN-KIND ANYTURF DAMAGED BYCONSTRUCTIONRELOCATEDOLIVE TREEEXISTING TREE, TYP.LANDSCAPE BOULDERS,TYP. SEE LC101.ROOT BARRIERPROTECTIONREPAIR IN-KIND ANYTURF DAMAGED BYCONSTRUCTIONCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS0feet201"=10'-0"1030MPMARISA PELTIERMPMPPLANTING PLANPLANTING SCHEDULELP1011Page 205 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12, 2023NOT FORCONSTRUCTION0256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSMPMARISA PELTIERMPMP1CITY STANDARD TREE PLANTING AND STAKINGNTS2CITY STANDARD SHRUB PLANTINGNTSPLANTING DETAILSLP501Page 206 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-101DETAIL REFERENCE BUBBLE WITH LEADERDRAG STRUT CONNECTIONMOMENT CONNECTIONWIDE FLANGE STEEL COLUMNNUMBER OF EVENLY SPACEDSTEEL HSS TUBE COLUMNWELDED WIRE FABRICELEVATION OF WALL OR FRAMESLOPED SURFACEINDICATES SAND OR GROUTINDICATES GRAVELEARTH LAYERNORTH ARROWSLOPEFULL HEIGHT SECTION INDICATORDETAIL REFERENCE BUBBLEBEAM CAMBER AT MID-SPANSPECIAL STUD SPACING SEE TYPICALDOUBLE ANGLE BRACESTEEL IN CROSS SECTIONFULL HEIGHT STIFFENER CONNECTIONSTEPPED FOOTINGTOP/BOTTOM OF ELEVATIONSTOP OF STEEL ± ELEVATIONMEMBER SPLICESTEEL HSS OR PIPE COLUMN(WWF LAYER)STEPPED SURFACE; FLOOR DEPRESSIONANGLE BRACESHEAR STUDSSTEEL DETAILS-S-BOT OFEL = (-X'-X")BOTTOM STEPPED FOOTINGWOOD POSTXXX'-X"INDICATES HEADER @ OPENING PER HEADER SCHEDULEINDICATES SPAN AND DIRECTION OF PREFABRICATED ROOF TRUSS (BY OTHERS)INDICATES SPAN AND DIRECTION OF ROOF RAFTER OR FLOOR JOIST WITH WEB STIFFENERXXINDICATES BEARING WALLSHADED AREA INDICATES CALIFORNIA FRAMINGSHADED AREA INDICATES FOOTPRINT OF FLOOR ABOVEINDICATES SPAN AND DIRECTION OF ROOF RAFTER OR FLOOR JOISTXXINDICATES EXTENTS OF FRAMING OR OTHER STRUCTURAL ELEMENTINDICATES PAD FOOTING TYPE PER SCHEDULE1xINDICATES SHEAR WALL STRAP / HOLDOWN TYPE PER SCHEDULEINDICATES BEARING CMU WALL BELOWINDICATES BEARING CMU WALL ABOVEINDICATES NON-BEARING CMU WALL BELOWINDICATES NON-BEARING CMU WALL ABOVEINDICATES EXISTING BEARING CMU WALLINDICATES BEARING CONCRETE WALL BELOWINDICATES EXISTING NON-BEARING CMU WALL INDICATES NON-BEARING CONCRETE WALL BELOWINDICATES BEARING CONCRETE WALL ABOVEINDICATES NON-BEARING CONCRETE WALL ABOVEINDICATES EXISTING NON-BEARING CONCRETE WALLINDICATES BEARING WOOD WALL BELOWINDICATES BEARING WOOD WALL ABOVEINDICATES PLYWOOD SIDE FOR SHEARWALLINDICATES NON-BEARING WOOD WALL BELOWINDICATES NON-BEARING WOOD WALL ABOVEINDICATES EXISTING BEARING WOOD WALL INDICATES EXISTING NON-BEARING WOOD WALL INDICATES EXISTING BEARING CONCRETE WALLKSIFOOTINGHEIGHTINCLUDEINFORMATIONINCLINFOJSTINSPINTJOINTJOISTKIPS IDI-JSTINIFHTINCHGRADE BEAMHORIZONTALGROUNDHIGH POINTH or HORIZHPGBGRNDFACE OF MASONARYFOOT; FEETFOMFJELEVATOREDGE NAILEMBEDMENTEXISTINGEXTERIOREACH WAYEQUAL OR EQUIVALENTEXIST or (E)FDNEWELEVESEQUIPEQSTRUCTURAL STEEL SHAPESWT, ST, MTMC AMERICAN STD CHANNEL SHAPEMISC CHANNEL SHAPETHRUTHKT & GT & BTOCTOTBSTRUCTSTIFFSTLSWTHREADEDTEMPERATURE; TEMPORARYSTIFFENERSSTEELSTANDARDAMERICAN WOOD PRESERVERS ASSOCIATIONCONSTRUCTION JOINT; CONTROL JOINTCOMPLETE JOINT PENETRATION WELDDIAPHRAGMDRAWINGDIAMETERDOWELEACH FACEELEVATIONEFELDWLEACHDIMDIAGCONTRACTORCONSTRUCTIONCUBIC FOOTPENNY (NAIL OR BAR DIA)CONNECTION; CONNECTCONCRETEDBLCU FTdDETAILCONSTRCONTRCJP CONTCONNCONCBEARINGCENTER OF GRAVITYCENTER TO CENTERCANTILEVERCAMBERCOMPRESSIONCOLUMNCONCRETE MASONRY UNITCLRCOMPCMUCJCLBTWNBLOCKINGBNBMBLOCKBLDGASTMAITCSPECSSNSPCGSHTGSEPPSIPVMT#PSLSHEATHINGSHEETSECTIONPARTIAL JOINT PENETRATION WELDREINFORCE; REINFORCINGPARALLEL STRAND LUMBERPAVEMENTREFERENCEREQUIREDPLATE WASHERPREFABRICATEDPLYWOODORIGINALODPI LPCOPPNO or #OC MIN(N)MFRPONDS PER LINEAL FOOTPROPERTY LINEPERPENDICULARADDLAPPROXIMATEARCHITECTURAL; ARCHITECTADJACENTARCHAPAAESSALUMALTADJANCHOR BOLTAMERICAN CONCRETE INSTITUTE ABLINEAL FOOTPOUND(S)LOW POINTLEVEL OR LAMINATED VENEER LUMBERMACHINE BOLTMASONRYMATERIALLINEAL; LINEARLONG SLOTTED HOLESLONG LEG VERTICALLFLT WTMASMAXMATLLVLLLVLLHAMERICAN PLYWOOD ASSOCIATION)KIPS PER SQUARE INCHFTGHORIZONTALLY SLOTTED HOLESHSHINSIDE DIAMETERINSIDE FACEI-JOISTINSPECTIONINTERIORJTKGALVANIZEDHANGERGLUED LAMINATED BEAMHGRGRGLB GALVGAGRADEGAUGEFACE OF CONCRETEFIELD NAILFLANGEFLOOR JOISTFRAMINGFACE OF WALLFACE OF STUDFTFRMGFOWFOSFNFOCFLGFLRFINFLOORFINISHENGINEEREACH SIDEEQUIPMENTFOUNDATIONEXTENGRENEMBEDTYPICALTYPPIPE-XPIPE-XXHSSCPIPE LWWWFWDWPW/OW/UNO VSH VERT UTDBL EXTRA STRONG PIPE SHAPEEXTRA STRONG PIPE SHAPEHOLLOW STRUCTURAL SECTIONSTANDARD PIPE SHAPESTRUCT TEE SHAPEANGLE SHAPEW SHAPEWELDED WIRE FABRICWORK POINT; WATERPROOFWOODWITHOUTWITHVERTICAL SLOTTED HOLESULTRA-SONIC TESTUNLESS NOTED OTHERWISEVERTICALTOP or TTHRTOWTOSTOFTEMPSTIRRSYM SSSSLSTGRSTDSQ TOP OF STEEL/TOP OF SLABTOP OF CURB; TOP OF CONCRETETHICKNESS/THICKTHROUGHTOP OF WALLTOPTOP OF FOOTINGTONGUE & GROOVETOP AND BOTTOMTOP OFTIE BEAMSYMMETRICALSHEAR WALLSTRUCTURALSTIRRUPSHORT SLOTTED HOLESSTAINLESS STEELSTAGGERSQUAREAWPAAMERICAN SOCIETY FOR TESTING MATERIALSAMERICAN INSTITUTE OF TIMBER CONSTRUCTIONDOUGLAS FIR/LARCHDFDIMENSIONDIAGONALELECTRICALEXPANSION JOINTDWGELECEJEADIAPHDN DOWNCENTERDEPARTMENTDOUBLECOUNTERSINK; COUNTERSUNKCONTINUE; CONTINUOUSCTRDEPTDETCTSKBETWEENCLEARANCE; CLEARCENTER LINECAST-IN-PLACECOLCIPBRGCAM OR CCANT CGCCBUILDINGBOUNDARY NAILBOTTOMAMERICAN WELDING SOCIETYBLKBOT OR BBRCBLKGBRACEBEAMAWSSOG SIMSCHEDRFØSHTSECTREINFREFREQDPREFABPLYPTPWPSFPJPPROPSPECIFICATIONSSLAB ON GRADESHEAR NAILSPACINGSIMILARROUND; DIAMETERROOFSEPARATIONSCHEDULEPOUNDS PER SQUARE INCHPOUNDS PER SQUARE FOOTPOUND; NUMBERPRESSURE TREATEDPROPERTYMECHANICALNEWNORTHON CENTERNOT TO SCALENUMBEROPENINGOPPOSITEOUTSIDE FACEORIENTED STRAND BOARDOPPOSITE HANDMINIMUM; MINUTEOUTSIDE DIAMETERMISCELLANEOUSMANUFACTURERPARA OR //PLF PLPLCSP OR PL.PERPOPNGOSBORIGOHOFNTSMECHMISCNPLYWOOD INDEXPRECAST; PIECEPLATEPLACESPARALLELARCHITECTURAL EXPOSED STRUCTURAL STEELAMERICAN NATIONAL STANDARDS INSTITUTEAMERICAN INSTITUTE OF STEEL CONSTRUCTIONADDITIONALANCHORALTERNATEALUMINUMAPPROVEDENGINEERED WOOD ASSOCIATION (FORMERLY THEANCHAPPROXAPPVDANSIAISCACILIGHTWEIGHTMAXIMUMLONG LEG HORIZONTALMBLPLSHLINLB(S) OR #DIA OR ØLAMINATED STRAND LUMBERLSLABOVE AND BELOWA & BRR ROOF RAFTERPOST ABOVEPAFLOOR TIE ABOVEFTAKING POSTKPWO WHERE OCCURSABOVEABVKING STUDKSTS TRIMMER STUDINDICATES CONTINUOUS FOOTING TYPE PER SCHEDULEC1SHEET INDEXWALL TYPESSYMBOLSABBREVIATIONSS-101 SHEET INDEX, ABBREVIATIONS, & SYMBOLSS-102 GENERAL NOTESS-103 GENERAL NOTESS-104 GENERAL NOTESS-105 SPECIAL INSPECTIONS & TESTSS-201 RESTROOM FOUNDATION & ROOF FRAMING PLANS-211 KIOSK FOUNDATION & ROOF FRAMING PLANS-221 CMU ELEVATIONSS-301 TYPICAL CONCRETE DETAILSS-302 TYPICAL CONCRETE DETAILSS-303 FPOUNDATION DETAILSS-401 TYPICAL MASONRY DETAILSS-402 TYPICAL MASONRY DETAILSS-403 TYPICAL MASONRY DETAILSS-404 TYPICAL STEEL DETAILSS-405 TYPICAL STEEL DETAILSS-406 TYPICAL STEEL DETAILSS-407 TYPICAL STEEL DETAILSS-411 STEEL DETAILSS-412 STEEL DETAILSDO DO OVERHEADERHDRF1XPage 207 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-1021. ALL WORK SHALL CONFORM TO THE MINIMUM STANDARDS OF THE FOLLOWING CODES AND STANDARDS:A. 2019 CALIFORNIA BUILDING CODE, PART 2, VOLUME 2 OF 2, AND TITLE 24 C.C.R. 2019 EDITION ANDLATEST REVISIONS (INCLUDING SUPPLEMENTS AND ERRATA) HEREIN REFERRED TO AS “THE CODE”.B. ANY OTHER REGULATING AGENCIES WHICH HAVE AUTHORITY OVER ANY PORTION OF THE WORK,INCLUDING THE STATE OF CALIFORNIA DIVISION OF OCCUPATIONAL SAFETY AND HEALTH (CAL/OSHA).C. CODES & STANDARDS REFERENCED IN THE CODE OR LISTED IN THESE NOTES AND SPECIFICATIONS.2. ALL DRAWINGS ARE CONSIDERED TO BE A PART OF THE CONTRACT DOCUMENTS. THE CONTRACTOR SHALLBE RESPONSIBLE FOR THE REVIEW AND COORDINATION OF ALL DRAWINGS AND SPECIFICATIONS PRIOR TOTHE START OF CONSTRUCTION. ANY DISCREPANCIES THAT OCCUR SHALL BE BROUGHT TO THE ATTENTION OFTHE ARCHITECT PRIOR TO START OF CONSTRUCTION SO THAT A CLARIFICATION CAN BE ISSUED. ANY WORKPERFORMED IN CONFLICT WITH THE CONTRACT DOCUMENTS OR ANY CODE REQUIREMENTS SHALL BECORRECTED BY THE CONTRACTOR AT THEIR OWN EXPENSE AND AT NO EXPENSE TO THE OWNER ORARCHITECT.3. NOTES AND DETAILS ON DRAWINGS SHALL TAKE PRECEDENCE OVER GENERAL NOTES AND TYPICAL DETAILS.WHERE NO DETAILS ARE GIVEN, CONSTRUCTION SHALL BE AS SHOWN FOR SIMILAR WORK.4. THE CONTRACTOR SHALL VERIFY ALL DIMENSIONS PRIOR TO STARTING CONSTRUCTION. THE ARCHITECT SHALLBE NOTIFIED OF ANY DISCREPANCIES OR INCONSISTENCIES. IN NO INSTANCE SHALL DIMENSIONS BE SCALEDFROM THE DRAWINGS.5. SEE ARCHITECTURAL DRAWINGS FOR THE FOLLOWING:A. SIZE AND LOCATION OF ALL DOOR AND WINDOW OPENINGS, EXCEPT AS NOTEDB. SIZE AND LOCATION OF ALL INTERIOR AND EXTERIOR NON-BEARING PARTITIONS UNLESSNOTED AND/OR DETAILED ON THE STRUCTURAL DRAWINGSC. SIZE AND LOCATION OF ALL CONCRETE CURBS, EQUIPMENT PADS, PITS, FLOOR DRAINS,SLOPES, DEPRESSED AREAS, CHANGE IN LEVEL, CHAMFERS, GROOVES, INSERTS, ETCD. SIZE AND LOCATION OF ALL FLOOR AND ROOF OPENINGS EXCEPT AS SHOWNE. FLOOR AND ROOF FINISHESF. MISCELLANEOUS DRAINAGE AND WATERPROOFINGG. ALL FIREPROOFING REQUIREMENTS INCLUDING FIREPROOFING OF STRUCTURAL STEELH. DIMENSIONS NOT SHOWN ON STRUCTURAL DRAWINGS6. SEE MECHANICAL, PLUMBING AND ELECTRICAL DRAWINGS FOR THE FOLLOWING:A. PIPE RUNS, SLEEVES, HANGERS, TRENCHES, WALL AND SLAB OPENINGS, ETC.,EXCEPT AS SHOWN OR NOTED.B. ELECTRICAL CONDUIT RUNS, BOXES, OUTLETS IN WALLS AND SLABS.C. CONCRETE INSERTS FOR ELECTRICAL, MECHANICAL OR PLUMBING FIXTURES.D. SIZE AND LOCATION OF MACHINE OR EQUIPMENT BASES, ANCHOR BOLTS FORMOTOR MOUNTS.7. SEE CIVIL DRAWINGS FOR THE FOLLOWING:A. HEIGHT AND/OR ELEVATION OF:a. FINISHED SURFACEb. TOP OF WALLc. TOP OF GRADEd. FINISHED GRADEe. SLOPEB. SITE CONCRETE WALKWAYS, CURBS & PAVING8. THE CONTRACT STRUCTURAL DRAWINGS AND SPECIFICATIONS REPRESENT THE FINISHED STRUCTURE. THEY DONOT INDICATE THE METHOD OF CONSTRUCTION. THE CONTRACTOR SHALL PROVIDE ALL MEASURESNECESSARY TO PROTECT THE STRUCTURE DURING CONSTRUCTION. SUCH MEASURES SHALL INCLUDE, BUTNOT BE LIMITED TO, BRACING, SHORING FOR LOADS DUE TO CONSTRUCTION EQUIPMENT ETC. THECONTRACTOR IS RESPONSIBLE FOR PROVISION OF TEMPORARY SHORING AND OTHER CONSTRUCTION AIDS,INCLUDING ALL ENGINEERING OF SUCH SYSTEMS, FOR TEMPORARY SUPPORT OF NEW AND/OR EXISTINGSTRUCTURAL ELEMENTS AS REQUIRED FOR ERECTION AND OTHER CONTRACTOR'S MEANS AND METHODS OFCONSTRUCTION (UNO). OBSERVATION VISITS TO THE SITE BY THE STRUCTURAL ENGINEER SHALL NOT INCLUDEINSPECTION OF THE ABOVE ITEMS OR CONCERN CONSTRUCTION MEANS AND METHODS OR CONSTRUCTIONSAFETY.9. BACKFILL SHALL NOT BE PLACED BEHIND EXTERIOR AND INTERIOR RETAINING WALLS UNTIL THE CONCRETE /CMU HAS ACHIEVED FULL DESIGN STRENGTH. FOR BRACED WALLS SUPPORTED BY STRUCTURAL DIAPHRAGMS.BACKFILL SHALL NOT BE PLACED BEHIND THE WALL UNTIL THE DIAPHRAGM HAS BEEN INSTALLED , AND FORCONCRETE DIAPHRAGMS, HAS ACHIEVED FULL DESIGN STRENGTH.10. THE CONTRACT STRUCTURAL DRAWINGS SHOW THE BUILDING IN ITS FINAL INTENDED POSITION. CONTRACTORSHALL MAKE PROVISIONS IN THE LAYOUT OF THE BUILDING TO TAKE INTO ACCOUNTS SHRINKAGE, CREEP,SHORTENING, ETC..11. OPENINGS, POCKETS, ETC., LARGER THAN 6" SHALL NOT BE PLACED IN CONCRETE SLABS, DECKS, WALLS,UNLESS SPECIALLY DETAILED ON THE STRUCTURAL DRAWINGS. NOTIFY THE STRUCTURAL ENGINEER WHENDRAWINGS BY OTHERS SHOW OPENINGS, POCKETS, ETC., LARGER THAN 6" NOT SHOWN ON THE STRUCTURALDRAWINGS, BUT WHICH ARE LOCATED IN STRUCTURAL MEMBERS.12. ASTM SPECIFICATIONS ON THE DRAWINGS SHALL BE THE VERSION REFERENCED IN CHAPTER 35 OF THE CODEOR AS REFERENCED IN THE APPLICABLE DESIGN STANDARD.13. CONTRACTOR SHALL INVESTIGATE SITE DURING CLEARING AND EARTHWORK OPERATIONS FOR FILLEDEXCAVATIONS OR BURIED STRUCTURES, SUCH AS CESSPOOLS, CISTERNS, FOUNDATIONS, ETC. IF ANY SUCHSTRUCTURES ARE FOUND, THE STRUCTURAL ENGINEER AND GEOTECHNICAL ENGINEER SHALL BE NOTIFIEDIMMEDIATELY.14. CONSTRUCTION MATERIAL SHALL BE SPREAD OUT IF PLACED ON FRAMED ROOF OR FLOOR. LOAD SHALL NOTEXCEED THE DESIGN LIVE LOAD PER SQUARE FOOT. THE CONTRACTOR TO DESIGN AND PROVIDE ADEQUATESHORING AND/OR BRACING WHERE STRUCTURE HAS NOT ATTAINED DESIGN STRENGTH.15. CONTRACTOR SHALL COORDINATE SHORING WITH DRAWINGS OF RECORD TO INSURE PROVISIONS FORPOCKETS, BLOCKOUTS, OFFSETS, STEPPED FOOTINGS AND ANY OTHER ITEMS AFFECTED BY THE SHORING16. AN UNDERGROUND SERVICE ALERT INQUIRY IDENTIFICATION NUMBER MUST BE OBTAINED AT LEAST TWOWORKING DAYS BEFORE STARTING WORK WITH THIS PERMIT.A. FOR PROJECTS IN SOUTHERN CALIFORNIA TELEPHONE NO. 1-800-422-4133.B. FOR PROJECTS IN NORTHERN CALIFORNIA TELEPHONE NO. 1-800-227-2600.17. EDGE OF SLAB DIMENSIONS TO BE COORDINATED AND VERIFIED BY THE GENERAL CONTRACTOR PRIOR TOFABRICATION.GENERAL1. FLOOR LIVE LOADS: (2019 CBC SECTION 1603.1.1)2. ROOF LIVE LOADS (2019 CBC SECTION 1603.1.2)3. ROOF SNOW LOADS (2019 CBC SECTION 1603.1.3):4. WIND DESIGN DATA (2019 CBC SECTION 1603.1.4) :5. EARTHQUAKE DESIGN DATA (2019 CBC SECTION 1603.1.5):6. GEOTECHNICAL INFORMATION (2019 CBC SECTION 1603.1.6):REFER TO FOUNDATION GENERAL NOTES7. FLOOD DESIGN DATA: (2019 CBC SECTION 1603.1.7)THIS PROJECT IS NOT IN A FLOOD PLAINSITE AND OCCUPANCY PARAMETERSPARAMETERVALUEREFERENCERISK CATEGORY II 2019 CBC TABLE 1604.5SEISMIC IMPORTANCE FACTOR I = 1.0 ASCE 7-16 TABLE 1.5-2MAPPED SPECTRAL RESPONSE ACCELERATIONS: S S = 1.059g2019 CBC 1613.2.1 S 1 = 0.39gSITE CLASS D 2019 CBC 1613.2.2SPECTRAL RESPONSE COEFFICIENTS: S DS = 0.847g2019 CBC 1613.2.4 S D1 =COMPONENTS & CLADDING WIND PRESSURES (PSF)LOCATIONCOMPONENT TRIBUTARY AREA (SQ FT)10 100 500ROOFZONE 1 -1.8 -0.8 -0.8ZONE 2e -1.8 -0.8 -0.8ZONE 2n -2.0 -1.2 -1.0ZONE 2r -1.8 -0.8 -0.8ZONE 3e -2.5-1.5-1.0ZONE 3r -2.0 -1.2 -1.0ALL ZONES 0.9 0.5 0.5OVERHANGZONE 1 -2.6 -1.6 -1.6ZONE 2e -2.6 -1.6 -1.6ZONE 2n -2.8 -2.0 -1.8ZONE 2r -2.6 -1.6 -1.6ZONE 3e -3.3 -2.3 -1.8ZONE 3r -2.8 -2.0 -1.8WALLZONE 4 -24.9 -21.6 -19.0ZONE 5 -30.7 -23.9 -19.0POSITIVE 22.9 19.017.1BUILDING PARAMETERSPARAMETERVALUEREFERENCESEISMIC DESIGN CATEGORY SDC = D 2019 CBC 1613.2.5BASIC SEISMIC FORCE RESISTING SYSTEMSPECIAL REINFORCED MASONRYSHEAR WALLS RESTROOM KIOSKASCE 7-16 TABLE12.2-1RESPONSE MODIFICATION FACTORR = 2 1.25SYSTEM OVERSTRENGTH FACTORΩo = 2 12 1.25DEFLECTION AMPLIFICATION FACTORCd = 1 34 1.25DESIGN BASE SHEAR V = 20.8k 4.62k ASCE 7-16 12.8.1SEISMIC RESPONSE COEFFICIENTS Cs = 0.380 0.608 ASCE 7-16 12.8.1.1ANALYSIS PROCEDURE USEDEQUIVALENT LATERAL FORCEPROCEDUREASCE 7-16 12.8FLOOR LIVE LOADSOCCUPANCY OR USEUNIFORM(PSF)CONC.(LBS)REFERENCETOILET ROOMS60___ASCE 7-16 TABLEC4.3-1ROOF LIVE LOADSOCCUPANCY OR USEUNIFORM(PSF)CONC.(LBS)REFERENCEROOF ORDINARY FLAT, PITCHED AND CURVED ROOFS (THAT ARE NOT OCCUPIABLE)20___2019 CBC TABLE1607.1SNOW DESIGN DATAPARAMETERVALUEREFERENCEGROUND SNOW LOADPg = 0 PSFASCE 7-16 7.2WIND DESIGN DATAPARAMETERVALUEREFERENCEULTIMATE DESIGN WIND SPEED (3-SEC GUST)VULT = 90 MPH2019 CBC FIG. 1609.3NOMINAL DESIGN WIND SPEED (3-SEC GUST)VASD = 70 MPH2019 CBC 1609.3.1EXPOSURE CATEGORY C 2019 CBC 1609.4.3INTERNAL PRESSURE COEFFICIENT:GCpi = ± 0.18ASCE 7-16 TABLE 26.13-1DESIGN INFORMATION1. GEOTECHNICAL INFORMATION AND FOUNDATION DESIGN IS BASED ON THE FOLLOWING GEOTECHNICALREPORTS AND SUPPLEMENTS/ADDENDUMS. COPIES OF THE REPORTS AND SUPPLEMENTAL LETTERS SHALL BEAVAILABLE AT THE JOBSITE AT ALL TIMES.2. SPREAD OR CONTINUOUS FOOTINGS:NOTES:A. THE ALLOWABLE CAPACITY MAY BE INCREASED BY ONE-THIRD WHEN CONSIDERING LOADS OF SHORTDURATION SUCH AS WIND OR SEISMIC FORCES.B. THE ALLOWABLE LATERAL RESISTANCE CAN BE TAKEN AS THE SUM OF THE FRICTIONAL RESISTANCE ANDPASSIVE RESISTANCE WITH THE LESSER REDUCED BY 33 PERCENT.C. THE UPPER 0 FOOT OF SOIL NOT PROTECTED BY PAVEMENT SHALL BE NEGLECTED WHEN CALCULATINGPASSIVE RESISTANCE.D. COMPACTED FILL SHOULD BE PREPARED PER SECTION 6.0 GEOTECHNICAL EVALUATION REPORT4. SLAB ON GRADE SUPPORT SHALL BE PER THE GEOTECHNICAL INVESTIGATION REPORT AND TYPICAL DETAILS INTHE CONSTRUCTION DOCUMENTS.5. WHERE NOT SHOWN ON THE DRAWINGS, CONTRACTOR TO PROVIDE FOR DESIGN AND INSTALLATION OF ALLCRIBBING, SHEATHING AND SHORING REQUIRED AND SHALL BE SOLELY RESPONSIBLE FOR ALL EXCAVATIONPROCEDURES INCLUDING LAGGING, SHORING, AND PROTECTION OF ADJACENT PROPERTY, STRUCTURES,STREETS, AND UTILITIES IN ACCORDANCE WITH ALL NATIONAL, STATE AND LOCAL SAFETY ORDINANCES.6. CONTRACTOR TO PROVIDE FOR DE-WATERING OF EXCAVATIONS FROM SURFACE WATER, GROUND WATERAND/OR SEEPAGE.7. EXCAVATION FOR FOOTINGS SHALL BE APPROVED BY THE INSPECTOR OR GEOTECHNICAL ENGINEER PRIORTO PLACING CONCRETE AND REINFORCING.8. ALL EXCAVATIONS SHALL BE PROPERLY BACKFILLED. DO NOT PLACE BACKFILL BEHIND RETAINING WALLSBEFORE CONCRETE OR GROUT HAS ATTAINED FULL DESIGN STRENGTH. CONTRACTOR SHALL BRACE ORPROTECT ALL BUILDING AND PIT WALLS BELOW GRADE FROM LATERAL LOADS UNTIL ATTACHING FLOORS ARECOMPLETELY IN PLACE AND HAVE ATTAINED FULL DESIGN STRENGTH. CONTRACTOR SHALL PROVIDE FORDESIGN, PERMITS AND INSTALLATION OF SUCH BRACING.9. EXCAVATIONS SHALL BE CUT SQUARE AND SMOOTH, WITH LEVEL BOTTOMS.10. FOOTING BACKFILL AND UTILITY TRENCH BACKFILL WITHIN BUILDING AREA SHALL BE MECHANICALLYCOMPACTED IN LAYERS IN ACCORDANCE WITH THE GEOTECHNICAL INVESTIGATION REPORT ANDAPPROVED BY THE GEOTECHNICAL ENGINEER. FLOODING WILL NOT BE PERMITTED. ALL FILLS USED TOSUPPORT FOUNDATIONS SHALL BE INSPECTED BY THE GEOTECHNICAL ENGINEER REPRESENTATIVE PERSECTION 1705.6 OF THE CODE.11. ALL ABANDONED FOOTINGS, UTILITIES, ETC. SHALL BE REMOVED. NEW FOOTINGS MUST EXTEND INTOUNDISTURBED SOILS.ELEMENTALLOWABLEBEARINGCAPACITY(PSF) AALLOWABLE LATERAL RESISTANCE BPASSIVERESISTANCE(PSF/FT BELOWGRADE)FRICTIONRESISTANCE(COEFFICIENT OFFRICTION)BUILDINGFOUNDATION2,000350150 (2:1 SLOPING DOWN)0.35RET WALL1,500REPORT/ADDENDUM TITLEPREPARED BY DATE PROJECT #GEOTECHNICAL ENGINEERING REPORTMISSION PLAZA RESTROOM AND CAFESAN LUIS OBISPO MISSION PLAZASAN LUIS OBISPO, CALIFORNIAEARTH SYSTEMS PACIFIC4378 OLD SANTA FEROAD SAN LUIS OBISPO,CA 93401OCTOBER 21, 2022305341-001FOUNDATION1. DIMENSIONS SHALL BE DEFINED TO INCLUDE BOTH HORIZONTAL DIMENSIONS AND VERTICAL DIMENSIONS(ELEVATIONS).2. WRITTEN DIMENSIONS SHALL TAKE PRECEDENCE OVER SCALED DRAWINGS.3. SEE ARCHITECTURAL DRAWINGS FOR DIMENSION NOT NOTED ON STRUCTURAL DRAWINGS.4. SEE ARCHITECTURAL AND/OR CIVIL DRAWINGS FOR FINISH FLOOR ELEVATIONS.5. SEE ARCHITECTURAL DRAWINGS FOR ALL TOP OF SHEATHING AND/OR ROOF ELEVATIONS.6. THE CONTRACTOR SHALL REVIEW AND VERIFY ALL DIMENSIONS PRIOR TO STARTING CONSTRUCTION. THEARCHITECT SHALL BE NOTIFIED IMMEDIATELY OF ANY DISCREPANCIES OR INCONSISTENCIES.DIMENSIONSEXISTING CONDITIONS1. ALL INFORMATION SHOWN ON THE PLANS RELATIVE TO EXISTING CONDITIONS IS GIVEN AS THE BEST PRESENTKNOWLEDGE FROM PLANS SUPPLIED BY THE OWNER, BUT WITHOUT GUARANTEE OF ACCURACY.2. WHERE ACTUAL CONDITIONS ARE NOT IN ACCORDANCE WITH THE INFORMATION PRESENTED, THE ARCHITECTAND/OR STRUCTURAL ENGINEER SHALL BE NOTIFIED IMMEDIATELY. NO MODIFICATIONS OF THE PLANS FORNEW CONSTRUCTION SHALL BE MADE WITHOUT THE WRITTEN APPROVAL OF THE ARCHITECT.EXISTING UNDERGROUND UTILITIES1. THE ARCHITECT AND ENGINEERS ARE NOT RESPONSIBLE FOR THE LOCATIONS OF EXISTING UNDERGROUNDUTILITIES WHETHER OR NOT SHOWN ON THE DRAWINGS. DRAWINGS, IF ANY, IS APPROXIMATE. THECONTRACTOR SHALL EXERCISE EXTREME CAUTION IN EXCAVATING AND TRENCHING ON THE SITE. THECONTRACTOR SHALL IMMEDIATELY NOTIFY THE ARCHITECT AND/OR STRUCTURAL ENGINEER SHOULD ANYSUCH UNIDENTIFIED CONDITIONS BE DISCOVERED.2. THE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY DAMAGES WHICH MAY RESULT FROM HIS FAILURE TOEXACTLY LOCATE AND PRESERVE ALL EXISTING UNDERGROUND UTILITIES.3. AN UNDERGROUND SERVICE ALERT INQUIRY IDENTIFICATION NUMBER MUST BE OBTAINED AT LEAST TWOWORKING DAYS BEFORE STARTING WORK WITH THIS PERMIT.A. FOR PROJECTS IN SOUTHERN CALIFORNIA TELEPHONE NO. 1-800-422-4133.B. FOR PROJECTS IN NORTHERN CALIFORNIA TELEPHONE NO. 1-800-227-2600.MATERIALASTM STANDARDPORTLAND CEMENT (TYPE II)AC150CONCRETE AGGREGATES (HARDROCK)C33CONCRETE AGGREGATES (LIGHTWEIGHT)CC330WATERBC1602COAL FLY ASH OR POZOLLAN (CLASS F)C618NATURAL OR MANUFACTURED SAND C33SLAGC989CONCRETELOCATION IN STRUCTUREMINIMUM STRENGTH(PSI)DENSITY (PCF)MAX SLUMP(IN±1)MAXWATER/CEMENTRATIOSLAG/FLY ASHA(MAX)CONCRETEFOUNDATIONS, GRADEBEAMS, TIE BEAMS4,00015040.5 0.15CONCRETE BASEMENTWALLS/STEM WALLS4,00015040.5 0.15CONCRETE SLAB ONGRADE3,00015040.45 0.15STAIRS ON GRADE, CURBSAND OTHER NON-STRUCTURAL CONCRETE3,00015040.5 0.15SITE WALLS3,00015040.5 0.151. ALL CONCRETE CONSTRUCTION SHALL CONFORM WITH CHAPTER 19 OF THE CODE AND WITH THEPROVISIONS OF ACI 318-14.2. CONCRETE MATERIALS SHALL BE IN ACCORDANCE WITH THE FOLLOWING STANDARDS:A. FOR SOILS WITH HIGH CONCENTRATIONS OF SULFATES (EXPOSURES S2 OR S3 PER ACI 318-14 TABLE19.3.2.1) PORTLAND CEMENT SHALL BE TYPE V. VERIFY WITH PROJECT GEOTECHNICAL REPORT.B. WATER SHOULD ONLY BE ADDED AT THE BATCH PLANT. IN NO CASE SHALL THE DESIGN WATER/ CEMENTRATIO BE EXCEEDED.C. PUMICE AGGREGATE SHALL NOT BE USED.3. CONCRETE MIXES SHALL BE PROPORTIONED BASED ON SECTION 26.4.3 OF ACI 318-14, WHICH REFERENCESACI 301-10 ARTICLE 4.2.3. MIX DESIGNS SHALL INCLUDE DOCUMENTATION OF MIX AVERAGE COMPRESSIVESTRENGTH THROUGH FIELD TEST DATA OR TRAIL MIXTURES IN ACCORDANCE WITH ACI 301-10 ARTICLE 4.2.3.4.SCHEDULE OF STRUCTURAL CONCRETE STRENGTHS AND LOCATIONS (UNO):A. AS MEASURED BY CEMENTITIOUS WEIGHT4. READY MIXED CONCRETE SHALL BE MIXED AND DELIVERED IN ACCORDANCE WITH THE REQUIREMENTS OFASTM C94 OF C685.5. DEPOSITING AND CONVEYING OF CONCRETE SHALL CONFORM TO SECTION 26.5 OF ACI 318-14 ANDPROJECT SPECIFICATIONS.6. ALL CONCRETE SURFACES AGAINST WHICH NEW CONCRETE IS TO BE PLACED SHALL BE CLEANED ANDROUGHENED TO 1/4" AMPLITUDE.7. ALL REINFORCING BARS, ANCHOR BOLTS AND OTHER CONCRETE INSERTS SHALL BE WELL SECURED INPOSITION PRIOR TO PLACING CONCRETE.8. PROVIDE SLEEVES FOR PLUMBING AND ELECTRICAL OPENINGS IN CONCRETE BEFORE PLACING. DO NOT CUTANY REINFORCING WHICH MAY CONFLICT. CORING IN CONCRETE IS NOT PERMITTED WITHOUT SEORAPPROVAL. NOTIFY THE SEOR IN ADVANCE OF CONDITIONS NOT SHOWN ON THE DRAWINGS. SEE THEDRAWINGS FOR ADDITIONAL RESTRICTIONS ON THE PLACEMENT OF OPENINGS IN SLABS AND WALLS.9. PIPES EMBEDDED IN CONCRETE:A. CONCRETEa. PIPES LARGER THAN 1-1/2" DIAMETER SHALL NOTE BE EMBEDDED IN STRUCTURAL CONCRETEEXCEPT WHERE SPECIFICALLY APPROVED BY SEOR.b. NO CONDUITS SHALL BE PLACED IN CONCRETE FILL OVER METAL DECK.c. PIPES SHALL NOT DISPLACE OR INTERRUPT REINFORCING BARS.d. DO NOT STACK CONDUITS, SPACE EMBEDDED PIPES AND CONDUITS AT A MINIMUM OF 3DIAMETERS CLEAR FROM OTHER EMBEDDED PIPES/CONDUITS AND REBAR.1. REINFORCING BARS SHALL CONFORM TO THE REQUIREMENTS OF CHAPTER 19 OF THE CODE AND WITH THEPROVISIONS OF ACI 318-14, ASTM A706, GRADE 60 UNO. ASTM A615 GR 60 STEEL MAY BE SUBSTITUTED FORASTM A706 GR60 STEEL PER ACI 318-14 SECTION 20.2.2.5 PROVIDED THE FOLLOWING CONDITIONS ARE MET:A. THE ACTUAL YIELD STRENGTH BASED ON MILL TESTS DOES NOT EXCEED THE SPECIFIED YIELD STRENGTH BYMORE THAN 18,000 PSI.B. THE RATIO OF THE ACTUAL ULTIMATE TENSILE STRESS TO THE ACTUAL YIELD STRENGTH IS NOT LESS THAN1.25.C. WHERE REINFORCEMENT COMPLYING WITH ASTM A615 IS TO BE WELDED, CHEMICAL TESTS SHALL BEPERFORMED TO DETERMINE WELDABILITY IN ACCORDANCE WITH SECTION 26.6.4 OF ACI 318-14.2. BARS SHALL BE CLEAN OF RUST, GREASE, OR OTHER MATERIALS LIKELY TO IMPAIR BOND. ALL REINFORCINGBAR BENDS SHALL BE MADE COLD.3. WELDED WIRE REINFORCEMENT (WWR), PLAIN OR DEFORMED, SHALL CONFORM TO ASTM A185. WELDEDDEFORMED WIRE REINFORCEMENT (WWR) SHALL CONFORM TO ASTM A1064. ALL WWR FOR STAIR PANS ANDALL WWR FOR CONCRETE FILL ON METAL DECK TO BE PLAIN WWR. PROVIDE LAPS PER ACI 318-14 SECTION25.5.3 OR 25.5.4 MINIMUM. WWR SHALL BE SUPPORTED ON APPROVED CHAIRS.4. REINFORCING BAR LAP SPLICES SHALL BE MADE AS INDICATED ON THE DRAWINGS. LAP ALL HORIZONTALBARS AT CORNERS AND INTERSECTIONS. STAGGER ALL SPLICES UNLESS NOTED OTHERWISE ON PLANS.A. MINIMUM LAP SPLICE LENGTH FOR REINFORCING STEEL BARS IN CONCRETE SHALL BE PER ACI 318-14SECTION 25.5.2 AND THE REINFORCING SCHEDULE ON THE DRAWINGS.B. MINIMUM LAP SPLICE LENGTH FOR REINFORCING STEEL BARS IN MASONRY SHALL BE PER ACI 530-13SECTION 8.1.6.7.1 OR 9.3.3.4 AND THE REINFORCING SCHEDULE ON THE DRAWINGS.5. ALL BARS SHALL BE MARKED SO THEIR IDENTIFICATION CAN BE MADE WHEN THE FINAL IN-PLACE INSPECTION ISMADE. ALL REINFORCING CONFORMING TO DIFFERING ASTM SPECIFICATIONS AND/OR OF DIFFERINGGRADES SHALL BE CLEARLY MARKED TO DIFFERENTIATE THEM FROM OTHER REINFORCING STEEL IFCONCURRENTLY PRESENT ON SITE.6. WHERE WELDING OF REINFORCING IS APPROVED BY THE STRUCTURAL ENGINEER, IT SHALL BE DONE BY AWSCERTIFIED WELDERS USING E80XX OR APPROVED ELECTRODES. WELDING PROCEDURES SHALL CONFORM TOTHE REQUIREMENTS OF STRUCTURAL WELDING CODE- REINFORCING STEEL", AWS-D1.4-15. REINFORCING BARSTO BE WELDED SHALL CONFORM TO THE REQUIREMENTS OF ASTM A706.7. REINFORCING STEEL SHALL BE ACCURATELY PLACED AND ADEQUATELY SUPPORTED BEFORE THE CONCRETE ISPLACED AND SHALL BE SECURED AGAINST DISPLACEMENT DURING CONSTRUCTION WITHIN PERMITTEDTOLERANCES. ADEQUATE SUPPORTS ARE ALSO NECESSARY TO KEEP THE REINFORCING STEEL AT THE PROPERDISTANCE FROM THE FORMS. USE WIRE BAR SUPPORTS, PRECAST CONCRETE SUPPORTS, SPACERS, BOLSTERS,REINFORCEMENT OR OTHER MEANS OF SUPPORT PER THE "CRSI MANUAL OF STANDARD PRACTICE", LATESTEDITION.8. REINFORCING STEEL SHALL BE DETAILED IN ACCORDANCE WITH THE "CRSI MANUAL OF STANDARD PRACTICEFOR DETAILING REINFORCED CONCRETE STRUCTURES", LATEST EDITION.9. COMPLETE AND DETAILED REINFORCING PLACEMENT DRAWINGS SHALL BE PREPARED AND SUBMITTED TO THEARCHITECT FOR APPROVAL BY THE SEOR PRIOR TO FABRICATION IN ACCORDANCE WITH THE SPECIFICATIONSAND APPLICABLE CODES. THESE DRAWINGS SHALL BE AVAILABLE ON THE JOB SITE PRIOR TO PLACING OFCONCRETE. THE REINFORCING PLACEMENT DRAWINGS SHALL INCLUDE ALL PRIMARY REINFOREMENT, LAPSPLICES, TIES, DOWELS, HEADED U-DOWELS, EMBED PLATES, ANCHOR BOLTS, ETC. AREAS OF CONGESTIONSHALL BE DETAILED SUFFICIENTLY TO DEMONSTRATE THAT PLACEMENT OF REBAR MEETS SPACINGREQUIREMENTS OF ACI 318-14.10. MILL TEST REPORTS FOR GRADE 60 BARS SHALL BE SUBMITTED TO THE INSPECTOR OF RECORD PRIOR TOPLACEMENT OF CONCRETE PER ACI 318-14 SECTION 26.13.2.3 OF THE CODE.11. WHEN REQ'D, INSPECTION OF CONCRETE SHALL INCLUDE INSPECTION DURING INSTALLATION OFREINFORCING STEEL. INSPECTION SHALL BE SCHEDULED SO THAT PLACEMENT OF REINFORCING STEEL,CONDUIT, SLEEVES, AND EMBEDDED ITEMS MAY BE CORRECTED PRIOR TO PLACEMENT OF OVERLYING GRIDSOR REINFORCING STEEL.12. CONCRETE PROTECTION FOR REINFORCEMENT13. MECHANICAL BAR SPLICE CONNECTIONS SHALL CONFORM TO THE REQUIREMENTS OF ACI 318-14 SECTION25.5.7 USE OF MECHANICAL CONNECTIONS SHALL BE APPROVED BY THE STRUCTURAL ENGINEER. SPLICESMUST BE TESTED AS INDICATED IN THE CONCRETE REINFORCEMENT SPECIFICATION. ACCEPTABLE PRODUCTSINCLUDE:LENTON STANDARD COUPLERS (IAPMO-ES 0129)LENTON FORM SAVERS, TYPE SA (IAPMO-ES 0129)LENTON WELDABLE HALF COUPLERS (IAPMO-ES 0129)LENTON LOCK COUPLERS PER (IAPMO-ES 0129)NOTE THAT REBAR ATTACHED TO PLATE USING LENTON WELDABLE HALF COUPLERS SHALLBE ASTM A706 PER IAPMO-ES 0129.ALL MECHANICAL BAR SPLICE CONNECTIONS IN SPECIAL STRUCTURAL WALLS, SPECIAL MOMENT FRAMESAND CONCRETE DIAPHRAGMS SHALL BE TYPE 2 CONFORMING TO THE REQUIREMENTS OF ACI 318-14SECTION 18.2.7 & 18.12.7.4THE FOLLOWING MINIMUM CONCRETE COVER SHALL BEPROVIDED FORREINFORCEMENT IN CAST-IN-PLACE CONCRETE(NON-PRESTRESSED):MINIMUM COVER,IN.A. CONCRETE CAST AGAINST AND PERMANENTLYEXPOSED TO EARTH3B. CONCRETE EXPOSED TO EARTH OR WEATHER: NO.6 THROUGH NO. 18 BAR NO.5 BAR, W31 OR D31 WIRE & SMALLER21 12"C. CONCRETE NOT EXPOSED TO WEATHER OR INCONTACT WITH GROUND: SLABS, WALLS, JOISTS: NO.14 AND NO.18 BARS NO.11 BAR & SMALLER BEAMS, COLUMNS: PRIMARY REINFORCEMENT TIES, STIRRUPS,SPIRALS1 12"34"1 12"REINFORCING STEEL111Page 208 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-1031. MASONRY CONSTRUCTION AND MATERIALS SHALL CONFORM TO THE REQUIREMENTS OF "SPECIFICATION FORMASONRY STRUCTURES" (TMS 402-16) PUBLISHED BY THE MASONRY SOCIETY AND WITH CHAPTER 21 OF THECODE.2. CONCRETE MASONRY UNITS SHALL COMPLY WITH SECTION 2103.1 OF THE CODE AND BE HOLLOW LOADBEARING CONFORMING TO ASTM C90 AND MEET THE FOLLOWING REQUIREMENTS:3. MORTAR SHALL CONFORM TO SECTION 2103.2 OF THE CODE AND ASTM C270 AND HAVE THE FOLLOWING PROPERTIES AND STRENGTHS: SEE NOTES UNDER "TEST AND INSPECTION REQUIREMENTS" FOR TESTING REQUIREMENTS.4. GROUT SHALL COMPLY WITH SECTION 2103.3 OF THE CODE AND ASTM C476. GROUT SHALL MEET THEFOLLOWING REQUIREMENTS:SEE NOTES UNDER "TEST AND INSPECTION REQUIREMENTS" FOR TESTING REQUIREMENTS.5. MORTAR AND GROUT COMPONENTS SHALL CONFORM WITH THE FOLLOWING:6. ADMIXTURES SHALL NOT BE USED IN GROUT EXCEPT BY SPECIFIC CONSENT OF SEOR. SEE NOTES UNDER "TEST AND INSPECTION REQUIREMENTS" FOR TESTING REQUIREMENTS.7. REINFORCING BARS - SEE NOTES UNDER "REINFORCING STEEL" FOR REQUIREMENTS.8. PROVIDE A MINIMUM OF 1/2" CLEAR BETWEEN MAIN REINFORCING AND MASONRY UNITS.9. ALL CELLS SHALL BE GROUTED SOLID.10. DESIGN f'm = 2,000 PSI FOR CMU CONSTRUCTION, TYPICAL. PRISM TESTING SHALL BE PERFORMED AS PER THEREQUIREMENTS OF PROJECT SPECIFICATIONS. SEE ALSO NOTES UNDER "TEST AND INSPECTION REQUIREMENTS"FOR REQUIREMENTS.11. USE RUNNING BOND PATTERN UNO BY ARCHITECT. USE OPEN ENDED UNITS FOR STACKED BOND PATTERN.12. USE OF "HIGH-LIFT" GROUT CONSTRUCTION IS SUBJECT TO APPROVAL BY SEOR AND JURISDICTION. MAXGROUT LIFT HEIGHT SHALL BE 5'-4" IN ACCORDANCE WITH TMS 602-16 ARTICLE 3.5D. GROUT LIFT HEIGHT MAYBE INCREASED TO 12'-8" IF THE FOLLOWING CONDITIONS ARE MET:A. MASONRY HAS CURED FOR AT LEAST 4 HOURSB. GROUT SLUMP IS MAINTAINED BETWEEEN 10" - 11"C. NO BOND BEAMS OCCUR BETWEEN TOP AND BOTTOM OF POUR HEIGHTD. CLEANOUTS ARE PROVIDED AT 32" MAX OC FOR CLEANING AND INSPECTION PRIOR TO GROUTINGPER TMS 602-16 ARTICLE 3.2F.13. CONSOLIDATE GROUT AT TIME OF PLACEMENT USING MECHANICAL VIBRATION OR USE A SELFCONSOLIDATING GROUT14. EMBEDDED PIPES AND CONDUITSA. CONDUITS, PIPES AND SLEEVES MAY BE EMBEDDED IN MASONRY ONLY IF COMPLYING WITH THEFOLLOWING REQUIREMENTS:a. THEY SHALL BE SPACED NO CLOSER THAN 3 DIAMETERS ON CENTERb. THE MAXIMUM AREA OF VERTICAL PIPES, CONDUITS, OR SLEEVES PLACED IN MASONRYCOLUMNS OR PILASTERS SHALL NOT EXCEED 2 PERCENT OF THE CROSS SECTIONc. THE MAXIMUM NUMBER OF PIPES ALLOWED IN A CELL FOR WALLS IS THE FOLLOWING:d. WRAP PIPES AND FITTINGS WITH 14" FOAM TAPE MIN.B. PIPES SHALL NOT BE EMBEDDED IN MASONRY WHEN:a. CONTAINING LIQUID GAS OR VAPORS AT TEMPERATURES HIGHER THAN 150° Fb. UNDER PRESSURE IN EXCESS OF 55 PSIc. CONTAINING WATER OR OTHER LIQUIDS SUBJECT TO FREEZINGC. ALUMINUM PIPES SHALL NOT BE EMBEDDED IN CMUCOMPONENT ASTM NOTESSAND ASTM C144LIME ASTM C207PORTLAND CEMENT ASTM C150TYPE I or II, LOW ALKALI, < 6 MONTHS OLDPEA GRAVEL ASTM C301MASONRYWALL DESIGN STRENGTHNET AREA COMPRESSIVE STRENGTH OFCONCRETE MASONRY UNITSDENSITYf'm = 2,000 PSI2,000 PSI MINIMUMMEDIUM WIEGHTf'm = 2,500 PSI3,250 PSI MINIMUMMEDIUM WIEGHTWALL DESIGN STRENGTH MORTAR TYPE MORTAR 28 DAY COMPRESSIVE STRENGTHf'm = 2,000 PSIS2,000 PSI MINIMUMf'm = 2,500 PSIM2,500 PSI MINIMUMWALL DESIGN STRENGTHCOMPRESSIVESTRENGTHGROUT 28 DAY MIX DESIGNf'm = 2,000 PSI2,000 PSI3 PARTS SAND2 PARTS PEA GRAVEL1 PART PORTLAND CEMENT8-11 INCH SLUMPf'm = 2,500 PSI- SUBMIT MIX DESIGNWALL THICKNESS REINFORCED CELL UN-REINFORECED CELL8"(2) 12" Ø(1) 34" Ø(3) 12" Ø(2) 34" Ø(1) 1" Ø12"(4) 12" Ø(3) 34" Ø(2) 1" Ø(1) 1 14" Ø(5) 12" Ø(4) 34" Ø(3) 1" Ø(2) 1 14" Ø1. STRUCTURAL STEEL SHALL BE DETAILED, FABRICATED AND ERECTED BY AN APPROVED AND LICENSEDFABRICATOR IN ACCORDANCE WITH AISC 360-16 AND CHAPTER 22 OF THE CODE.2. ALL STRUCTURAL STEEL SHALL CONFORM TO THE ASTM DESIGNATION AS INDICATED BELOW (UNO):W SHAPES, WT SHAPES A992ANGLES, CHANNELS A36HSS A500 GRBSIMPLE SHEAR TAB CONNECTION PLATES(AS NOTED ON DWG'S) A36HIGH STRENGTH BOLTS A325/F1852, A490SC/F2280SC(AS NOTED ON DRAWINGS) A325SC/F1852SCANCHOR RODS (AS NOTED ON DRAWINGS) F1554 GR36COMMON/MACHINE BOLTS A307 GR A3. THE STRUCTURAL STEEL FABRICATOR SHALL FURNISH SHOP DRAWINGS OF ALL STEEL FOR REVIEW ANDAPPROVAL BY THE AOR AND SEOR PRIOR TO FABRICATION.4. BOLT HOLES USED IN STEEL SHALL BE 1/16" LARGER IN DIAMETER THAN NOMINAL SIZE OF BOLT USED, EXCEPT ASNOTED.5. ALL STRUCTURAL STEEL SURFACES THAT ARE ENCASED IN CONCRETE, MASONRY, SPRAY ON FIREPROOFING,OR ARE ENCASED BY BUILDING FINISH, SHALL BE LEFT UNPAINTED, EXCEPT AS REQUIRED FOR DESIGNATION OFPROTECTED ZONES.6. PRIOR TO FABRICATING PLATES, MEMBERS, OR OTHER STEEL ASSEMBLIES ATTACHED TO REINFORCEDCONCRETE/MASONRY USING POST-INSTALLED ANCHORS, CONTRACTOR SHALL LOCATE ALL REINFORCEMENTAND CONFIRM CONSTRUCTABILTY OF ANCHOR LOCATIONS. SHOULD CONFLICTS WITH REINFORCEMENTOCCUR, CONTRACTOR SHALL COORDINATE AND SUBMIT ALTERNATE ANCHOR LOCATIONS AND REVISEDSTEEL FABRICATIONS TO SEOR FOR REVIEW AND APPROVAL. DO NOT CUT OR DAMAGE EXISTINGREINFORCEMENT.7. ALL STRUCTURAL STEEL AND MISCELLANEOUS METAL EXPOSED TO THE WEATHER SHALL BE HOT DIPGALVANIZED AFTER FABRICATION, UNLESS CALLED OUT TO BE PAINTED ON THE CONSTRUCTION DOCUMENTS.PROTECT FIELD WELDS EXPOSED TO THE WEATHER VIA PRIME AND PAINT OR BRUSH / COLD GALVANIZING.REFER TO ARCH DRAWINGS FOR STEEL FINISH. ALL ARCHITECTURALLY EXPOSED STRUCTURAL STEEL (AESS)SHALL CONFORM TO REQUIREMENTS OF AISC 303-16.8. ALL WELDING IS TO BE DONE BY CERTIFIED WELDERS USING E70XX ELECTRODES (UNO). ALL WELDS SHALL BE INCONFORMANCE WITH THE PROJECT SPECIFICATIONS AND THE CODE FOR WELDING IN BUILDINGCONSTRUCTION (AWS D1.1-10) OF THE AMERICAN WELDING SOCIETY. SEE SPECIAL INSPECTIONS SECTION FORWELDING INSPECTION REQUIREMENTS. ALL WELDING FOR ELEMENTS OF THE LATERAL FORCE RESISTING SYSTEMSHALL PER AWS D1.8-09.9. THE CONTRACTOR SHALL SUBMIT ALL WELDING PROCEDURE SPECIFICATIONS FOR REVIEW AND APPROVAL BYSEOR. THE SUBMITTED WELDING PROCEDURES SHALL INCLUDE ONLY THOSE PROCEDURES RELEVANT TO THISPROJECT. ALL WELDED JOINTS SHALL BE PREQUALIFIED PER AWS OR BE QUALIFIED BY TEST PER AWS. APROCEDURE QUALIFICATION RECORD (PQR) SHALL BE INCLUDED WITH THE WPS IF THE WELDING PROCEDUREOR JOINT IS QUALIFIED BY TESTING. THE ELECTRODE MANUFACTURER AND PRODUCT/TRADE NAME SHALL BEIDENTIFIED IN THE WPS IN ADDITION TO THE AWS ELECTRODE CLASSIFICATION NAME. A COPY OF THEELECTRODE MANUFACTURER'S TECHNICAL DATA SHEETS WITH THE RECOMMENDED WELDING PARAMETERSSHALL BE SUBMITTED WITH THE WPS.10. 100 PERCENT ULTRASONIC TESTING IS REQUIRED FOR ALL COMPLETE JOINT PENETRATION GROOVE WELDS.11. IF INTERMIXING OF WELD FILLER MATERIAL IS REQUIRED AT SPECIFIC WELDED JOINTS, AND IF ONE OF THE FILLERMETALS IS FCAW-S, SUBMIT A WELDING PROCEDURE SPECIFICATION (WPS) AND QUALIFY BY TESTING.12. DISCONTINUITIES IN WELDS CREATED BY ERRORS OR BY FABRICATION OR ERECTION OPERATIONS, SUCH ASTACK WELDS, ERECTION AIDS, AIR ARC GOUGING AND FLAME CUTTING SHALL BE REPAIRED AS REQUIRED BYSEOR.STRUCTURAL STEEL1. ALL HEADED STUDS WELDED TO BEAMS OR CONCRETE CONNECTIONS SHALL BE NELSON STUDS (ICC-ESR 2856), OR APPROVED EQUAL. STUD MATERIAL SHALL BE IN ACCORDANCE WITH AWS D1.1-10, "STRUCTURAL WELDING CODE-STEEL"2. NELSON SHEAR CONNECTOR STUDS SHALL BE AUTOMATICALLY END WELDED IN THE SHOP OR IN THE FIELDWITH EQUIPMENT AND PROCEDURES RECOMMENDED BY NELSON STUD WELDING, INC. AND COMPLY WITHAISC 360-16 SECTION M2, ITEM 4 AND AWS D1.1-10. WELDING SHALL BE DONE IN SUCH A MANNER AS TOPROVIDE COMPLETE FUSION BETWEEN THE WELDED END OF THE STUD AND THE PLATE.3. ALL SURFACES TO RECEIVE NELSON STUDS SHALL BE CLEAN, UNPAINTED AND FREE OF HEAVY RUST AND MILLSCALE, DIRT, SAND OIL, WATER OR OTHER DELETERIOUS MATERIALS.STEEL HEADED STUDS1. ALL LIGHT GAGE METAL FRAMING CONSTRUCTION SHALL BE IN ACCORDANCE WITH SECTION 2211 OF THECODE AND AISI 5100-16 "SPECIFICATIONS FOR DESIGN OF COLD FORMED STEEL STRUCTURAL MEMBERS".2. MEMBER IDENTIFICATION SHALL BE AS SHOWN:A. MEMBER DEPTH:(EXAMPLE: 6" = 600/100 INCHES)ALL MEMBER DEPTHS ARE TAKEN IN 1/100 INCH INCREMENTS. FOR "T" SECTIONS, MEMBER DEPTH IS THEINSIDE TO INSIDE DIMENSION.B. STYLE:(EXAMPLE: STUD OR JOIST SECTION = "S")THE FOUR ALPHA CHARACTERS USED TO DESIGNATE THE TYPE OF SECTION ARE:xS = STUD OR JOIST SECTIONSxT = TRACK SECTIONSxU = CHANNEL SECTIONSxF = FURRING CHANNEL SECTIONSC. FLANGE WIDTH:(EXAMPLE: 1 5/8" = 1.625" = 162/100 INCHES)ALL MEMBER FLANGE WIDTH ARE TAKEN IN 1/100 INCH INCREMENTS.D. MATERIAL THICKNESS:(EXAMPLE: 0.054" = 54 MIL = 54/1,000 INCHES)MATERIAL THICKNESS IS THE MINIMUM BASE METAL THICKNESS IN MILS. MINIMUM BASE METAL THICKNESSREPRESENTS 95% OF THE DESIGN THICKNESS.3. ALL CALCULATED MEMBER PROPERTIES PER AISI SPECIFICATIONS ARE BASED ON THE FOLLOWINGTHICKNESSES:4. ALL LIGHT GAGE METAL FRAMING SHALL CONFORM WITH THE FOLLOWING:GALVANIZED STUDS & TRACKS: ASTM A653 SQ, GR 5012 (97), 14 (68) OR 16 (54) GAGE (MILS) (Fy = 50,000 PSI)GALVANIZED STUDS & TRACKS: ASTM A653 SQ, GR 3318 (43), 20 (33) GAGE (MILS) (Fy = 33,000 PSI)GALVANIZED BACKING PLATES: ASTM A653 SQ, GR 50(Fy = 50,000 PSI)GALVANIZED END CLOSURES, ASTM A653 SQ, GR 33BRIDGING AND ACCESSORIES (Fy = 33,000 PSI)5. ALL LIGHT GAGE METAL FRAMING SHALL BE GALVANIZED.6. DOUBLE VERTICAL STUDS SHALL BE STITCH WELDED TOGETHER ON BOTH FLANGES WITH 1/16" GROOVE WELDS x 1" LONG AT 12" ON CENTER, U.N.O. ON DRAWINGS.7. TOP AND BOTTOM TRACK GAGE THICKNESS SHALL MATCH THE GAGE THICKNESS OF THE WALL STUDS, U.N.O.8. MINIMUM STUD PROPERTIES SHALL BE PER AISI 5100-16.THE FOLLOWING ARE ACCEPTABLE MANUFACTURERS:xCLARK DIETRICH (ICC ESR 4782 AND 4784P)xCEMCO (ICC ESR 3016)xAPPROVED EQUAL9. ALL SHEET METAL SCREWS SHALL PROTRUDE 1/4" MIN THROUGH METAL FRAMING.10. THE CONTRACTOR IS PROHIBITED FROM USING TORCHES TO BURN HOLES IN TRACKS OR STUDS.11. PUNCHED OPENINGS IN THE PARTITION WALL STUDS AND EXTERIOR WALL STUDS NEED TO BE LOCATED AMINIMUM OF 1.5 TIMES THE DEPTH OF THE STUD FROM THE CONNECTION AT THE FLOOR, CONNECTION AT THEUNDERSIDE OF THE DECK, AND CONNECTIONS OF HEADERS AND SILLS TO JAMBS.MINIMUM THICKNESS REFERENCE GAGE DESIGN THICKNESS33 MIL 20 GA - STRUCTURAL 0.0346"43 MIL 18 GA 0.0451"54 MIL 16 GA 0.0566"68 MIL 14 GA 0.0713"97 MIL 12 GA 0.1017"118 MIL 10 GA 0.1242"A600BSC162 -D54COLD-FORMED STEEL (LIGHT GAGE METAL FRAMING)1. ALL HEADED STUDS WELDED TO BEAMS OR CONCRETE CONNECTIONS SHALL BE NELSON STUDS (ICC-ESR 2856), OR APPROVED EQUAL. STUD MATERIAL SHALL BE IN ACCORDANCE WITH AWS D1.1-10, "STRUCTURAL WELDING CODE-STEEL"2. NELSON SHEAR CONNECTOR STUDS SHALL BE AUTOMATICALLY END WELDED IN THE SHOP OR IN THE FIELDWITH EQUIPMENT AND PROCEDURES RECOMMENDED BY NELSON STUD WELDING, INC. AND COMPLY WITHAISC 360-16 SECTION M2, ITEM 4 AND AWS D1.1-10. WELDING SHALL BE DONE IN SUCH A MANNER AS TOPROVIDE COMPLETE FUSION BETWEEN THE WELDED END OF THE STUD AND THE PLATE.3. ALL SURFACES TO RECEIVE NELSON STUDS SHALL BE CLEAN, UNPAINTED AND FREE OF HEAVY RUST AND MILLSCALE, DIRT, SAND OIL, WATER OR OTHER DELETERIOUS MATERIALS.STEEL HEADED STUDSPOST-INSTALLED ANCHORS IN CONCRETE / MASONRY1. POST-INSTALLED ANCHOR CAPACITIES IN CONCRETE SHALL BE DETERMINED PER SECTION 1901.3 OF THECODE AND ACI 318-14 CHAPTER 17 USING STRENGTH DESIGN.2. POST INSTALLED ANCHORS IN CONCRETE AND MASONRY SHALL BE PREQUALIFIED FOR SEISMIC APPLICATIONSIN ACCORDANCE WITH THE FOLLOWING INSTALLATION OF POST-INSTALLED ANCHORS SHALL BE INACCORDANCE WITH THE LISTED APPLICABLE ICC EVALUATION REPORT. **LIMITATIONS OF USE OF POWER ACTUATED FASTENERS:PER SECTION 13.4.5 OF ASCE 7-16 POWER ACTUATED FASTENERS IN CONCRETE OR STEEL SHALL NOT BE USEDFOR SUSTAINED TENSION LOADS OR FOR BRACE APPLICATIONS IN SEISMIC UNLESS APPROVED FOR SEISMICLOADING. POWER ACTUATED FASTENERS IN MASONRY SHALL NOT BE PERMITTED UNLESS APPROVED FORSEISMIC LOADING.EXCEPTION: POWER ACTUATED FASTENERS IN CONCRETE USED FOR SUPPORT OF ACOUSTICAL TILE OR LAY-IN PANEL SUSPENDED CEILING APPLICATIONS AND DISTRIBUTED SYSTEMS WHERE THE SERVICE LOAD ONANY INDIVIDUAL FASTENER DOES NOT EXCEED 90 LB.3. EXPANSION ANCHOR EMBEDMENTS IN THE DRAWINGS ARE MINIMUM "EFFECTIVE EMBEDMENTS" (hef) ASSHOWN IN THE ICC REPORT CORRESPONDING TO THE ANCHOR.4. LOCATE ALL EXISTING REINFORCEMENT BY NON-DESTRUCTIVE MEANS (X-RAY, PACOMETER, GPR, ETC.) PRIORTO DRILLING OR INSTALLING POST-INSTALLED ANCHORS. COORDINATE POST-INSTALLED ANCHOR LOCATIONSWITH LOCATIONS OF EXISTING REINFORCEMENT. DO NOT CUT OR DAMAGE EXISTING REINFORCEMENT.5. ALL POST-INSTALLED ANCHORS USED IN DRY INTERIOR CONDITIONS SHALL BE CARBON STEEL, U.N.O6. ALL POST-INSTALLED ANCHORS USED AT EXTERIOR CONDITIONS, EXPOSED TO THE ELEMENTS, OR USED IN ADAMP ENVIRONMENT (I.E. KITCHENS) SHALL BE STAINLESS STEEL, U.N.O.7. WHERE POST-INSTALLED MECHANICAL ANCHORS ARE USED FOR NON-VIBRATION ISOLATED MECHANICALEQUIPMENT RATED OVER 10 HP, THEY SHALL BE QUALIFIED IN ACCORDANCE WITH ACI 355.2.8. IF THE CONCRETE CRACKS DURING THE INSTALLATION OF AN ANCHOR, THE ANCHOR SHALL BE REMOVED ORABANDONED. FOR ABANDONED ANCHORS AND ABANDONED ANCHOR HOLES:A. FILL ALL EMPTY ABANDONED ANCHOR HOLES WITH A DRY-PACK MORTAR.B. FOR ABANDONED EXPANSION ANCHORS WHICH CANNOT BE REMOVED WITHOUT DAMAGING THESUBSTRATE, CUT/BURN OFF THE END OF THE BOLT FLUSH WITH THE FACE OF CONCRETE/MASONRYAND THEN DRIVE ABANDONED ANCHOR TO BOTTOM OF HOLE. FILL REMAINDER OF HOLE WITH ADRY-PACK MORTAR.C. FOR ABANDONED ADHESIVE OR UNDERCUT ANCHORS WHICH CANNOT BE REMOVED WITHOUTDAMAGING THE SUBSTRATE, BURN OFF THE END OF THE BOLT/ROD 1" BELOW THE SURFACE OFCONCRETE/MASONRY AND FILL REMAINDER OF HOLE WITH A DRY-PACK MORTAR.D. ABANDONED ANCHOR HOLES (WHETHER FILLED WITH DRY-PACK OR CONTAINING ABANDONEDANCHORS) MAY NOT BE LOCATED ANY CLOSER THAN 3x DIAMETER CENTER-TO-CENTER TO ANYANCHOR IN SERVICE. ANCHORS NOT MEETING THIS MINIMUM SPACING MAY HAVE REDUCEDCAPACITY AND SHALL BE REVIEWED WITH THE SEOR.SUBSTRATEMATERIALANCHOR TYPE ANCHOR PRODUCTICC EVALUATIONREPORTACCEPTANCECRITERIACONCRETE EXPANSION ANCHORS SIMPSON STRONGBOLT 2 ICC ESR-3037 AC193CMU EXPANSION ANCHORS SIMPSON STRONGBOLT 2 IAPMO ES ER 240 AC01 OR AC106CONCRETE SCREW ANCHOR SIMPSON TITEN HD ICC ESR-2713 AC193CMU SCREW ANCHOR SIMPSON TITEN HD ICC ESR-1056 AC106CONCRETE ADHESIVE ANCHORS SIMPSON SET-XP ICC ESR-2508 AC193CMU ADHESIVE ANCHOR SIMPSON SET-XP IAPMO ES ER 265 AC58CONCRETEPOWER ACTUATEDFASTENER**SIMPSON PDPAW ICC ESR-2138 AC70SUBSTRATEMATERIALANCHOR TYPE ANCHOR PRODUCTICC EVALUATIONREPORTACCEPTANCECRITERIACONCRETE EXPANSION ANCHORS HILTI KB-TZ ICC ESR-1917 AC193CONCRETE SCREW ANCHOR HILTI KH-EZ ICC ESR-3027 AC193CONCRETE ADHESIVE ANCHORS HILTI HIT-HY 200 ICC ESR-3187 AC308CONCRETEPOWER ACTUATEDFASTENER**HILTI X-UICC ESR-2269 AC701. CONDUCT TESTING OF POST- INSTALLED ANCHORS PER SECTION 1901.3.4 OF THE CODE.2. WHERE THE MANUFACTURER'S INSTALLATION INSTRUCTIONS OR APPLICABLE ICC-ES EVALUATION SERVICESREPORT CALL FOR THE APPLICATION OF AN INSTALLATION TORQUE, THE SPECIFIED TORQUE SHALL BE APPLIEDWITH A CALIBRATED TORQUE WRENCH. THE SPECIFIED INSTALLATION TORQUE SHALL NOT BE EXCEEDED.3. THE SPECIAL INSPECTOR SHALL BE ON THE JOBSITE DURING ANCHOR INSTALLATIONS AS REQUIRED PERCHAPTER 17 OF THE CODE, UNLESS OTHERWISE NOTED IN ICC-ES ESR, TO VERIFY ANCHOR, ANCHORDIMENSIONS, CONCRETE TYPE, CONCRETE COMPRESSIVE STRENGTH, HOLE DIMENSIONS, ANCHOR SPACING,EDGE DISTANCES, SLAB THICKNESS, ANCHOR EMBEDMENT, AND INSTALLATION TORQUE.4. TEST LOAD: REQUIRED TEST LOADS SHALL BE DETERMINED BY ONE OF THE FOLLOWING METHODS:A. TWICE THE MAXIMUM ALLOWABLE TENSION LOAD OR ONE AND A QUARTER (1 1/4) TIMES THEMAXIMUM DESIGN STRENGTH PROVIDED BY THE ICC REPORT OR DETERMINED PER ACI 318. THE TENSIONTEST LOAD NEED NOT TO EXCEED 80 PERCENT OF THE NOMINAL YIELD STRENGTH OF THE ANCHOR (0.8As Fy). SEE STRUCTURAL DETAILS FOR DESIGN-BASED TENSION TEST LOADS FOR ADHESIVE ANCHORS.B. THE MANUFACTURER'S RECOMMENDED INSTALLATION TORQUE AS APPROVED BY THE ICC REPORT.5. TENSION OR TORQUE TESTING OF POST-INSTALLED ANCHORS SHALL BE DONE IN THE PRESENCE OF THESPECIAL INSPECTOR AND A REPORT OF THE TEST RESULTS SHALL BE SUBMITTED TO THE IOR AND ENFORCEMENTAGENCY.6. THE SPECIAL INSPECTOR SHALL SELECT ANCHORS FOR TESTING AT RANDOM.7. TEST FREQUENCY:APPLICATIONQUANTITYSTRUCTURAL 100% OF BOLTSNON-STRUCTURAL 50%; ALTERNATE BOLTS IN A GROUP(SUCH AS EQUIPMENT ANCHORAGE) (TEST AT LEAST HALF OF THE ANCHORS IN GROUP)SILL PLATE BOLTING 10% OF BOLTSEXCEPTIONS:A. UNDERCUT ANCHORS THAT ALLOW VISUAL CONFIRMATION OF FULL SET SHALL NOT REQUIRE TESTING.B. WHERE THE FACTORED DESIGN TENSION ON ANCHORS IS LESS THAN 100 LBS AND THOSE ANCHORS ARECLEARLY NOTED ON THE APPROVED CONSTRUCTION DOCUMENTS.C. WHERE ADHESIVE ANCHOR SYSTEMS ARE USED TO INSTALL REINFORCING DOWEL BARS IN HARDENEDCONCRETE, ONLY 25 PERCENT OF THE DOWELS SHALL BE TESTED IF ALL OF THE FOLLOWING CONDITIONSARE MET:xTHE DOWELS ARE USED EXCLUSIVELY TO TRANSMIT SHEAR FORCES ACROSS JOINTS BETWEENEXISTING AND NEW CONCRETE.xTHE NUMBER OF DOWELS IN ANY ONE MEMBER EQUALS OR EXCEEDS 12.xTHE DOWELS ARE UNIFORMLY DISTRIBUTED ACROSS SEISMIC FORCE RESISTING MEMBERS (SUCH ASSHEAR WALLS, COLLECTORS, AND DIAPHRAGMS).D. TESTING OF SHEAR DOWELS ACROSS COLD JOINTS IN SLAB ON GRADE, WHERE THE SLAB IS NOT PART OFTHE LATERAL FORCE-RESISTING SYSTEM SHALL NOT BE REQUIRED.E. TESTING IS NOT REQUIRED FOR POWER ACTUATED FASTENERS USED TO ATTACH TRACKS OF INTERIORNON-SHEAR WALL PARTITIONS FOR SHEAR ONLY, WHERE THERE ARE AT LEAST THREE FASTENERS PERSEGMENT OF TRACK.8. TEST METHODS: TEST LOADS MAY BE APPLIED BY ANY METHOD THAT WILL EFFECTIVELY TRANSMIT AMEASURABLE TENSION LOAD TO THE ANCHOR. ACCEPTABLE METHODS INCLUDE:A. USE OF HYDRAULIC JACK, WHEREBY EITHER UNCONFINED OR CONFINED TESTING SHALL BE ACCEPTABLE;B. USE OF CALIBRATED SPRING LOADED DEVICES; ORC. USE OF A CALIBRATED TORQUE WRENCH FOR TORQUE-CONTROLLED EXPANSION ANCHORS.9. TEST ACCEPTANCE CRITERIA: ACCEPTANCE CRITERIA FOR POST-INSTALLED ANCHORS SHALL BE BASED ON THEICC REPORT OR MANUFACTURER'S WRITTEN INSTRUCTION AS ACCEPTABLE TO OSHPD. FIELD TESTS SHALLSATISFY THE FOLLOWING MINIMUM REQUIREMENTS:A. HYDRAULIC RAM METHOD: ANCHORS TESTED WITH A HYDRAULIC JACK OR SPRING LOADED DEVICESSHALL MAINTAIN THE TEST LOAD FOR A MINIMUM OF 15 SECONDS AND SHALL EXHIBIT NO DISCERNABLEMOVEMENT DURING THE TENSION TEST, E.G. AS EVIDENCED BY LOOSENING OF THE WASHER UNDER THENUT. SCREW ANCHORS MAY BE LOOSENED A MAXIMUM ONE FULL TURN TO FACILITATE THEPOSITIONING OF A TENSION TEST COLLAR.B. TORQUE WRENCH METHOD: ANCHORS TESTED WITH A CALIBRATED TORQUE WRENCH MUST ATTAIN THESPECIFIED TORQUE WITHIN HALF (1/2) TURN OF THE NUT.EXCEPTIONS:xWEDGE OR SLEEVE TYPE: ONE-QUARTER (1/4) TURN OF THE NUT FOR A 3/8 INCH ANCHOR ONLY.xTHREADED TYPE: ONE-QUARTER (1/4) TURN OF THE SCREW AFTER INITIAL SEATING OF THE SCREWHEAD.10. IF ANY ANCHOR FAILS TESTING, TEST ALL ANCHORS OF THE SAME TYPE, INSTALLED BY THE SAME TRADE, ANDNOT PREVIOUSLY TESTED UNTIL TWENTY (20) CONSECUTIVE ANCHORS PASS, THEN RESUME INITIAL TESTFREQUENCY.11. REQUIRED TORQUE TEST LOADS SHALL BE EQUAL TO THE MANUFACTURER'S RECOMMENDED INSTALLATIONTORQUE PROVIDED IN THE ICC-ESR FOR THE SPECIFIC ANCHOR. TEST TORQUE VALUES ARE SUMMARIZED INTHE TABLE BELOW:TESTING CRITERIA FOR POST-INSTALLED ANCHORS IN CONCRETE / MASONRYSIMPSONLOCATION INSTRUCTUREINSTALLATION TORQUE (FT-LBS)SIMPSON STRONG-BOLT2(ICC-ES ESR 3037)SIMPSON WEDGE-ALL(ICC-ES ESR 1396)SIMPSON TORQ-CUTSELF-UNDERCUTTINGANCHOR(ICC-ES ESR 2705)INCHES144--3830 30 -1260 35 9058905518534150 120 240Page 209 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-1041. IN ACCORDANCE WITH SECTION 1704.6 OF THE CODE STRUCTURAL OBSERVATIONS SHALL BE PERFORMEDFOR THE FOLLOWING ELEMENTS OF CONSTRUCTION:A. FOUNDATION REINFORCINGSHEATHING NAILING FOR THE WOOD LATERAL FORCE-RESISTING SYSTEM, INCLUDING DIAPHRAGMSAND2. THE OBJECTIVE OF THE STRUCTURAL OBSERVATION IS TO BECOME FAMILIAR WITH THE PROGRESS AND QUALITYOF THE CONTRACTOR'S WORK AND DETERMINE IF THE WORK IS BEING COMPLETED IN GENERALCONFORMANCE WITH THE APPROVED PLANS AND SPECIFICATIONSA. STRUCTURAL OBSERVATIONS ARE NOT INSPECTIONS AND SHALL NOT BE USED AS A REPLACEMENT FORTHE SPECIAL INSPECTIONS REQUIRED BY THE CODE OR REFERENCED STANDARD OR FOR SPECIALINSPECTIONS REQUIRED IN THIS DOCUMENT.B. THE PERSON COMPLETING THE STRUCTURAL OBSERVATIONS DOES NOT HAVE RESPONSIBILITY FOR ANYACTS OR OMISSIONS BY THE CONTRACTOR OR OF ANY OTHER ENTITY PROVIDING MATERIALS ORSERVICES ON THE PROJECT.3. ADEQUATE NOTIFICATION SHALL BE PROVIDED TO THE STRUCTURAL ENGINEER PERFORMING OBSERVATIONS,A MINIMUM OF (2) WORKING DAYS, PRIOR TO OBSERVATION OF THE WORK.STRUCTURAL OBSERVATIONS1. THIS STATEMENT OF SPECIAL INSPECTIONS HAS BEEN PREPARED PURSUANT TO SECTION 1704.3 OF THE CODE .THIS SECTION DETAILS BOTH REQUIRED SPECIAL INSPECTIONS AND TESTS INCLUDING TESTING PER SECTION1705 OF THE CODE. THE FOLLOWING SHALL BE OBSERVED DURING THEIR IMPLEMENTATION:A. GENERAL:a. STRUCTURAL VERIFICATIONS, INSPECTIONS AND TESTS SHALL BE PERFORMED IN ACCORDANCEWITH CHAPTER 17 OF THE CODE AND/OR THE APPLICABLE REFERENCE STANDARD.B. OWNER REQUIREMENTS:a. THE OWNER OR OWNER'S AGENT SHALL EMPLOY ONE OR MORE APPROVED AGENCIES TOPERFORM INSPECTIONS DURING CONSTRUCTION ON THE TYPES OF WORK LISTED IN SECTION1705 OF THE CODE AND IN THIS STATEMENT OF INSPECTIONS.C. SPECIAL INSPECTOR QUALIFICATIONS:a. THE SPECIAL INSPECTIONS SHALL PROVIDE WRITTEN DOCUMENTATION TO THE BUILDINGOFFICIAL DEMONSTRATING HIS OR HER COMPETENCE AND RELEVANT EXPERIENCE ORTRAINING. THE EXPERIENCE OR TRAINING SHALL BE CONSIDERED RELEVANT WHEN THEDOCUMENTED EXPERIENCE OR TRAINING IS RELATED IN COMPLEXITY TO THE SAME TYPE OFSPECIAL INSPECTION ACTIVITIES FOR PROJECTS OF SIMILAR COMPLEXITY AND MATERIALQUANTITIES.D. CONTRACTOR REQUIREMENTS:a. SPECIAL INSPECTION IS IN ADDITION TO THE CONTRACTOR'S QUALITY CONTROL INSPECTIONSAND TESTING. THE CONTRACTOR'S QUALITY CONTROL INSPECTIONS AND TESTING SHALLOCCUR PRIOR TO SPECIAL INPECTION AND REPORTS SHALL BE AVAILABLE TO THE SPECIALINSPECTOR.b. THE CONTRACTOR SHALL ENSURE THAT THE WORK FOR WHICH SPECIAL INSPECTION IS REQUIREDREMAINS ACCESSIBLE AND EXPOSED FOR SPECIAL INSPECTION PURPOSES UNTIL COMPLETIONOF THE REQUIRED SPECIAL INSPECTION.c. ANY CONTRACTOR RESPONSIBLE FOR THE CONSTRUCTION OF THE MAIN WIND OR SEISMICFORCE RESISTING SYSTEM SHALL SUBMIT A WRITTEN STATEMENT OF RESPONSIBILITY TO THEBUILDING OFFICIAL AND OWNER PRIOR TO COMMENCEMENT OF WORK ON THE SYSTEM ORCOMPONENT. THE STATEMENT OF RESPONSBILITY SHALL CONTAIN ACKNOWLEDGEMENT OFAWARENESS OF THE SPECIAL INSPECTION REQUIREMENTS CONTAINED IN THE STATEMENT OFSPECIAL INSPECTIONS.E. SPECIAL INSPECTOR REPORT REQUIREMENTS:a. THE SPECIAL INSPECTOR SHALL KEEP RECORD OF INSPECTIONSb. THE SPECIAL INPSECTOR SHALL FURNISH INSPECTION REPORTS TO THE BUILDING OFFICIAL ANDTO THE ARCHITECT AND STRUCTURAL ENGINEER OF RECORD.c. REPORTS SHALL INDICATE THAT WORK INSPECTED WAS OR WAS NOT COMPLETED INCONFORMANCE TO APPROVED CONSTRUCTION DOCUMENTS.d. DISCREPANCIES SHALL BE BROUGHT TO THE IMMEDIATE ATTENTION OF THE CONTRACTOR FORCORRECTION.e. IF NOT CORRECTED DISCREPANCIES SHALL BE BROUGHT TO THE ATTENTION OF THE BUILDINGOFFICIAL AND THE ARCHITECT AND STRUCTURAL ENGINEER OF RECORD PRIOR TO THECOMPLETION OF THAT PHASE OF WORK.f. A FINAL REPORT DOCUMENTING SPECIAL INSPECTIONS AND CORRECTION OF ANYDISCREPANCIES NOTED SHALL BE SUBMITTED TO THE BUILDING OFFICIAL.STATEMENT OF SPECIAL INSPECTIONS1. THE FOLLOWING SUBMITTALS SHALL BE SUBMITTED FOR REVIEW AND APPROVAL BY THE ENGINEER:A. STEEL INCLUDING MISC. METALSa. SHOP DRAWINGS FOR FABRICATION AND ERECTIONb. WPS's (INCLUDING PQR'S AS APPLICABLE)c. REINFORCING STEELd. SHOP DRAWINGS FOR FABRICATION AND PLACEMENT2. BEFORE SUBMITTING EACH SUBMITTAL, (INCLUDES SHOP DRAWINGS, PRODUCT DATA, SAMPLES AND SIMILARSUBMITTALS), THE CONTRACTOR SHALL HAVE:A. REVIEWED AND COORDINATED EACH SUBMITTAL WITH OTHER SUBMITTALS AND WITH THE REQUIREMENTSOF THE WORK AND THE CONTRACT DOCUMENTS. THIS INCLUDES THE CONTRACTOR REVIEWING ANDVERIFYING THAT THE SUBMITTAL IS COORDINATED AMONG ALL CONSTRUCTION TRADES:B. DETERMINED AND VERIFIED ALL FIELD MEASUREMENTS, QUANTITIES, DIMENSIONS , SPECIFIEDPERFORMANCE AND DESIGN CRITERIA, INSTALLATION REQUIREMENTS, MATERIALS, CATALOG NUMBERSAND SIMILAR INFORMATIONC. DETERMINED AND VERIFIED ALL INFORMATION RELATIVE TO THE CONTRACTOR'S RESPONSIBILITIES FORMEANS, METHODS, TECHNIQUES, SEQUENCES AND PROCEDURES OF CONSTRUCTION, AND SAFETYPRECAUTIONS AND PROGRAMS.D. REVIEWED AND VERIFIED THAT THE ARCHITECT'S OR ENGINEER'S COMMENTS FROM PREVIOUS SUBMITTALROUNDS HAVE BEEN ADDRESSED.3. EACH SUBMITTAL SHALL BEAR A STAMP OR SPECIFIC WRITTEN CERTIFICATION THAT THE CONTRACTOR HASSATISFIED THEIR OBLIGATIONS UNDER THE CONTRACT DOCUMENTS WITH RESPECT TO THE CONTRACTOR'SREVIEW AND APPROVAL OF THAT SUBMITTAL.4. THE CONTRACTOR'S OBLIGATION TO PERFORM AND COMPLETE THE WORK IN ACCORDANCE WITH THECONTRACT DOCUMENTS SHALL BE ABSOLUTE:a. REVIEW AND APPROVAL OF SHOP DRAWINGS BY THE ARCHITECT AND/OR ENGINEER DOES NOTCONSTITUTE APPROVAL OF A CHANGE REQUEST, SUBSTITUTION OR MODIFICATION TO THECONTRACT DRAWINGS.b. THE ARCHITECT AND ENGINEER SHALL BE NOTIFIED OF CHANGE REQUESTS, SUBSTITUTIONS ORMODIFICATIONS TO THE CONTRACT DRAWINGS IN WRITING BEFORE AND SEPARATE FROM THESUBMITTAL PRIOR TO SUBMISSION.5. FABRICATION FOR ITEMS IN THESE DOCUMENTS SHALL NOT COMMENCE UNTIL THE SUBMITTAL HAS BEENREVIEWED AND APPROVED BY THE ENGINEER.SUBMITTALS1. SHOP FABRICATION REQUIRES SPECIAL INSPECTION IN ACCORDANCE WITH CODE SECTION 1704.2.5.EXCEPTION: SHOP SPECIAL INSPECTIONS ARE NOT REQUIRED WHEN WORK IS DONE ON THE PREMISES OFFABRICATOR REGISTERED AND APPROVED TO PERFORM SUCH WORK IN ACCORDANCE WITH CODE SECTION 1704.2.5.1. THE FOLLOWING ACCREDITATIONS MEET THE REQUIREMENTS OF THIS EXCEPTION:A. STEEL BUILDINGS (OR STEEL ELEMENTS IN OTHER BUILDINGS)a. FOR GENERAL STEEL BUILDINGS OR ELEMENTS THE FABRICATOR SHALL BE AN AISC CERTIFIEDFABRICATOR IN ACCORDANCE WITH THE AISC CERTIFICATION PROGRAM FOR STRUCTURALSTEEL FABRICATORS (AISC 201-06).b. OTHER ACCREDITATION DEEMED ACCEPTABLE BY THE AUTHORITY HAVING JURISDICTION.c. IF FABRICATION IS PERFORMED BY AN APPROVED FABRICATOR A CERTIFICATE OFCOMPLIANCE MUST BE PROVIDED TO THE BUILDING INSPECTOR THAT THE MATERIALSSUPPLIED AND WORK PERFORMED BY THE FABRICATOR ARE IN CONFORMANCE WITH THECONSTRUCTION DOCUMENTS.d. IF FABRICATION IS NOT PERFORMED BY AN APPROVED FABRICATOR WELDING INSPECTIONREPORTS MUST BE SUBMITTED TO THE BUILDING OFFICIAL BY AN APPROVED TESTING AGENCY.e.a. NONDESTRUCTIVE TESTING (NDT) MAY BE PERFORMED BY THE FABRICATOR,HOWEVER THE QA AGENCY SHALL REVIEW THE FABRICATOR'S NDT REPORTS.SHOP FABRICATIONPage 210 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-105REQUIRED VERIFICATION AND INSPECTIONSSTEELWELDINGINSPECTION TASKS PRIOR TO WELDING (AISC 360-16 N.5.4-1)QC QAAWS 2015 D1.1REFERENCE1. WELDING PROCEDURE SPECIFICATIONS (WPSs) AVAILABLEPP 6.32. MANUFACTURER CERTIFICATIONS FOR WELDING CONSUMABLES AVAIALABLE P P 6.23. WPS AVAILABLE P P -4. MATERIAL IDENTIFICATION (TYPE/GRADE)OO 6.25. WELDER IDENTIFICATION SYSTEM O O 6.46. FIT-UP OF GROOVE WELDS (INCLUDING JOINT GEOMETRY) - JOINT PREPARATION - DIMENSIONS (ALIGNMENT, ROOT OPENING, ROOT FACE, BEVEL) - CLEANLINESS (CONDITION OF STEEL SURFACES) - TACKING (TACK WELD QUALITY AND LOCATION) - BACKING TYPE AND FIT (IF APPLICABLE)OO6.5.25.225.155.185.10, 5.22.1.17. FIT-UP OF GROOVE WELDS OF HSS T-, Y-, AND K-JOINTS WITHOUT BACKING (INCLUDING JOINT GEOMETRY) - JOINT PREPARATION - DIMENSIONS (ALIGNMENT, ROOT OPENING, ROOT FACE, BEVEL) - CLEANLINESS (CONDITION OF STEEL SURFACES) - TACKING (TACK WELD QUALITY AND LOCATION)PO----8. CONFIGURATION AND FINISH OF ACCESS HOLES O O6.5.2, 5.1.7& AISC 360-16 J1.69. FIT-UP OF FILLET WELDS - DIMENSIONS (ALIGNMENT, GAPS AT ROOT) - CLEANLINESS (CONDITION OF STEEL SURFACES) - TACKING (TACK WELD QUALITY AND LOCATION)OO5.22.15.155.1810. CHECK WELDING EQUIPMENTO___6.2, 5.11INSPECTION TASKS DURING WELDING (AISC 360-16 N.5.4-2)1. CONTROL AND HANDLING OF WELDING CONSUMABLES -PACKAGING -EXPOSURE CONTROLOO6.25.3.15.3.2 (SMAW)5.3.3 (SAW)2. NO WELDING OVER CRACKED TACK WELDS O O 5.183. ENVIRONMENTAL CONDITIONS - WIND SPEED WITHIN LIMITS - PRECIPITATION AND TEMPERATUREOO5.12.15.12.24. WPS FOLLOWED - SETTINGS ON WELDING EQUIPMENT - TRAVEL SPEED - SELECTED WELDING MATERIALS - SHIELDING GAS TYPE/FLOW RATE - PREHEAT APPLIED - INTERPASS TEMPERATURE MAINTAINED (MIN/MAX) - PROPER POSITIONS (F, V, H, OH)OO6.3.3, 6.5.2, 5.5, 5.215.6, 5.75. WELDING TECHNIQUES - INTERPASS AND FINAL CLEANING - EACH PASS WITHIN PROFILE LIMITATIONS - EACH PASS MEETS QUALITY REQUIREMENTSOO6.5.2, 6.5.3, 5.245.30.16. PLACEMENT AND INSTALLATION OF STEEL HEADED STUD ANCHORS P P -INSPECTION TASKS AFTER WELDING (AISC 360-16 N.5.4-3)1. WELDS CLEANED O O 5.30.12. SIZE, LENGTH AND LOCATION OF WELDSP P 6.5.13. WELDS MEET VISUAL ACCEPTANCE CRITERIA - CRACK PROHIBITION - WELD/BASE-METAL FUSION - CRATER CROSS SECTION - WELD PROFILES - WELD SIZE - UNDERCUT - POROSITYPP6.5.3TABLE 6.1(1)TABLE 6.1(2)TABLE 6.1(3)TABLE 6.1(4), 5.24TABLE 6.1(6)TABLE 6.1(7)TABLE 6.1(8)4. ARC STRIKESP P 5.295. k-AREAPPAISC 360-16 CA3.1c& J10.86. WELD ACCESS HOLES IN ROLLED HEAVY SHAPES AND BUILT-UP HEAVY SHAPES [b]PP -7. BACKING REMOVED AND WELD TABS REMOVED (IF REQUIRED)PP5.10, 5.318. REPAIR ACTIVITIES P P6.5.3, 5.269. DOCUMENT ACCEPTANCE OR REJECTION OF WELDED JOINT OR MEMBERPP6.5.4, 6.5.510. NO PROHIBITED WELDS HAVE BEEN ADDED WITHOUT THE APPROVAL OF THE EOROO -STEELBOLTINGINSPECTION TASKS PRIOR TO BOLTING (AISC 360-16 N.5.6-1)QC QA2014 RCSC SPEC.REFERENCE1. MANUFACTURER'S CERTIFICATIONS AVAILABLE FOR FASTENER MATERIALSOP2.1, 9.12. FASTENERS MARKED IN ACCORDANCE WITH ASTM REQUIREMENTSOOFIGURE C-2.1, 9.1(SEE ASTMSTANDARDS)3. CORRECT FASTENERS SELECTED FOR THE JOINT DETAIL (GRADE, TYPE, BOLTLENGTH IF THREADS ARE TO BE EXCLUDED FROM SHEAR PLANE)OO2.3.2, 2.7.2, 9.14. CORRECT BOLTING DETAILS SELECTED FOR THE JOINT DETAIL. O O4, 85. CONNECTING ELEMENTS, INCLUDING THE APPROPRIATE FAYING SURFACECONDITION AND HOLE PREPARATION, IF SPECIFIED, MEET APPLICABLEREQUIREMENTS.OO3, 9.1, 9.36. PRE-INSTALLATION VERIFICATION TESTING BY INSTALLATION PERSONNELOBSERVED AND DOCUMENTED FOR FASTENER ASSEMBLIES AND METHODSUSED.PO7, 9.27. PROTECTED STORAGE PROVIDED FOR BOLTS, NUTS, WASHERS, AND OTHERFASTENER COMPONENTSOO2.2, 8, 9.1INSPECTION TASKS DURING BOLTING (AISC 360-16 N.5.6-2)1. FASTENER ASSEMBLIES, PLACED IN ALL HOLES AND WASHERS AND NUTS AREPOSITIONED AS REQUIRED.OO8.1, 9.12. JOINT BROUGHT TO THE SNUG-TIGHT CONDITION PRIOR TO THEPRE-TENSIONING OPERATIONOO8.1, 9.13. FASTENER COMPONENT NOT TURNED BY THE WRENCH PREVENTED FROMROTATINGOO8.2, 9.24. FASTENERS ARE PRETENSIONED IN ACCORDANCE WITH THE RCSCSPECIFICATION PROGRESSING SYSTEMATICALLY FROM THE MOST RIGID POINTTOWARD THE FREE EDGES.OO8.2, 9.2INSPECTION TASKS AFTER BOLTING (AISC 360-16 N.5.6-3)1. DOCUMENT ACCEPTANCE OR REJECTION OF BOLTED CONNECTIONS P P___REQUIRED VERIFICATION AND INSPECTIONS CONT.STEEL ELEMENTS OF COMPOSITE CONSTRUCTIONDECK AND HEADED STUDSINSPECTION TASKS PRIOR TO CONCRETE PLACEMENT(AISC 360-16 N.6.1)1. PLACEMENT AND INSTALLATION OF STEEL DECK P P___2. PLACEMENT AND INSTALLATION OF STEEL HEADED STUD ANCHORS P P___2. DOCUMENT ACCEPTANCE OR REJECTION OF STEEL ELEMENTS P P___0 - OBSERVE THESE ITEMS ON A RANDOM BASIS. OPERATIONS NEED NOT BE DELAYED PENDING THESE INSPECTIONS.P - PERFORM THESE TAKS FOR EACH WELDED JOINT OR MEMBER, EACH BOLTED CONNECTION, OR STEEL ELEMENT. REFER TO CONCRETE TABLE FOR REQUIRED GROUTING INSPECTIONS BELOW BASE PLATES.REQUIRED VERIFICATION AND INSPECTIONSMASONRYLEVEL 2 QUALITY ASSURANCEMINIMUM TESTSPRIOR TO CONSTRUCTION, VERIFY CERTIFICATES OF COMPLIANCE USED IN MASONRY CONSTRUCTION INACCORDANCE WITH SPECIFICATION ARTICLE 1.5VERIFICATION OF SLUMP FLOW AND VISUAL STABILITY INDEX (VSI) AS DELIVERED TO THE PROJECT SITE INACCORDANCE WITH SPECIFICATION ARTICLE 1.5 & 1.6 FOR SELF-CONSOLIDATING GROUTVERIFICATION OF f'm AND f'AAC IN ACCORDANCE WITH SPECIFICATION ARTICLE 1.4 B PRIOR TO CONSTRUCTION,EXCEPT WHERE SPECIFICALLY EXEMPTED BY THIS CODEMINIMUM SPECIAL INSPECTIONINSPECTION TASKFREQUENCY (a)REFERENCE FOR CRITERIACONT PERIODIC TMS 402 TMS 602XArt. 1.5a. PROPORTIONS OF SITE-PREPARED MORTARXArt. 2.1, 2.6 Ab. GRADE AND SIZE OF PRESTRESSING TENDONS AND ANCHORAGESXArt. 2.4 B, 2.4 Hc. GRADE, TYPE AND SIZE OF REINFORCEMENT, CONNECTORS, ANCHOR BOLTS AND PRESTRESSING TENDONS AND ANCHORAGESXArt. 3.4, 3.6Ad. PRESTRESSING TECHNIQUEXArt. 3.6 Be. PROPERTIES OF THIN-BED MORTAR FOR AAC MASONRY X (b)X (c)Art. 2.1 C f. SAMPLE PANEL CONSTRUCTIONX Art. 1.6 D3. PRIOR TO GROUTING, VERIFY THAT THE FOLLOWING ARE IN COMPLIANCE:a. GROUT SPACEXArt. 3.2 D, 3.2 Fb. PLACEMENT OF PRESTRESSING TENDONS AND ANCHORAGESXSEC. 10.8,10.9Art. 2.4, 3.6c. PLACEMENT OF REINFORCEMENT, CONNECTORS AND ANCHOR BOLTSXSEC. 6.3.1,6.3.6, 6.3.7 Art. 3.2 E, 3.4,d. PROPORTIONS OF SITE-PREPARED GROUT AND PRESTRESSING GROUT FOR BONDED TENDONSXArt. 2.6 B,2.4 G.1.b4. VERIFY DURING CONSTRUCTION:a. MATERIALS AND PROCEDURES WITH THE APPROVED SUBMITTALSX Art. 1.5b. PLACEMENT OF MASONRY UNITS AND MORTAR JOINT CONSTRUCTIONX Art. 3.3 Bc. SIZE AND LOCATION OF STRUCTURAL ELEMENTSX Art. 3.3 Fd. TYPE, SIZE AND LOCATION OF ANCHORS, INCLUDING OTHER DETAILS OF ANCHORAGE OF MASONRY TO STRUCTURAL MEMBERS, FRAMES OR OTHER CONSTRUCTIONXSEC. 1.2.1(e),6.1.4.3, 6.2.1e. WELDING OF REINFORCEMENT XSEC. 6.1.6.2f. PREPARATION, CONSTRUCTION AND PROTECTION OF MASONRY DURING COLD WEATHER (TEMPERATURE BELOW 40°F ) OR HOT WEATHER (TEMPERATURE ABOVE 90°F )XArt. 1.8 C,1.8 Dg. APPLICATION AND MEASUREMENT OF PRESTRESSING FORCEX Art. 3.6 Bh. PLACEMENT OF GROUT AND PRESTRESSING GROUT FOR BONDED TENDONS IS IN COMPLIANCEXArt. 3.5, 3.6 Ci. PLACEMENT OF AAC MASONRY UNITS AND CONSTRUCTION OF THIN-BED MORTAR JOINTSX (b)X (c)Art. 3.3 B.9,3.3 F.1.b5. OBSERVE PREPARATION OF GROUT SPECIMENS, MORTAR SPECIMENS AND/OR PRISMSXArt.1.4 B.2.a.3,1.4 B.2.b.3,1.4 B.2.c.3,1.4 B.3,1.4 B.4(a) FREQUENCY REFERS TO THE FREQUENCY OF SPECIAL INSPECTION, WHICH MAY BE CONTINUOUS DURING THETASK LISTED OR PERIODIC DURING THE TASK LISTED, AS DEFINED IN THE TABLE(b) REQUIRED FOR THE FIRST 5000 SQ FT OF AAC MASONRY(c) REQUIRED AFTER THE FIRST 5000 SQ FT OF AAC MASONRYREQUIRED VERIFICATION AND INSPECTIONSWOODCODE CHAPTER 17 AND REFERENCED 2018 NDS AND AWC SDPWS-2015SPECIAL INSPECTION OR TESTCONTINUOUSPERIODICCBC REFERENCE3. WOOD LATERAL FORCE-RESISTING SYSTEM WITH FASTENER SPACING OF THESHEATHING LESS THAN OR EQUAL TO 4" OC. - WOOD DIAPHRAGMS - DRAG STRUTS___X 1705.12.24. WOOD LATERAL FORCE-RESISTING SYSTEM WITH FASTENER SPACING OF THESHEATHING GREATER THAN 4" OC (NOT REQUIRED) - WOOD DIAPHRAGMS - DRAG STRUTS___ ___1705.12.26. METAL PLATE CONNECTED WOOD WITH OVERALL HEIGHTS OF 60 INCHES ORGREATER - PERMANENT INDIVIDUAL TRUSS MEMBER RESTRAINT/BRACING IN ACCORDANCE WITH APPROVED TRUSS SUBMITTAL PACKAGE___X 1705.5.2REQUIRED VERIFICATION AND INSPECTIONSSOILSCODE TABLE 1705.6SPECIAL INSPECTION OR TESTCONTINUOUSPERIODIC1. VERIFY MATERIALS BELOW SHALLOW FOUNDATIONS ARE ADEQUATE TO ACHIEVE THE DESIGN BEARING CAPACITY___X2. VERIFY EXCAVATIONS ARE EXTENDED TO PROPER DEPTH AND HAVE REACHED PROPER MATERIAL.___X3. PERFORM CLASSIFICATION AND TESTING OF COMPACTED FILL MATERIALS___X4. VERIFY USE OF PROPER MATERIALS, DENSITIES, AND LIFT THICKNESSES DURING PLACEMENT AND COMPACTION OF COMPACTED FILL.X___5. PRIOR TO PLACEMENT OF COMPACTED FILL, INSPECT SUBGRADE AND VERIFY THAT SITE HAS BEEN PREPARED PROPERLY.___XCONCRETE CONSTRUCTIONCODE TABLE 1705.3SPECIAL INSPECTION OR TESTCONTINUOUSPERIODICREFERENCEDSTANDARDCBC REFERENCE1. INSPECT REINFORCMENT AND VERIFY PLACEMENT.___XACI 318: CH 20, 25.2,25.3, 26.6.1-26.6.31908.42. REINFORCING BAR WELDING: a. VERIFY WELDABILITY OF REINFORCING BARS OTHER THAN ASTM A706 b. INSPECT SINGLE-PASS FILLET WELDS, MAXIMUM 516" AND c. INSPECT ALL OTHER WELDS______XXX___AWS D1.4ACI 318: 26.6.4___3. INSPECT ANCHORS CAST IN CONCRETE___XACI 318:17.8.2___5. VERIFY USE OF REQUIRED MIX DESIGN___XACI 318:CH. 19, 26.4.3, 26.4.41904.1, 1904.2,1908.2, 1908.36. PRIOR TO CONCRETE PLACEMENT, FABRICATE SPECIMENS FOR STRENGTH TESTS, PERFORM SLUMP AND AIR CONTENT TESTS, AND DETERMINE THE TEMPERATURE OF THE CONCRETE.X___ASTM C 172ASTM C 31ACI 318: 26.5, 26.121908.108. VERIFY MAINTENANCE OF SPECIFIED CURING TEMPERATURE AND TECHNIQUES.___XACI 318: 26.5.3-26.5.51908.912. INSPECT FORMWORK FOR SHAPE, LOCATION, AND DIMENSIONS OF THE CONCRETE MEMBER BEING FORMED.___X___ SPECIAL INSPECTIONS LISTED FOR CONCRETE ALSO APPLY TO GROUTING OPERATIONS.REQUIRED VERIFICATION AND INSPECTIONSPage 211 of 802 1ABCD2ABCD12HSS 6x6x 14HSS 6x6x 14HSS 6x6x 14HSS 6x6x 14HSS 6x6x 14HSS 6x6x 14F3F3F3F3F3F3TB1TB1TB1TB15" CONC SLAB W/ #4 @16" OC EA WAY SLOPETO DRAINS PER ARCH11S-30311S-30311S-30312S-30312S-30313S-30311S-303HSS 43S-303TYPOF 343S-303TYPOF 3C3.5C3.5C3.5C3.5C3.5C3.51ABCD2ABCD122'-0"4'-0" MINTYP OF 6LINES 1 & 21'-4"8"4'-0"TYP OF 6LINES 1 & 22'-0"41S-411HSS 8x4x 316HIP TYPHSS 8x4x 316HIP TYPHSS 8x4x 316HIP TYPHSS 8x4x 316HIP TYPHSS10 x 4 x 316 BMHSS10 x 4 x 316 BMHSS10 x 4 x 316 BMHSS10 x 4 x 316 BMHSS 4x4x 14ON WALLHSS 4x4 x 1 4 ON WAL LHSS 4x4x 1 4 ON W ALL HSS 4x4x 14ON WALLDODODODODODODODODODODODODO600S200-33@ 24" OCMAX TYPDODODODODODODODODODODO600S200-33@ 24" OCMAX TYPDODO600S200-33@ 24" OCMAX TYPDODODODODODO600S200-33@ 24" OCMAX TYPDODO600S200-33@ 24" OCMAX TYP21S-411 TYPTYP @CORNER42S-411TYP11S-41213S-40232S-411BEL ABV41S-411TYP12S-412TYP @CORNER4S-2212S-2213S-2211S-2216'-0" MINCONT C6 TYPFROM CORNERSW1RESTROOM FOUNDATION PLANSCALE: 1/4" = 1'-0"NORTHCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-012RESTROOM ROOF FRAMING PLANSCALE: 1/4" = 1'-0"NORTHS-201PAD FOOTING SCHEDULETYPE WIDTH LENGTH THICKNESSTOP REINF BOT REINF DETAIL3'-0" 3'-0" 2'-0" SEE NOTE 12(4) #5, EW (4) #5 , EW43/S-303F3TIE BEAM SCHEDULETYPE WIDTH THICKNESSLONG REINF TRANS REINF DETAIL1'-4"1'-0" SEE NOTE 12(2) #4 @ TOP(2) #4 @ BOT#3 @ 24" OC32/S-303TB1FOUNDATION PLAN NOTES1. REFER TO THE FOLLOWING SHEETS FOR TYPICAL DETAILS:2. SEE ARCHITECTURAL DRAWINGS FOR FINISHED FLOOR ELEVATIONS. REFERENCE FINISHED FLOORELEVATION = 0'-0" CORRESPONDS TO FINISHED FLOOR ELEVATION.3. ALL DIMENSIONS SHOWN ARE FROM FACE OF CONCRETE/MASONRY, FACE OF SHEATHING, ORCENTERLINE OF COLUMN. ALL COLUMNS ARE CENTERED IN STUD WALLS, UNO.4. FOR ANY DIMENSIONAL INFORMATION NOT SHOWN, SEE ARCHITECTURAL DRAWINGS.5. SEE ARCHITECTURAL DRAWINGS FOR ANY EMBEDDED ITEMS AND ALL EXTERIOR CONCRETE PAVING.6. SEE PLANS AND ARCHITECTURAL DRAWINGS FOR DEPRESSIONS AND/OR SLOPES IN CONCRETESLABS.7. SEE ARCHIECTURAL DRAWINGS FOR SIZE AND LOCATION OF ALL DOOR AND WINDOW OPENINGS INBEARING AND NON-BEARING WALLS.8. SEE ARCHITECTURAL DRAWINGS FOR LOCATION OF INTERIOR NON-BEARING PARTITIONS.9. SEE ARCHITECTURAL, PLUMBING, MECHANICAL AND ELECTRICAL DRAWINGS FOR ADDITIONALEMBEDDED ITEMS AND SLAB PENETRATIONS.10. FOR TYPICAL SLAB-ON-GRADE REQUIREMENTS, INCLUDING SLAB JOINTS, SEE DETAIL 31/S-301.11. THE BUILDING PAD SHALL BE PREPARED AS OUTLINED IN DETAIL 53/S-301. THE BUILDING OFFICIALSHALL REQUIRE PAD CERTIFICATION BY A GEOTECHNICAL ENGINEER AT THEIR DISCRETION.12. BOTTOM OF FOOTING SHALL BE, UNLESS DEEPER FOUNDATIONS ARE REQUIRED BY THE BUILDINGOFFICIAL:A. 30" BELOW PAD OR ADJACENT GRADE AT PERIMETER, WHICHEVER IS DEEPER, UNO.B. 30" BELOW PAD OR ADJACENT GRADE AT INTERIOR GRADE BEAMS, WHICHEVER IS DEEPER, UNO.DESCRIPTIONSHEET (S)SYMBOLS AND ABBREVIATIONS S-101STRUCTURAL GENERAL NOTES S-102 - S-103TESTING AND INSPECTION S-104TYPICAL CONCRETE DETAILS S-301TYPICAL WOOD DETAILS S-401 - S-405SYMBOL LEGENDINDICATES CONC MASONRY WALL PER DETAIL XX/S-3XXSSINDICATES STEPPED FOOTING PER DETAIL 33/S-301SCHEDULESCONTINUOUS FOOTING SCHEDULEMARK WIDTHMIN EMBED BELOWLOWEST PAD GRADELONG REINF STIRRUP DETAIL3'-6" SEE NOTE 12#3 @ 12" OC11,12/S-303C3.5ROOF FRAMING NOTES1. SEE ARCHITECTURAL DRAWINGS FOR ALL DIMENSIONS AND ELEVATIONS INCLUDING, BUT NOTLIMITED TO THE FOLLOWING, ALL DIMENSIONS TO BE VERIFIED PRIOR TO CONSTRUCTION:A. GRID DIMENSIONS AND HORIZONTAL CONTROLB. ALL DIMENSIONS, ELEVATIONS, FINISH SURFACE, SLOPES, DRAINS, SLAB DEPRESSIONS, ETCC. LOCATION AND EXTENT OF EXTERIOR WALL ASSEMBLIES AND OPENINGSD. ALL NON STRUCTURAL WALLS2. REFER TO THE FOLLOWING SHEETS FOR TYPICAL DETAILS:3. SEE ARCHITECTURAL DRAWINGS FOR ALL TOP OF SHEATHING AND TOP OF WALL ELEVATIONS.4. SEE ARCHITECTURAL, PLUMBING, MECHANICAL AND ELECTRICAL DRAWINGS FOR SIZE ANDLOCATION OF PIPES, DUCTS AND OTHER ROOF PENETRATIONS. FOR ROOF PENETRATIONS NOTSHOWN ON ROOF FRAMING PLAN, SEE DETAIL 23, 33/S-406 FOR TYPICAL OPENINGS, UNO.5. ALL INTERIOR WALLS NOT SHOWN ON THE STRUCTURAL FRAMING PLANS BUT SHOWN ON THEARCHITECTURAL DRAWINGS SHALL BE CONSTRUCTED PER NON-BEARING PARTITION WALLDETAILS 11-43/S-404, UNO.6. DIAPHRAGM TYPES:ALL ROOF DIAPHRAGMS SHALL BE TYPE A, UNOREFER TO 12/-4067. FRAMING MEMBERS AND COMPONENTS SHALL NOT BE CUT, NOTCHED, DRILLED OROTHERWISE ALTERED IN ANY WAY WITHOUT WRITTEN CONCURRENCE AND APPROVAL OF AREGISTERED DESIGN PROFESSIONAL.8. ALTERATIONS RESULTING IN THE ADDITION OF LOADS TO ANY MEMBER (E.G. HVACEQUIPMENT, WATER HEATER) SHALL NOT BE PERMITTED WITHOUT VERIFICATION THAT THEFRAMING IS CAPABLE OF SUPPORTING SUCH ADDITIONAL LOADING.DESCRIPTIONSHEET (S)SYMBOLS AND ABBREVIATIONS S-101STRUCTURAL GENERAL NOTES S-102 - S-104TESTING AND INSPECTION S-105TYPICAL CONCRETE DETAILS S-301 -S-303TYPICAL MASONRY DETAILSS-303, S-401-403SYMBOL LEGEND111111116(VERT)X2X1/4HSS6(VERT)X2X1/411S-303311S-303311S-303311S-3033Page 212 of 802 A5421BDE3C54213ABDECP1P1P1P1P1P1P1P1C1C1C1C1C1C1HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14HSS 4x4x 14C1C15" CONC SLAB W/ #4@16" OC EA WAYSLOPE PER ARCH33S-303TYP13S-30213S-30213S-30213S-30213S-30213S-30213S-30213S-302A5421BDE3C54213ABDECB2 ABVB2 ABVB5B5B5B5B5B5B5B5J1TYPJ2TYP B2 ABVB2 ABV B2 ABVB2 ABVB1B2 ABVB1B1B1B1B1B1B2 ABV(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4(2*)B4B1HSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDNHSS COL BELPER FDN(2*)B3BEL(2*)B3BEL(2*)B3BEL(2*)B3BEL33S-41113S-41211S-411B3 TOCOL TYP31S-412TYP22S-412TYP23S-412TYP21S-412TYPS-2111KIOSK FOUNDATION PLANSCALE: 1/4" = 1'-0"NORTHCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-012KIOSK ROOF FRAMING PLANSCALE: 1/4" = 1'-0"NORTHFOUNDATION PLAN NOTES1. REFER TO THE FOLLOWING SHEETS FOR TYPICAL DETAILS:2. SEE ARCHITECTURAL DRAWINGS FOR FINISHED FLOOR ELEVATIONS. REFERENCE FINISHED FLOORELEVATION = 0'-0" CORRESPONDS TO FINISHED FLOOR ELEVATION.3. ALL DIMENSIONS SHOWN ARE FROM FACE OF CONCRETE/MASONRY, FACE OF SHEATHING, ORCENTERLINE OF COLUMN. ALL COLUMNS ARE CENTERED IN STUD WALLS, UNO.4. FOR ANY DIMENSIONAL INFORMATION NOT SHOWN, SEE ARCHITECTURAL DRAWINGS.5. SEE ARCHITECTURAL DRAWINGS FOR ANY EMBEDDED ITEMS AND ALL EXTERIOR CONCRETE PAVING.6. SEE PLANS AND ARCHITECTURAL DRAWINGS FOR DEPRESSIONS AND/OR SLOPES IN CONCRETE SLABS.7. SEE ARCHITECTURAL DRAWINGS FOR SIZE AND LOCATION OF ALL DOOR AND WINDOW OPENINGS INBEARING AND NON-BEARING WALLS.8. SEE ARCHITECTURAL DRAWINGS FOR LOCATION OF INTERIOR NON-BEARING PARTITIONS.9. SEE ARCHITECTURAL, PLUMBING, MECHANICAL AND ELECTRICAL DRAWINGS FOR ADDITIONAL EMBEDDEDITEMS AND SLAB PENETRATIONS.10. FOR TYPICAL SLAB-ON-GRADE REQUIREMENTS, INCLUDING SLAB JOINTS, SEE DETAIL 11/S-302.11. THE BUILDING PAD SHALL BE PREPARED AS OUTLINED IN DETAIL 42/S-301. THE BUILDING OFFICIAL SHALLREQUIRE PAD CERTIFICATION BY A GEOTECHNICAL ENGINEER AT THEIR DISCRETION.12. BOTTOM OF FOOTING SHALL BE, UNLESS DEEPER FOUNDATIONS ARE REQUIRED BY THE BUILDING OFFICIAL:A. 30" BELOW PAD OR ADJACENT GRADE AT PERIMETER, WHICHEVER IS DEEPER, UNO.B. 30" BELOW PAD OR ADJACENT GRADE AT INTERIOR GRADE BEAMS, WHICHEVER IS DEEPER, UNO.DESCRIPTIONSHEET (S)SYMBOLS AND ABBREVIATIONS S-101STRUCTURAL GENERAL NOTES S-102 - S-104TESTING AND INSPECTION S-105TYPICAL CONCRETE DETAILS S-301- S-303SYMBOL LEGENDSSINDICATES STEPPED FOOTING PER DETAIL 43/S-301SCHEDULESCONTINUOUS FOOTING SCHEDULEMARK WIDTHMIN EMBED BELOWLOWEST PAD GRADELONG REINF STIRRUP DETAIL1'-0" SEE NOTE 12#3 @ 12" OC33/S-303C1POLE FOOTING SCHEDULEMARKDIA (Ø)EMBEDMENT DEPTH VERT REINF TIE REINF DETAIL2'-0" 7'-0"(6) #4#3 SPIRALS PITCHPER 13/S-30213/S-302P1ROOF FRAMING NOTES1. SEE ARCHITECTURAL DRAWINGS FOR ALL DIMENSIONS AND ELEVATIONS INCLUDING, BUT NOTLIMITED TO THE FOLLOWING, ALL DIMENSIONS TO BE VERIFIED PRIOR TO CONSTRUCTION:A. GRID DIMENSIONS AND HORIZONTAL CONTROLB. ALL DIMENSIONS, ELEVATIONS, FINISH SURFACE, SLOPES, DRAINS, SLAB DEPRESSIONS, ETCC. LOCATION AND EXTENT OF EXTERIOR WALL ASSEMBLIES AND OPENINGSD. ALL NON STRUCTURAL WALLS2. REFER TO THE FOLLOWING SHEETS FOR TYPICAL DETAILS:3. SEE ARCHITECTURAL DRAWINGS FOR ALL TOP OF SHEATHING AND TOP OF WALL ELEVATIONS.4. SEE ARCHITECTURAL, PLUMBING, MECHANICAL AND ELECTRICAL DRAWINGS FOR SIZE ANDLOCATION OF PIPES, DUCTS AND OTHER ROOF PENETRATIONS. FOR ROOF PENETRATIONS NOTSHOWN ON ROOF FRAMING PLAN, SEE DETAIL 23, 33/S-406 FOR TYPICAL OPENINGS, UNO.5. ALL INTERIOR WALLS NOT SHOWN ON THE STRUCTURAL FRAMING PLANS BUT SHOWN ON THEARCHITECTURAL DRAWINGS SHALL BE CONSTRUCTED PER NON-BEARING PARTITION WALLDETAILS 11-43/S-404, UNO.6. DIAPHRAGM TYPES:ALL ROOF DIAPHRAGMS SHALL BE TYPE A, UNOREFER TO 12/-4067. FRAMING MEMBERS AND COMPONENTS SHALL NOT BE CUT, NOTCHED, DRILLED OROTHERWISE ALTERED IN ANY WAY WITHOUT WRITTEN CONCURRENCE AND APPROVAL OF AREGISTERED DESIGN PROFESSIONAL.8. ALTERATIONS RESULTING IN THE ADDITION OF LOADS TO ANY MEMBER (E.G. HVACEQUIPMENT, WATER HEATER) SHALL NOT BE PERMITTED WITHOUT VERIFICATION THAT THEFRAMING IS CAPABLE OF SUPPORTING SUCH ADDITIONAL LOADING.DESCRIPTIONSHEET (S)SYMBOLS AND ABBREVIATIONS S-101STRUCTURAL GENERAL NOTES S-102 - S-104TESTING AND INSPECTION S-105TYPICAL CONCRETE DETAILS S-301 - S-303SYMBOL LEGENDJOIST / BEAM SCHEDULEMARK SIZE REMARKSJ1400S200@ 8" OCJ2400S200@ 16" OCB1HSS 6x4x316B2HSS 6X2X316B3HSS 4X4X316B4C4x5.4B5 C6X8.2SCHEDULESINDICATES TWO LEVELS OF SUPPORT FRAMING AT EYEBROW AND COUNTER LEVELS - SEE ARCH( 2* )111111111111Page 213 of 802 01-GROUND FLOOR0' - 0"02-TOP CMU10' - 0"12#5 CTR IN WALL - TYP UNONOTE:REINFORCING SHOWN IS IN PLACEOF TYPICAL REINFORCING PER PLANAD01-GROUND FLOOR0' - 0"02-TOP CMU10' - 0"#5 CTR IN WALL - TYP UNONOTE:REINFORCING SHOWN IS IN PLACEOF TYPICAL REINFORCING PER PLANAD01-GROUND FLOOR0' - 0"02-TOP CMU10' - 0"#5 CTR IN WALL - TYP UNONOTE:REINFORCING SHOWN IS IN PLACEOF TYPICAL REINFORCING PER PLAN1201-GROUND FLOOR0' - 0"02-TOP CMU10' - 0"#5 CTR IN WALL - TYP UNONOTE:REINFORCING SHOWN IS IN PLACEOF TYPICAL REINFORCING PER PLAN1RESTROOM EAST CMU WALL ELEVATIONSCALE: 1/4" = 1'-0"NORTHCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-012RESTROOM SOUTH CMU WALL ELEVATIONSCALE: 1/4" = 1'-0"NORTHS-2213RESTROOM WEST CMU WALL ELEVATIONSCALE: 1/4" = 1'-0"NORTH4RESTROOM NORTH CMU WALL ELEVATIONSCALE: 1/4" = 1'-0"NORTH1Page 214 of 802 NOTES:1. VALUES ABOVE ARE FOR REINFORCEMENT WITH THE FOLLOWING PARAMETERS:A. GRADE 60 REINFORCEMENTB. NORMAL WEIGHT CONCRETEa. FOR LIGHTWEIGHT CONCRETE MULTIPLY THE VALUES ABOVE BY 1.3C. NON-EPOXY COATED REINFORCEMENTD. HORIZONTAL BARS WITHOUT 12" OF CONCRETE BELOW (BOTTOM BARS), AND VERTICAL BARSa. FOR TOP BARS WITH 12" OR MORE OF CONCRETE BELOW THE BAR MULTIPLY THE VALUES ABOVE BY 1.3E. CLEAR SPACING NOT LESS THAN db, CLEAR COVER NOT LESS THAN db AND STIRRUPS THROUGH Ld NOT LESS THANMINORCLEAR SPACING NO LESS THAN 2db AND CLEAR COVER NOT LESS THAN dba. FOR OTHER SPACING AND COVER CONDITIONS MULTIPLY THE VALUES ABOVE BY 1.5F. REINFORCEMENT NOT IN SHEAR WALLSa. FOR REINFORCEMENT IN SHEAR WALLS MULTIPLY THE VALUES ABOVE BY 1.252. THE MULTIPLIERS LISTED IN NOTE 1 ABOVE ARE CUMULATIVE INCREASES IN DEVELOPMENT/LAP SPLICE LENGTH.3. ALL LAP SPLICES REFERENCED IN THE PLANS SHALL BE CLASS B UNLESS NOTED OTHERWISE.4. WHEN REINFORCING BARS OF TWO SIZES ARE LAP-SPLICED IN TENSION, USE THE LARGER OF THE TENSION CLASS B, LAP SPLICE LENGTH (ls) OF THE SMALLER BAR, AND THE CLASS A, TENSION DEVELOPMENT LENGTH (ld) OF THE LARGERBAR.CONTACT LAP SPLICE(PREFERRED)NON-CONTACT LAP SPLICELAP SPLICEMAX = LARGER OFCLASS B, UNOls/5 OR 6"REINFORCING TENSION DEVELOPMENT LENGTH AND LAP SPLICE SCHEDULEBAR SIZEDEVELOPMENT LENGTH, ld(CLASS A LAP SPLICE)LAP SPLICE, ls(CLASS B LAP SPLICE)f'c (psi) f'c (psi)2,5003,000 4,0002,5003,000 4,000#3 1'-6"1'-5"1'-3" 2'-0" 1'-10"1'-7"#42'-0" 1'-10"1'-7"2'-8" 2'-5"2'-1"#52'-6"2'-4"2'-0" 3'-3" 3'-0" 2'-7"#63'-0" 2'-9" 2'-5" 3'-11" 3'-7" 3'-2"#7 4'-5" 4'-0" 3'-6" 5'-9" 5'-2" 4'-6"#8 5'-0" 4'-7" 4'-0" 6'-6"5'-11"5'-2"#9 5'-8" 5'-2" 4'-6" 7'-4" 6'-9" 5'-10"#10 6'-5" 5'-10"5'-1"8'-3"7'-7"6'-7"#117'-1"6'-6"5'-7"9'-2" 8'-5" 7'-3"REINF DEVELOPMENT LENGTH AND SPLICES0256-03-CU20 - S301NTSBAR SIZE D#3 THRU #86d#9 THRU #11 8dNOTES:1. ALL HOOKED BARS SHALL EXTEND AS FAR AS POSSIBLE WITH A MINIMUM 2" END COVER AND WITH EMBEDMENT NOT LESS THAN SHOWN ON THE SCHEDULE UNLESS NOTED OTHERWISE ON PLANS.2. MINIMUM SIDE COVER = 2 12".3. FOR LIGHTWEIGHT CONCRETE MULTIPLY LENGTHS IN SCHEDULE BY 1.3.STANDARD HOOK DEVELOPMENT LENGTH "ldh"BAR SIZE D"lh"NORMAL WEIGHT2,500 3,000 4,000#32 1/4"6" 0'-9" 0'-9" 0'-8"#43" 8" 1'-0" 0'-11" 0'-10"#53 3/4"10" 1'-3"1'-2"1'-0"#64 1/2"12"1'-6"1'-5"1'-3"#75 1/4"1'-2"1'-9" 1'-8"1'-5"#86"1'-4"2'-0" 1'-10"1'-7"#99 1/2" 1'-7 1/2"2'-3"2'-1"1'-10"#1010 3/4"1'-10" 2'-7"2'-4" 2'-1"#11 12"2'-0 1/2"2'-10" 2'-7" 2'-3"ldhdb4db2 12" MINDD12 db"l h"2" CLR MINHOOK DEVELOPMENT LENGTH(SEE SCHEDULE)FACE OFCONCRETEFOC OR POURJT @ STD HOOKdbREINF HOOK DEVELOPMENT LENGTH AND BENDS0256-03-CU20 - S301NTSdb6dbD6db *dbD135 HOOK90 HOOK** PROVIDE 10db EXTENSIONS IN LIEUOF 6db AT ALL FRAME COLUMNS,GIRDERS, SHEAR WALLS AND SHEARWALL BOUNDARY MEMBERSBAR SIZE D#3 1 12"#4 2"#5 2 12"OR 3" MINREINF TIES AND STIRRUPS0256-03-CU20 - S301NTS6'-0" MAX6'-0" MAX2'-0"2'-0"45°2" TYPSECTION ATYP SLAB REINFFILL IN SLAB, WO(2) #4 DIAG BARS @ MIDOF SLAB, BEND UNDERTYP BARS @ INTERFERENCEKEY JT @ FILL SLABNOTES:1. ELIMINATE BARS IF OPENING IS LESS THAN 2'-0" IN BOTH DIMENSIONS.2. REFER TO DETAIL 53/- FOR SLAB ON GRADE SUBGRADE SUPPORTRECTANGULAR ORROUND OPNGASOG OPENING0256-03-CU20 - S301NTSLAP SPLICELAP SPLICELAP SPLICELAP SPLICECONCRETE INTERSECTIONCONCRETE CORNERCONCRETE END0" TYP.0" TYP.0" TYP0" TYPDOWELS TO MATCH SIZE &SPCG OF HORIZ REINF, TYP90 DEG HOOK@ INT BARSPROVIDE 90 DEG STD HOOK, A U-BARMAY BE PROVIDED W/ LAP SPLICE TOHORIZ BARS IN LIEU OF END HOOKSNOTE:REINFORCEMENT SHOWN ON WALL ELEVATION(S),BOUNDARY REINFORCING DETAILS, AND OTHERSPECIFICALLY REFERENCED DETAILS SHALL TAKEPRECEDENCE OVER REINFORCEMENT SHOWN HERE.DOUBLE MATLAP SPLICELAP SPLICELAP SPLICELAP SPLICECONCRETE INTERSECTIONCONCRETE CORNERCONCRETE ENDPROVIDE 90 DEG STDHOOK @ SHEAR WALLS(2) BARS TO MATCHWALL VERT REINF MIN(2) BARS TO MATCHWALL VERT REINF MIN(2) BARS TO MATCHWALL VERT REINF MINDOWELS TO MATCHSIZE & SPCG OFHORIZ REINF, TYPALT DOWEL DIRECTION@ INTERSECTIONSINGLE MATCONC REINF @ INTERSECTION0256-03-CU20 - S301NTS"SL" STEP LENGTH= 2 "SH""SH""SH""D" + "SL""D"DEPTH OF FTGFTG EL = SEE PLAN"SH" STEPHEIGHTTOP REINF WHERESHOWN PER PLAN"ls' LAP SPLICETYP"D" + "SL""SL" STEP LENGTH= 2 "SH""ls' LAP SPLICETYPSSSTEP LONG REINF TO MATCHLONG REINF SIZE & SPCGSTEP TRANS REINF TO MATCHTRANS REINF SIZE & SPCGFTG REINF PERPLAN & DETAILS"SH" STEPHEIGHTSSNOTE: "SH" = 1'-6" MAXLAP SPLICEDOWEL TO MATCHLONG REINF SIZE & SPCGPLANCALLOUTSTEP FOOTING0256-03-CU20 - S301NTSNOTES:1. PREPARATION OF THE SLAB SUBGRADE SHALL BE BASED ON THE GEOTECHNICAL INVESTIGATION REPORT ASREFERENCED IN THE FOUNDATION GENERAL NOTES. THE FOLLOWING INFORMATION IS FOR REFERENCE ONLY.A. OVER-EXCAVATION SHALL EXTEND 5 FEET BEYOND PERIMETER FOUNDATION, TO PROPERTY LINES OREXISTING IMPROVEMENTS, WHICHEVER IS LEAST.B. NATIVE MATERIALSa. SHALL BE OVER-EXCAVATED 30" BELOW (E) GRADE OR 12" BELOW BOTTOM OF FOOTINGS, TOCOMPETENT MATERIAL, OR TO 12 THE DEPTH OF THE DEEPEST FILL (MEASURED FROM THE BOTTOMOF THE DEEPEST FOOTING); WHICHEVER IS GREATEST.b. THE EXPOSED SURFACE SHALL BE SCARIFIED TO A DEPTH OF 6", MOISTURE CONDITIONED TO 3PERCENT OVER OPTIMUM MOISTURE CONTENT AND COMPACTED TO A MINIMUM RELATIVEDENSITY OF 90 PERCENT (ASTM D1557)C. ENGINEERED COMPACTED FILLa. REFER TO THE GEOTECHNICAL INVESTIGATION REPORT FOR RECOMMENDATIONS FORSTRUCTURAL FILLb. STRUCTURAL FILL SHALL BE PLACED IN HORIZONTAL LAYERS, EACH APPROXIMATELY 8" THICKBEFORE COMPACTION, AND SHOULD BE CONDITIONS WITH WATER TO PRODUCE A SOIL WATERCONTENT NEAR OPTIMUM MOISTURE AND COMPACTED TO A MINIMUM RELATIVE DENSITY OF 90PERCENT (ASTM D1557)D. 4" THICK, CLEAN FREE-DRAINING MATERIAL SUCH AS 12" COARSE AGGREGATEE. REFER TO GEOTECH REPORT AND ARCH DRAWINGS FOR VAPOR BARRIER. INSTALL PER MANUFACTURER'SRECOMMENDATIONS FOR SEALING OF PENETRATIONS, JOINTS AND EDGES.a. VAPOR BARRIER IS NOT TO BE PUNCTURED DURING CONSTRUCTION OF SLAB ON GRADE.F. 2" THICK OPTIONAL SAND LAYER, SHALL BE LIGHTLY MOISTENED PRIOR TO PLACING CONCRETE.THICKNESS PER PLANVAPOR BARRIER (SEE NOTE 1E)FREE DRAINING MATERIAL (SEE NOTE 1D)STRUCTURAL COMPACTEDFILL (SEE NOTE 1C)WIDTH(SEE NOTE 1A)NATIVE FILL(SEE NOTE 1B)1-12" CLR CVR @ 4" SLAB2" CLR CVR @ 5"+ SLABFIN GRADEPERPLAN11T.O. SLABEL = PER PLAN12SLAB PER PLANSLAB ON GRADE EDGE AND SUBGRADE PREP0256-03-CU20 - S301NTSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-3011222324213233343Page 215 of 802 POST PIER FOOTING0256-03-CU20 - S302 - 13NTS2'-0" Ø, TYPBOT 2'-0"SPIRALS W/ 3" PITCH3" CLRMIN, TYP6"MIN#3 SPIRALS(6) #4 VERT REINFHSS POSTPER PLAN3"CLRMID SECTIONSPIRALS W/ 6" PITCHTOP 2'-0"SPIRALS W/ 3" PITCH5'-6"HSS PER PLANFINISH GRADESLOPE TOP SURFACE OF PIERAWAY FROM POLECONC PIER FTGSECTION A-AAA℄ POST & PIER#4 VERT REINF, TYP#3 SPIRALS, TYP4" MINTYP3" MIN TYPRE-ENTRANT CORNERISOLATION JT @ EACOL THRU SLABCONTRACTION/CONTROLOR CONSTR JT STRAIGHT &CONT NOT STGRJT SPCG5'-0" MIN36 x " t ", 18'-0" MAXL/W = 2 MAX(2) DIAGONAL ADDBARS AT RE-ENTRANTCORNER(2) DIAG ADD BARS @RE-ENTRANT CORNER" W "CONTRACTION JT AREAS SHOULDBE SQUARE OR RECTANGULAR,NOT "L" OR "T" SHAPED.CONTRACTION JOINT18" THK SAW-CUT ORPREMOLDED INSERTSLAB DEPTH, " t "CONSTRUCTION JOINT (TYPICAL)18" THK SAW-CUTSLAB DEPTH, " t ""t"/434"" t "/4" t "/213ISOLATION JOINTISOLATION JTNOTES:1. IF SAW CUT CONTRACTION OR CONTROL JOINT IS USED, SAW-CUT WITHIN 24 HOURS. EARLY ENTRY SAWS MAY BE USED WITHIN 1-4 HOURS OF POUR, AND CONVENTIONAL SAWS 4-12 HOURS OF POUR DEPENDING ON WEATHER.2. FILL CONTRACTION JOINT WITH AN ELASTOMERIC JOINT COMPOUND RATED FOR ITS USE. FOR INDUSTRIAL FLOORS SUBJECTED TO HARD WHEELED TRAFFIC, USE SEALANTS RATED FOR SUCH APPLICATIONS BY THE MANUFACTURER.3. DOWELS IN INDUSTRIAL FLOOR APPLICATIONS SHOULD BE SMOOTH ALIGNED, AND SUPPORTED SO THEY WILLREMAIN PARALLEL IN BOTH HORIZONTAL AND VERTICAL PLANES DURING PLACING AND FINISHING.4. IN STEEL AND/OR CONC. BUILDINGS DO NOT POUR DIAMOND UNTIL STRUCTURAL STEEL AND CONCRETE ABOVE HAS BEEN INSTALLED.COLUMN ISOLATION JOINTWALL PER PLANELASTOMERICJT SEALANTPRE-FORMED JT FILLERCONC REINFPER PLANSLAB SUBGRADEPREP PER 53/-SLAB SUBGRADEPREP PER 53/-ISOLATION JT AROUNDEQUIPMENT FOUNDATIONSCONTRACTION ORCONSTRUCTION JTCOL PER PLANBASE PL, WOFILL AROUND COLAFTER FLOOR IS CASTCONC REINFPER PLAN℄ COL" t "/4SLAB ON GRADE JOINTS0256-03-CU20 - S302NTSBOT OF FTGEL = PER PLAN"ls' LAP SPLICETYPPIPE ØTOP REINF PER PLAN & TYP DETAILS12"12"FTG DEPTHPER PLANPIPE Ø+ 4"3"CLR216" MIN"d/3" MAX SLEEVE OPNG'S SHALLONLY OCCUR IN MIDDLE THIRD"d/3""d"@ PENETRATION6" MIN"d/3"BOT REINF PER PLAN &TYP DETAILSDOWELS TO MATCHTYP REINF SIZE & SPCGPIPE SLEEVE, SLEEVE SHALL BE (2) SIZESLARGER THAN PIPE ØSLEEVE THROUGH FOUNDATION (SLAB TURN-DOWN)0256-03-CU20 - S302NTS1SEE PLAN6" MAXSLAB SUBGRADE PREPPER DETAIL 53/-12"31" CLRTHICKNESS PER PLANCONC REINFPER PLANT.O. SLABEL = PER PLANCONC #4 @ STEPSLAB ON GRADE DEPRESSION0256-03-CU20 - S302 - 23NTSLAP SPLICE, TYPSEE PLAN1'-0" MAX1'-0"LAP SPLICE, TYP210"DOWELS TO MATCHSIZE & SPCGSTD HOOK#4 NOSING BARSTEP, WO#4 BARS @ 18" OC (2 MIN PER STEP)ALTERNATIVELY, BARS MAY BE EPOXIED W/SIMP SET-XP (ICC-ESR 2508) W/ 2" EMBEDCURB, WO, W/ #4 @18" OC(VERT) & # 4 @ TOP (HORIZ)SOG PER PLANSTEP IN CONCRETE SLAB ON GRADE0256-03-CU20 - S302NTS1'-6"MIN9"FTG PIPEBACKFILLPER SPECSTRENCH EXCAVATION,TYP21 PIPEBOT OF TRENCH EXCAVATION SHALLNOT EXTEND BELOW THIS LINE UNLESSAPPROVED BY THE GEOTECHNICALENGINEERGRADENOTES:1. CONTRACTOR SHALL COORDINATE ALL PIPE LOCATIONSWITH BUILDING FOUNDATION REQUIREMENTS.2. IF REQUIREMENTS AS SHOWN CANNOT BE MET STEPFOOTING PER TYPICAL "STEPPED FOOTING" DETAILSPIPES PARALLEL TO FOOTINGS0256-03-CU20 - S302NTS34S-30133S-301PIPES PERPENDICULAR TO FOOTINGS W/ STEM WALL0256-03-CU20 - S302NTS3'-0" MAX(SEE NOTE #1)4"MIN6" MIN1'-6" MINSLEEVE3D MIN"D"Ø OF SLEEVESTEM WALLFOOTINGNO PIPES PERMITTED IN THIS AREAELEVATIONSECTIONNOTES:1. FOOTINGS SHALL BE STEPPED PER DETAIL 33/ & 34/S-301 SO THAT THIS DIMENSION DOES NOT EXCEED 3'-0".2. CONTRACTOR SHALL COORDINATE ALL PIPE LOCATIONS WITH BUILDING FOUNDATION REQUIREMENTS.3. TRENCH BELOW FOOTING SHALL BE FILLED WITH CONCRETE OR 3-SACK SLURRY BEFORE POURINGFOOTING. CONCRETE FILL SHALL BE SAME WIDTH AS FOOTING AND FULL WIDTH OF PIPE TRENCH.4. PIPES MAY BE WRAPPED IN 1" THICK LOOSE FOAM IN LIEU OF SLEEVING.5. CONDUIT MAY BE RUN THRU STEM OR ENCASEMENT UNDER FOOTING WITHOUT SLEEVES OR FOAM WRAP.2"SLEEVE 2" LARGERTHAN OD OF PIPE(SEE NOTE #4)PIPES PERPENDICULAR TO FOOTINGS0256-03-CU20 - S302NTS3'-0" MAX(SEE NOTE #1)4" MIN6" MIN1'-6" MINSLEEVE3D MINDØ OF SLEEVESOG PER PLANSOG PER PLANFOOTINGFOR PIPES IN THIS AREA SEE DETAIL 32/S-301ELEVATIONSECTIONNOTES:1. FOOTINGS SHALL BE STEPPED PER DETAIL 33/ & 34/S-301 SO THAT THIS DIMENSION DOES NOT EXCEED 3'-0".2. TRENCH BELOW FOOTING SHALL BE FILLED WITH CONCRETE OR 3-SACK SLURRY BEFORE POURINGFOOTING. CONCRETE FILL SHALL BE SAME WIDTH AS FOOTING AND FULL WIDTH OF PIPE TRENCH.3. PIPES MAY BE WRAPPED IN 1" THICK LOOSE FOAM IN LIEU OF SLEEVING.4. CONDUIT MAY BE RUN THRU STEM OR ENCASEMENT UNDER FOOTING WITHOUT SLEEVES OR FOAM WRAP.STEM WALLWIDEN FTG FOR VERTPIPE & CONDUITPENETRATIONCONC OR SLURRYPER 52/- OR 53/-9" MINTYPD, ØOF SLEEVE3 x DTYPSLEEVE 2" LARGERTHAN OD OF PIPE(SEE NOTE 1)#4 T&B24246"MINNOTES:1. PIPES MAY BE WRAPPED IN 1" THICK LOOSE FOAM IN LIEUOF SLEEVING.2. CONDUIT MAY BE ROUTED UP THROUGH FOOTINGWITHOUT SLEEVES OR FOAM WRAP.AELEVATIONAPLANTYPICAL VERT PIPES OR COND THROUGH FOOTING0256-03-CU20 - S302NTSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-30211412232421323334311Page 216 of 802 LAP SPLICEEQ.EQ.WIDTH "W"PER PLANCMU WALL PER PLANBOT TRANSVERSE "T"BARS PER PLANTOP LONGITUDINAL "L"ADD BARS PER PLAN(WHERE OCCURS)BOT LONGITUDINAL"L" BARS PER PLANDOWEL TO MATCH VERT WALL REINFFTG PER PLAN2"CLR3"CLR2" CLR IF FORMED3" CLR IF CAST AGAINSTEARTH, TYP0"THICKNESS "T"PER PLANFINISH GRADE(EXT SLAB, WO)TOP TRANSVERSE "T"ADD BARS PER PLAN(WHERE OCCURS)NOTE: CONTRACTOR TO COORDT.O.F. SUCH THAT CMU COURSINGCORRESPONDS W/ FINISH FLOORCURB PER 31/-, WOLAP SPLICEROUGHEN JOINT TO 14" AMPLITUDESOG PER PLANDOWEL TO MATCH SLABREINF SIZE & SPACING8" CMU EXTERIOR WALL FOUNDATION0256-03-CU20 - S311 - 113/4" = 1'-0"MIN EMBEDBELOW PADPER PLANDOWEL TO MATCH SLABREINF SIZE & SPACINGSOG PER PLANCMU WALL PER PLANFTG PER PLANLAP SPLICESOG PER PLANSEE DETAILFOR INFONOT SHOWN11-8" CMU INTERIOR WALL FOUNDATION0256-03-CU20 - S311 - 123/4" = 1'-0"WIDTH "W"PER PLANCMU WALL BEYONDFINISH GRADE(EXT SLAB, WO)DOWEL TO MATCH SLABREINF SIZE & SPACINGFTG PER PLANEXTEND SLAB, WOSEE DETAILFOR INFONOT SHOWN11-OPENING @ CMU WALL FOUNDATION 0256-03-CU20 - S311 - 133/4" = 1'-0"DEPRESSED SLAB PER PLANFFPER ARCHPER PLANCURB PER 31/-, WOLAP SPLICECMU WALL PER PLANFTG PER PLANSEE DETAILFOR INFONOT SHOWN11-8" CMU EXTERIOR WALL FOUNDATION0256-03-CU20 - S311 - 213/4" = 1'-0"CMU WALL BEYONDWIDTH "W"PER PLANFINISH GRADE(EXT SLAB, WO)FTG PER PLANDOWEL TO MATCH SLABREINF SIZE & SPACINGEXTEND SLAB, WODEPRESSIONPER PLAN (3" MAX)LAP SPLICELAP SPLICESEE DETAILFOR INFONOT SHOWN11-8" CMU EXTERIOR WALL FOUNDATION0256-03-CU20 - S311 - 223/4" = 1'-0"WIDTH "W"PER PLANCMU WALL BEYONDDOWEL TO MATCH SLABREINF SIZE & SPACINGFTG PER PLANSEE DETAILFOR INFONOT SHOWN13-OPENING @ CMU WALL FOUNDATION 0256-03-CU20 - S311 - 233/4" = 1'-0"FTG & REINF PER PLANHOOPS PER PLANVAPOR BARRIER. TERMINATE ATTHE TOP OF THE FOOTING OF ATWO POUR INSTALLATION, TYPNOTE:SLAB REINF NOTSHOWN FOR CLARITYTIE BEAM0256-03-CU20 - S311 - 321" = 1'-0"BAPROVIDE STEGO CRETE CLAWTAPE OR APPROVED EQUAL PERMFR. INSTALLATION INSTRUCTIONS.GRADE BM PERPLAN & REINFPER PLANTHICKNESS PER PLANDEPTH PER PLANWIDTH PER PLAN3" CLRTYPFINISH GRADEOR FLATWORKSOG PER PLANFTG PER PLANADDL #4 IF CURB HT EXCEEDS 6"STD HOOKCURB HEIGHTPER ARCH#4 @ TOP#4 @ 18" OCEMBED BELOW PADPER PLAN"ldh"FOR (1) POUR"ldh"FOR (2) POURWALL SHTGPER ARCHESWALL FOOTING WITH RAISED CURB1326-01-CI18_S-411_331" = 1'-0"STIRRUPS PERFTG SCHEDMETAL STUDSPER ARCH38" Ø X 6" AB W/ PL WASHER @24" OC MAX & 8" MAX FROMENDS OF TRACK PER ARCHPER PLANPER PLAN3" CLRTYP3" CLRTYPBOT REINF PER PLANSOG PER PLANBOT OF FTGEL = PER PLANEXPANSION JOINTTHK "D" PER PLANLINE OF CONTFTG BEYONDTOP REINF PERPLAN, WOEXTEND CONT FTGREINF THRU PAD FTGCOLD JOINT, CLEAN &ROUGHEN SURFACETO 14" AMPLITUDESTL COL PER PLAN3" MIN CONC COVERAROUND BASE PLEXT PAVING PER CIVILBASE PL OVER 1 12 " NON-SHRINKGROUT, PER DETAIL 42B/S-051℄ COL &STUDSSTEEL COL @ EXTERIOR FTG0256-03-CU20 - S3031" = 1'-0"1'-0"EMBEDCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-3031121311222321323334341113/16PL 1/4" X 4" SQW/ 1/2" DIA A307BOLT IN 9/16" X 1 1/2"SLOT VERT IN ONE PLHORIZ IN OTHER PLEND PL1/4"X6"X2"HSS BM PER PLANHSS COL PER PLAN1Page 217 of 802 "db""6 db""D""6 db" *"db""D"135 HOOK90 HOOK*BAR SIZE D#31 12"#4 2"#5 2 12"OR 3" MIN"ldh""db""db""4 db"2 12" MIN"D""D""12 db"" l h"12"MINBAR SIZE D#3 THRU #86db#9 THRU #118dbHOOK DEVELOPMENT LENGTH(SEE SCHED)FACE OFMASONRYBAR SIZEDEVELOPMENT LENGTH (ld) ORLAP SPLICE LENGTH (ls)HOOKDEVELOPMENTLENGTH (le)Dln#3 2'-3" 0'-5" 2 145"#43'-0" 0'-7" 3 8"#5 3'-9" 0'-9"3 3410"#6 4'-6" 0'-10" 4 121'-0"#7 5'-3" 0'-12"5 141'-2"#86'-0" 1'-1" 61'-4"#96'-9" 1'-3"9 121'-7 12"NOTES:1. USE DEVELOPMENT LENGTH (ld) AND SPLICE LENGTH (ls) INDICATED IN SCHEDULE FOR ALL DOWEL LENGTHS NOT SHOWN ON PLANS UNLESSOTHERWISE PERMITTED BY THE SEOR AND JURISDICTION AGENCY2. DEVELOPMENT LENGTHS (ld) AND SPLICE LENGTHS (ls) INDICATED IN SCHEDULE CORRESPOND TO GRADE 60 BARS IN 1,500 OR 2,500 psi NORMALWEIGHT MASONRY3. THIS SCHEDULE SHALL BE USED WHERE DEVELOPMENT AND SPLICE LENGTHS ARE NOT SPECIFICALLY DETAILS AND DIMENSIONED ON THEDRAWINGS4. WHERE BARS OF DIFFERENT SIZES ARE LAP SPLICED, SPLICE LENGTH SHALL BE THE SPLICE LENGTH OF THE SMALLER BARS5. NOTE THAT THE LAP SPLICES SHOWN ACCOUNT FOR THE INCREASE IN LAP SPLICE IN REGIONS OF MOMENT WHERE THE DESIGN TENSILE STRESSES INTHE REINFORCEMENT ARE GREATER THAN 80 PERCENT OF THE ALLOWABLE STEEL TENSION STRESS, Fs6. D = FINISHED INSIDE BEND DIAMETER7. db = NOMINAL BAR DIAMETERCONTACT LAP SPLICE(PREFERRED)NON-CONTACT LAP SPLICELAP SPLICEPER SCHEDMAX = SMALLER OF"ls"/ 5" OR 8"LAP SPLICEPER SCHEDLAP SPLICEPER SCHEDLAP SPLICEPER SCHED"db"CLEARSPCGCLEARSPCGTYPICAL LAP SPLICESSTAGGERED SPLICINGFACE OF MASONRYOR JT @ STD HOOK212TYPICAL COLUMN BAR OFFSETMASONRY-LAP SPLICE / DEVELOPMENT LENGTH SCHED0256-03-CU20 - S401NTS"H"(SEE SCHED BEL)LAP SPLICE(SEE DETAIL M-TYP-001)CLEAR SPANDEVELOPMENT LENGTH(SEE DETAIL M-TYP-001)TOWJAMB BARS3"CLREXTEND JAMB BARS TO BOT OF FTG& PROVIDE STD 90° HOOKEXTEND JAMB BARS FLR TO FLR OR FLR TO ROOFWHERE OPNG EXCEEDS 4'-0" IN WIDTH FOR ALLOTHER CONDITIONS (EXTEND BAR BEYOND EDGEOF OPNG FULL DEVELOPMENT LENGTH OR 2'-0" MIN)FOR TYP LINTEL REINF SEE DETAIL M-TYP-003WHERE EXTENSION OF FULL DEVELOPMENTLENGTH OF LINTEL & SILL REINF BEYOND EDGEOF OPNG IS NOT POSSIBLE, PROVIDE MINHOOKED DEVELOPMENT LENGTH PER M-TYP-001EDGE OF WALLBOT OF THK SLAB ORCONT WALL FTGWALL REINF ON RECTPENETRATION PERM-M-007WALL REINF ON ROUNDPENETRATION PERM-M-006(2) TYP BARS @ JAMB & SILL(2) #4 MINNOTES:1. ALL CELLS SHALL BE GROUTED SOLID, UNO2. WALL CONSTRUCTION SHALL BE RUNNING BOND ONLY3. WALL THICKNESS PER PLAN4. PROVIDE CMU LINTELS AT ALL CMU WALL OPENINGS, UNO5. PRECAST CONCRETE LINTELS MAY BE USED WITH ARCHITECT'S & SEOR'S APPROVAL6. ALL MASONRY OPENINGS SHALL BE SHORED UNTIL MASONRY HAS CURED FOR A MIN OF 72 HOURS7. REFER TO ARCHITECTURAL & MECHANICAL, ELECTRICAL & PLUMBING DRAWINGS FOR SIZE & LOCATIONS OFOPENINGS. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO VERIFY & PROPERLY SIZE ALL CMU WALL OPENINGS8. HORIZ REINF SHALL BE PROVIDED WITHIN 16 INCHES OF THE TOP & BOT OF THE WALL9. WALL OPENINGS SHALL NOT BE CLOSER THAN 24" FROM THE TOP OF THE EDGE IN ORDER TO ACCOMMODATETHE WALL LINTEL10. MIN SEPARATION BETWEEN OPENINGS SHALL ACCOMMODATE THE NUMBER OF ROWS OF JAMB BAR REINF11. SEE GENERAL NOTES FOR MORE INFOSEE SCHED BEL FORTYP WALL REINFCMU WALL REINFORCING SCHEDULEWALL THICKNESS(NOMINAL)BAR SIZE & SPACING EACH MATMAXIMUMHEIGHTHORIZONTAL VERTICAL REMARKS6"#4 @ 24" OC #4 @ 24" OCSINGLE MAT 12'-0"8"#5 @ 24" OC #5 @ 24" OCSINGLE MAT 16'-8"12" #5 @ 24" OC #5 @ 24" OCDOUBLE MAT 25'-0"TYPICAL CMU WALL ELEVATION0256-03-CU20 - S401NTS12" TYP FROM INSIDEFACE OF CELLTOP OF WALLSTD 90° HOOK TURNINTO PLANE OF WALLTYP HORIZ WALLREINF PER SCHEDTYP VERT WALLREINF PER SCHEDTYP HORIZ WALLREINF PER SCHED"U" BARS TO MATCHVERT REINF, TYP2 BARS AT TOP MIN( (2) #4 MIN)SINGLE MATDOUBLE MATTYP REINF AT TOP OF WALL0256-03-CU20 - S401 - 23NTSCONCRETE MASONRY WALL PIERS0256-03-CU20 - S401 - 33NTS'T' TO LESS THAN 3x'T'BLOCK THICKNESS'T'3T TO 5TJAMB REINFJAMB REINFEA END#3 TIES @ 8" OCTIES SAME SIZE & SPACINGTO MATCH SPECIFIED REINFNOTE:TIE MAY BE TURNED UP AS NECESSARY TO FIT INSIDE WALL.BREAK WEBS AND/OR INTERIOR FACE SHELL AS REQUIREDBLOCK THICKNESS'T'OPNG SHALL BE 12 BLKMODULES IN WIDTH,FULL BLK MODULES INHT (MAX OPNG 24" x24" UNO)STOP TYP WALL REINF@ BLOCKOUTUTILITY PER MEP DWGSROUND PENETRATIONSSHALL BE CORED AFTERWALL HAS BEENGROUTED (COREDHOLE MUST LIE WITHINTHIS AREA & BEREINF AS SHOWNCMU WALL PER PLANADD VERT BARS EASIDE OF OPNG TOMATCH TYP WALL BARS((2) BARS @ WALLS W/2 MATS OF REINFADD HORIZ BARS EA SIDE OF OPNG TO MATCH TYPWALL BARS ( (2) BARS @ WALLS W/ 2 MATS OF REINF)ROUND PENETRATION IN MASONRY0256-03-CU20 - S401 - 41NTSTYP WALL REINF, WOTYP WALL REINF, WOOPNG SHALL BE 12 BLKMODULES IN WIDTH,FULL BLK MODULES INHT (MAX OPNG 24" x24" UNO)STOP TYP WALL REINF@ BLOCKOUTCMU WALLPER PLANUTILITY PERMEP DWGSRECTANGULAR PENETRATION IN MASONRY0256-03-CU20 - S401 - 42NTSADD VERT BARS EASIDE OF OPNG TOMATCH TYP WALL BARS((2) BARS @ WALLS W/2 MATS OF REINFADD HORIZ BARS EA SIDE OF OPNG TO MATCH TYPWALL BARS ( (2) BARS @ WALLS W/ 2 MATS OF REINF)TYP WALL REINF, WOTYP WALL REINF, WOMASONRY ANCHOR BOLT SCHEDULE0256-03-CU20 - S401 - 43NTSMIN EMBED1" MIN GROUTALL AROUNDANCHOR BOLTFACE OF MASONRYBOLT SIZEMINIMUMEMBEDMENT12"4"58"5"34"6"78"7"1" 8"1 18"9"1 14" 10"NOTES:1. MINIMUM BOLT SPACING SHALL BE 16 BOLT DIAMETERS WITH A MINIMUM EDGEDISTANCE OF 12 DIAMETERS, UNLESS NOTED OTHERWISE.2. PROVIDE AN ADDITIONAL 2" OF EMBEDMENT FOR ANCHOR BOLTS LOCATED INTHE TOP OF COLUMNS.3. ANCHOR BOLTS SHALL BE HEX HEADED WITH THE DIMENSIONS OF THE HEXCONFORMING TO ANSI/ASME B18.2.1 BENT BAR ANCHORS SHALL NOT BE USED.MAX FOR 8"MASONRYMAX FOR 12"MASONRY1" CLRMINCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-40141224213233343Page 218 of 802 TEMPLATE 18" THK,SAME SIZE AS BASE PLTOP OF FTGTOP OFBASE PLALT LOCATIONFOR TEMPLATEBASE PL (CONTRACTOR TOVERIFY TOTAL PROJECTIONPRIOR TO FTG POUR)3" MIN AB PROJECTION ABV112" MIN, 2" MAXNON-SHRINK GROUT, UNOLEVELINGNUTANCHOR BOLT PROJECTION1326-01-CI18_S-051-43NTS12"12"℄ STL COL14"CMU WALLPER PLANBASE PL 14" W/ 58" Ø THR "CFL"NELSON STUD (ICC-ESR 2856)6" MINEMBEDCOL PER PLANEND CONDITIONCORNER CONDITIONCMU WALLPER PLAN112" CLRTYP12"12"8"3 12"3 12"112" CLRTYP4" MINTYP℄ OF WALL,PL, HSS &BOLTSEQEQCENTER CONDITIONELEVATION112"TYP8"12"TYPCMU WALLPER PLAN4" MINTYPEQEQ112"TYP8"112"TYP℄ OF WALL,PL, HSS &BOLTS312"312"℄ HSS &PL312"312"℄ HSS &PL312"312"312"312"8"CMU WALLPER PLANHSS @ CMU WALL0256-03-CU20 - S4021-1/2" = 1'-0"NOTES:1. TIES SHOWN AT LINTELS ARE IN ADDITION TO ALL TYP WALL REINF2. LINTEL DESIGN IS BASED ON MEDIUM WT (124 PSF) MAX FULLY GROUTED CONC MASONRY CONSTRUCTION3. WALL CONTROL JOINTS SHALL NOT OCCUR WITHIN DEVELOPMENT LENGTH OF LINTEL REINFLINTEL DEPTH (D)PER SCHED, UNODOUBLE MATSINGLE MATTOW OPNG HORIZREINF PER SCHEDSTD CMU LINTEL WALLCELLS GROUTED SOLID &LINTEL REINF PER SCHED8" MINBRGTYP JAMB REINFPER ELEVATIONJAMB @ EDGEOF OPNGMATCH WALL LINTEL TIES TOWALL REINF PER M-TYP-002WALL REINFPER SCHEDBOND BM UNITLINTEL REINFPER SCHEDU-BEAM UNIT3"CLR3"CLRSTD 90° HOOKLAP SPLICETYPICAL CMU REINFORCEMENT SCHEDULETYPEMAX CLR SPAN (FT) D (IN)SOLID-GROUTED MASONRY WALL LINTELREINFORCEMENT SCHEDULEWALL HORIZABOVE LINTEL8" WALLS 12" WALLSL1 5'-4"15 58"(2) #4 (2) #5 #4 @ 24" OCL210"-8"15 58"(2) #4 (2) #5 #4 @ 24" OCL3 12'-0"15 58"(2) #5 (2) #6#4 @ 24" OCL414'-0"15 58"(2) #5 (2) #6#4 @ 24" OCELEVATIONTYPICAL CMU LINTEL DETAILS0256-03-CU20 - S402 - 22NTS24-22-NOTE: MAX CONTROL JOINT SPACING = 20'-0" OC32-34-CONTROL JTHORIZ REINF PERREINF SCHED ORWALL ELEVVERT REINF PERREINF SCHED ORWALL ELEV, TYPCONTROL JOINT AT NON-SHEAR CMU WALLM-TYP-012NTSINTERSECTIONPLAN - DOUBLE MATCORNER/ENDCORNER/ENDSTD 90° HOOK& ALTERNATEBREAK SHELL FORFLOW OF GROUTOPEN END BLK(2) #5 VERT MINSTD 90° HOOK& ALTERNATEBREAK SHELL FORFLOW OF GROUTOPEN END BLKPROVIDE 180° HOOKAT SHEAR WALL(2) #5 VERT, MINPROVIDE 135° HOOKAT SHEAR WALL(2) #5 VERT MINSTD 90° HOOK(3) #5 VERT MINBREAK SHELL FORFLOW OF GROUTOPEN END BLKBREAK SHELL FORFLOW OF GROUTSTD 90° HOOK(2) #5 VERT MINSTD 90° HOOK, TYPOPEN END BLKINTERSECTIONPLAN - SINGLE MATMASONRY WALL CORNER DETAIL0256-03-CU20 - S402NTSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-402224213233343Page 219 of 802 TYP CONTROL JT SPCGEQUAL TO 1.5H OR 25' (WHICHEVER IS LESS)"d2"252 1/2LENGTH, FTLENGTH / HEIGHT RATIOMAXIMUM WALL PANEL DIMENSIONS"d1""d1"SPAN < 6'-0""d2"SPAN > 6'-0""d2"1/2 CONTROLJT SPCG MAXRECTANGULAR BUILDING PLANIRREGULAR BUILDING PLANELEVATIONTYP CONTROL JT SPCGEQUAL TO 1.5H OR 25' (WHICHEVER IS LESS)RETAINING WALLCONTROL JOINTCONTROL JOINTNOTE:1. THE CONTRACTOR SHALL SUBMIT THE INTENDED CONTROL JOINT LOCATIONS TO THESEOR FOR REVIEW AND APPROVAL.1/2 CONTROLJT SPCG MAXTYP CONTROL JT SPCGEQUAL TO 1.5H OR 25' (WHICHEVER IS LESS)CONTROL JOINTMASONRY CONTROL JOINT SPACING0256-03-CU20 - S403NTS38"MORTAR JTRAKED 12" DEEPVERT REINF PERREINF SCHEDOR WALL ELEVHORIZ REINF PERREINF SCHEDOR WALL ELEVSINGLE MAT50% OF HORIZ WALL REINF & ADDED REINFSHOWN ON SECTIONS OR STRUCT WALLELEVATIONS SHALL BE CONTIOUS THRU CJCONTROL JOINT W/ CONT REINFORCEMENTM-TYP-013NTSVERT REINF PERREINF SCHEDOR WALL ELEVHORIZ REINF PERREINF SCHEDOR WALL ELEVSTOP HORIZ BARSES OF JTBACKUP RODCAULKINGCONTROL JOINTM-TYP-014NTS38"PROVIDE 1/2" X 4'-0" LONG SMOOTH DOWELSGREASED OR WITH PLASTIC SLEEVE W/ SPCGTO MATCH HORIZ REINFMASONRY WALLCAULKING SEALANT, CONT ESALT CONTROL JOINT W/ FLANGED NEOPRENE0256-03-CU20 - S403NTSVERT REINF PERREINF SCHEDOR WALL ELEVHORIZ REINF PERREINF SCHEDOR WALL ELEVSTOP HORIZ BARSES OF JTPROVIDE 1/2" X 4'-0" LONG SMOOTH DOWELSGREASED OR WITH PLASTIC SLEEVE W/ SPCGTO MATCH HORIZ REINFFLANGED NEOPRENECONTROL JT, CONT VERT38"HORIZ REINF PERREINF SCHEDOR WALL ELEVVERT REINF PER REINFSCHED OR WALL ELEV,EA SIDE OF JTMORTAR JOINTRAKED 12" DEEP12"CLR50% OF HORIZ WALL REINF & ADDED REINFSHOWN ON SECTIONS OR STRUCT WALLELEVATIONS SHALL BE CONTIOUS THRU CJDOUBLE MATCONTROL JOINT W/ CONT REINFORCEMENT0256-03-CU20 - S403NTSPROVIDE 1/2" X 4'-0" LONG SMOOTH DOWELS GREASED ORWITH PLASTIC SLEEVE W/ SPCG TO MATCH HORIZ REINF38" TO 12"HORIZ REINF PERREINF SCHEDOR WALL ELEV12"CLRBACKUP RODVERT REINF PERREINF SCHEDOR WALL ELEVSTOP HORIZ BARSES OF JTCAULKINGCONTROL JOINT 0256-03-CU20 - S403NTSPROVIDE 1/2" X 4'-0" LONG SMOOTH DOWELS GREASED ORWITH PLASTIC SLEEVE W/ SPCG TO MATCH HORIZ REINFHORIZ REINF PERREINF SCHEDOR WALL ELEV12"CLRCAULKINGSEALANT, CONT ESVERT REINF PERREINF SCHEDOR WALL ELEVSTOP HORIZ BARSES OF JTFLANGED NEOPRENECONTROL JT, CONT VERTALT CONTROL JOINT W/ FLANGED NEOPRENE0256-03-CU20 - S403NTSPROVIDE 1/2" X 4'-0" LONG SMOOTH DOWELS GREASED ORWITH PLASTIC SLEEVE W/ SPCG TO MATCH HORIZ REINFCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-40331413242133343Page 220 of 802 CEILING16 GA STUDS @ 16" OC UNO@ CABINETS OR EQUIP4'-0" MAX16'-0" MAX6"MIN6"MINMTL STUD WALL FRMG - FULL HTSTL BM PERPLAN, PARATO WALL,WOBOT OF SUPPORTDUCT OPNG,WO13S-06231S-06231S-06254-23S-06233S-06243S-06252-14C-14B-14G-14A-14C-14G-14C-14D-14F-14E-14G-@ NON-BRGWALL ONLY14S-062@ NON-BRGWALL ONLY14B-@ BRGWALLMETAL STUD WALL FRAMING ELEVATION (BEARING & NON-BEARING)0256-03-CU20 - S404 - 111/4" = 1'-0"WALL STUD BRCGWHERE REQD,SEE DETAILMTL STUDS @ 16" OC, TYP,SEE DETAILCABINETSOR EQUIPPROVIDE (1) BAY OF BLK EA SIDE OFOPNGS TOP, BOT & MID-HEIGHT,SEE DETAILSTL BM PER PLAN PERPTO WALL, WO,SEE DETAILT.O. CONC SLAB ORCONC CURB, WOSILL, WOLINE OF CONT BRIDGING@ MID-HEIGHT OF WALL,SEE DETAILBACKING FOR CABINETS OREQUIP ANCHORAGE, TYP,SEE DETAILDBL STUDS (MIN) AT JAMBS OF ALL OPNGS TYP UNOOR (1) 16 GA DIETRICH HDS PROVIDE (4) STUDSAT JAMBS OF ADJ OPNGS OR (2) DIETRICH HDS(AT OPNGS OVER 10'-0" WIDE PROVIDE(2) DIETRICH HDS, MIN)BOT TRACKLINE OF LINTEL @BEARING WALL,WO11S-0624'-0" MAX @ NON-BRG(WHERE SPAN EXCEEDS 4'-0",PROVIDE LINTEL IN LIEU OFTRACK ABV PER 14B/- )1/8ES1/8ES~31-1812 GA x3" STRAP @ 2'-0" OCES W/ #10 SMS EA ENDJAMB STUDS OR HDS(3) #10 SMS EA ENDPRICELESSPRICE LESS CLIPPER SCHED ABV(2) #10 SMS BOT OFPRO-X HDR TO CLIPLINTELALINTEL TO JAMB1/81/81/8 1-12@ WELDEDSTUDSTRACK PER PLAN W/ #10SMS @ 12" OC EA FLANGE12 GA x 3" STRAP @ 2'-0" OCES W/ #10 SMS EA END(1) #10 SMS ESJAMB STUDS OR HDS(2) #10 SMS16 GA CONT TRACKCUT WEB @ FLANGES& BEND WEB DOWN1/8ES1/81/8MTL STUDSCONT BOT TRACK#10 SMS EA FLANGE (2)#10 SMS EA FLANGE @ HDSAT SCREWABLE STUDCTRACK TO JAMBDSTUD TO TRACKAT SCREWABLE STUDAT WELDED STUDBHEADER SECTION#10 SMS @ 12" OCWALL STUDS16 GA CONT TRACKAT WELDED STUDAT SCREWABLE STUDESFEGTYPICAL INTERSECTIONTYPICAL CORNER MULTIPLE STUDSSTUD, TYPOUTLINE OF WALL, TYP#10 SMS @ 3'-0" OC(PER NOTE 6)1/81/81/8 1-181/81/81/8 1-18@ WELDED STUDSONLY, TYPSTUD, TYPOUTLINE OFWALL, TYP#10 SMS @ 3'-0" OC(PER NOTE 6)ADDL STUD @ OPNGSGREATER THAN 4'-0"DBL STUD OR (1)DIETRICH HDSSEE A FORFASTENING STUDSOUTLINE OFWALL, TYPNOTES:1. SEE METAL STUD AND TRACK SCHEDULES ON THIS SHEET FOR ADDITIONAL INFORMATION.2. SEE ARCHITECTURAL AND STRUCTURAL DRAWINGS FOR SIZE OF STUDS.3. ALL TOP AND BOTTOM TRACKS SHALL BE SAME GAUGE AS STUDS UNO.4. ALL STUDS AT JAMBS OF DOOR AND WINDOW OPENINGS SHALL BE 16 GAUGE UNO.5. WELDING SHALL BE IN ACCORDANCE WITH STRUCTURAL WELDING CODE - SHEET STEEL, AWS D1.3 BY THE AMERICAN WELDING SOCIETY.6. PROVIDE EITHER WELDED OR CREWED CONNECTIONS AT CONTRACTOR'S OPTION. OMIT SHEET METAL SCREWS AT WELDED STUD CONDITIONS.TRACK PER PLAN W/ #10 SMSEA FLANGE, EA STUD@ WELDED STUDSONLY, TYPMETAL STUD WALL FRAMING0256-03-CU20 - S404 - 13NTSSTUD PER PLAN CONT, ESOPTION 1PRICELESSHEADERPRICELESSCLIPCLIP TOJAMBCLIP TOHEADER550HDR350-54 550HDR 350-54(6) @10 SMS (6) #10 SMS550HDR450-68 550HDR 450-54(8) @10 SMS (6) #10 SMS#10 SMS @ 12" OC#8 SMS @ 12" OCPRICELESS HDRPER PLANOPTION 2WALL STUDSWALL COVERING WO. WHERE WALLCOVERING OCCURS ONE SIDE,STUD BRCG IS REQD ON OPP SIDEDIST FROM T.O. WALL COVERINGTO CL OF STUD BRCG SHALL NOTEXCEED MAX SPCG AS INDICATEDON MTL STUD AND TRACK SCHEDSMTL STUD WALLCL OF STUDBRCG, TYP12S-062STUD BRCG,SEEBOT OF SUPPORTT.O. SUPPORTWALL STUD BRACING LOCATION0256-03-CU20 - S404 - 31NTSNOTES:1. SEE ARCHITECTURAL AND STRUCTURAL DRAWINGS FOR SIZE AND GAUGE OF STUDS.2. DIMENSIONS, PROPERTIES AND TYPES NOTED ARE BASED ON METAL STUDS AND TRACKSBY STEEL STUD MANUFACTURERS ASSOCIATION (SSMA) ICBO NO 4943 UNO.HDS STUD SCHEDULEDEPTH GAUGE B AAREA(IN2)I (IN4) S (IN3)MAX SPACINGOF STUDBRACING3 5/8"16 3 1.0625" 0.715 1.483 0.818 4'-0"4"16 3 1.0625" 0.736 1.869 0.934 4'-0"6" 16 3 2.25" 0.984 4.856 1.619 4'-0"8" 16 3 2.25" 1.097 9.843 2.461 4'-0"DIETRICH HDS PER ICC ESR-2374BDEPTHO.D.ATYPSTUD SCHEDULEDEPTH GAUGE BAREA(IN2)I (IN4) S (IN3)MAXSPACINGOF STUDBRACINGSSMADESIGNATOR2 1/2"201 5/8".223 .236 .188 4"-0" 250S162-33181 5/8".289 .302.2424'-0" 250S162-43161 5/8".358 .370 .296 4"-0" 250S162-543 5/8"201 5/8".262.551.304 4'-0" 362S162-33181 5/8".340 .710 .392 4"-0" 362S162-43161 5/8".422.873 .482 4'-0" 362S162-54141 5/8".524 1.070 .590 4'-0" 362S200-684"201 5/8".275 .692 .346 4'-0" 400S162-33181 5/8".375 .892 .446 4"-0" 400S162-43161 5/8".443 1.098 .549 4'-0" 400S162-545 1/2"201 5/8".327 1.458 .530 4'-0" 550S162-33181 5/8".424 1.883 .685 4"-0" 550S162-43161 5/8".528 2.324 .845 4'-0" 550S162-54141 5/8".657 2.860 1.400 4'-0" 550S162-686"201 5/8".344 1.793 .598 4"-0" 600S162-33181 5/8".447 2.316 .772 4'-0" 600S162-43161 5/8".556 2.860 .953 4"-0" 600S162-548"201 5/8".413 3.582 .896 4'-0" 800S162-33161 5/8".670 5.736 1.434 4"-0" 800S162-5414 2"0.907 8.140 2.035 4'-0" 800S200-6810" 162".839 11.278 2.256 4"-0" 250S200-5412" 14 2"1.192 21.947 3.658 4'-0" 1200S200-68BDEPTHO.D.PRO-X SCHEUDLEWIDTH GAUGE BAREA(IN2)I (IN4) S (IN3)PRO-X CLIP3 5/8"164 1/4"0.786 1.182 0.445 362 CLIP-544"164 1/4"0.808 1.230 0.456 400 CLIP-546" 164 1/4"0.921 1.452 0.504 600 CLIP-548" 164 1/4"1.034 1.625 0.537 800 CLIP-54BRADY PRO-X PER ICC ESR-1765WIDTHI.D.BTRACK SCHEDULEDEPTH GAUGE BAREA(IN2)I (IN4) S (IN3)SSMADESIGNATOR2 1/2"201 1/2".190 .221 .167 250T150-33181 1/2".248 .289 .217 250T150-43161 1/2".311 .368 .273 250T150-544"201 1/2".242 .622 .300 400T150-33181 1/2".315 .811 .390 400T150-43161 1/2".396 1.025 .489 400T150-545 1/2"201 1/2".294 1.295 .459 550T150-33181 1/2".383 1.688 .596 550T150-43161 1/2".480 2.128 .747 550T150-546"201 1/2".311 1.590.517600T150-33181 1/2".405 2.072 .673 600T150-43161 1/2".509 2.611 .843 600T150-548"201 1/2".380 3.180 .781 800T150-33161 1/2".622 5.214 1.272 800T150-54141 1/2".783 6.594 1.599 800T150-6810" 161 1/2".735 9.0611.777250T150-5412" 141 1/2"1.068 18.148 2.963 1200T150-68DEPTHI.D.BMETAL STUD SCHEDULE0256-03-CU20 - S404 - 43NTSPRICELESS HEADER SCHEDULEWIDTH GAUGEAREA(IN2)I (IN4) S (IN3)SADDLE CLIP PART NO.3 5/8"16 1.368 2.514 .907 362 C350-54 350HDR350-543 5/8"141.713.242 1.201 362C350-54 350HDR350-685 1/2"16 1.594 3.203 1.032 550C350-54 550HDR350-545 1/2"142.28 7.236 2.055 550C450-54 550HDR450-68PRICELESS HEADER PER ER-0342WIDTHCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-40411134331Page 221 of 802 MTL STUDS PER PLANPIECE OF TRACK OR STUDSAME GA AS STUDSTYP, EA END1/8 118 GA & HEAVIER STUDSMTL STUD PER PLANPIECE OF TRACK OR STUDSAME GA AS STUDS (CUTWEB @ FLANGES & BEND UP)(2) #8 SMS20 GA & HEAVIER STUDSMETAL STUD BLOCKING0256-03-CU20 - S405 - 11NTS20 GA x 1 18" CONT STRAPW/ (1) #10 SMS SCREWTO EA STUDMTL STUD PER PLANSPLICE @ OF BLKG,WHERE REQD(8) #10 SMSTO BLKGSTUD BLKG @ EA END OFWALL & @ 8'-0" OC MAXSEE DET11-℄ OFBRCG℄METAL STUD BRACING0256-03-CU20 - S405 - 12NTSAT WELDED STUD18"TYPBRIDGING CLIP @ EA STUD(2) #8 SMS, EA LEGCONT 1 12" x 16 GAUGECOLD ROLLED CHANNELMTL STUD18"TYPBRIDGING CLIP @ EA STUDCONT 1 12" x 16 GAUGECOLD ROLLED CHANNELMTL STUD1/8 1AT SCREWABLE STUDMETAL STUD BRIDGING0256-03-CU20 - S405 - 13NTSMTL STUD (VERT)PER PLAN#6 SCREWS, TYPSLIPTRACK SYSTEMS 16 GA SLOTTEDSLIP TRACK OR APPRVD EQUAL2 1 2 " TYP 5 8 " TYP 1 1 4 "TYPSEE SCHED14"TYP1"TYPSEE CCENLARGED ISOMETRIC VIEWNTSAISOMETRIC VIEWBSECTION VIEWNON-BEARING METAL STUD TOP TRACK0256-03-CU20 - S405 - 21NTS12"CLRFACE OF CMU WALLCEILING JSTPER SCHED16 GA JST W/ 12" AB @4'-0" OC & 1'0" MAXFROM ENDS OF PIECEBLKG @ 4'-0" OC @ PARA JSTSOR CEILING JST, PER SCHED#10 SMS EA FLANGE EA STUDJST PARA TOWALL, WOMTL STUD WALLPER PLAN16 GA TRACK W/ (2) #10 SMS PER EA4" STUD & (3) #10 SMS EA 6" STUD20 GA CONT BLKG16 GA TRACK W/ (2) #10SMS EA FLANGE EA STUD20 GA CONT BLKGCEILING JSTPER SCHEDCEILING JOIST SCHEDULEJOIST SIZE MAX SPAN4" x 20 GA @ 16" OC7'-6"6" x 20 GA @ 16" OC9'-0"NOTE:THIS DET IS INTENDED FOR CEILING JSTS THATSPAN FROM WALL TO WALL @ CONTRS OPTIONAAGAINST CMU WALLBAGAINST WALLCON T.O. WALLNON-BRG MTLSTUD WALLPER PLANCEILING JOIST SCHEDULE & DETAILS0256-03-CU20 - S405 - 22NTS618"4"618"4"CONT BOT TRACK W/ HILTI DS (0.177" DIA) LOW VELOCITY FASTENER(ICC ES ESR-1663) @ 2'-0" OC AND 6" MAX FROM ENDS (PROVIDEFASTENERS @ 16" OC WHERE CABINETS OR EQUIP IS ANCH TO WALL)1 716" MIN EMBED (2) FASTENERS MIN PER PIECE OF TRACKDEPRESSED SLAB, WOCONC SOGMTL STUD WALLPER PLANCONT BOT TRACK W/ 38" HILTI KWIK BOLTKB-TZ (ICC ES ESRI-11917) @ 2'-0" OC & 6"MAX FROM ENDS 2 12" MIN EMBED (2) MINPER PIECE OF TRACKDEPRESSED SLAB, WOCONC SOGMTL STUD WALLPER PLAN#4 CONT#4 @ 18" OCNOTE:SHOT PINS NOT ALLOWEDIN CURBS OR SLAB EDGESBAT CURB ON SOGAAT SOGNON-BEARING METAL STUD BOTTOM0256-03-CU20 - S405 - 23NTS℄ STL BMEQ12"CLREQ8"MAXCONT NON-BRGSLIP TRACK SEE DET1 12" COLD ROLLEDCHANNEL @ 4'-0" OC(2) #10 SMS @EA CHANNELMTL STUD WALLPER PLAN1/8 1BPARA TO STEEL BEAMAPERP TO STEEL BEAMSTL BMNON-BRGSLIP TRACKMTL STUD BLKG,SEE DETPROVIDE STUDBRCG (2) BAYSEA SIDE OF BM,SEE DET11-12-21-NON-BRG METAL STUD TOP @ STL BM (FULL HEIGHT WALL)0256-03-CU20 - S405 - 31NTSMTL STUD WALLPER PLANSHTG PER PLAN& SCHEDBPERP TO JSTSAPARA TO JSTSCONT NON-BRG SLIPTRACK PER DET21-SHTG PER PLAN& SCHEDNON-BEARING PARTITION TOP CONNECTION 0256-03-CU20 - S405 - 33NTSCONT NON-BRG SLIPTRACK PER DET21-BS ALONG BLKG(N) OR (E)MTL JST(2) #10 SMS EA BLK16GA MTL BLKG@ 48" OC(N) OR (E)MTL JST(2) #10 SMS EA JSTMTL STUD WALLPER PLANMTL STUD WALLPER PLANBPERP TO JSTSAPARA TO JSTSCONT NON-BRG SLIPTRACK PER DET21-NON-BEARING PARTITION TOP CONNECTION 0256-03-CU20 - S405 - 43NTS(N) OR (E)MTL JST(2) #10 SMS EA BLK16GA MTL BLKG@ 48" OC, CLIPFLG & WEB ASREQ'D @ JSTFLG (DEPTH TOMATCH JST)(N) OR (E)MTL JST(2) #10 SMS EA JSTMTL STUD WALLPER PLANCONT NON-BRG SLIPTRACK PER DET21-CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-405112131122213233343Page 222 of 802 NOTES:1. MINIMUM EDGE DISTANCE FOR FASTENERS SHALL BE 38" FROM SHEATHING EDGE AND 14" FROM MEMBER EDGE.DIAPHRAGM SCHEDULETYPE SHEATHING PANEL GAGE BLOCKING SCREWSBOUNDARY SCREWS(BS)EDGE SCREWS ATCONT. PANEL EDGES(ES)EDGE SCREWS ATOTHER PANEL EDGES(ES)FIELD SCREWS (FS)PANEL EDGE SUPPORT OR NOMINALMEMBER WIDTH AT PANEL EDGESLINES OFFASTENERSA SURE-BOARD SERIES 200S 22 GA YES#8 x 1 58"6666 BLOCKING 1B SURE-BOARD SERIES 200S 22 GA YES#8 x 1 58"4446BLOCKING1C SURE-BOARD SERIES 200S 22 GA YES#8 x 1 58"2226BLOCKING1STAGGERPANEL JTCONT PANEL JTPANEL ENDEDGE SCREWING (BS)PER SCHEDFRMG PERPLANBOUNDARY SCREWING (BS) PER SCHEDSTAGGER NAILING AT PANEL JTSCREW SPCG @PANEL EDGES PER SCHEDNAIL SPCG @PANEL EDGESPER SCHED16" MINPANEL WIDTHBLKG AT PANEL JT(S)FULL HT BLKG AT RIM JSTPER WALL DETAILSCONT RIM JST PERWALL DETAILSFIELD SCREWING (FS)PER SCHEDSTRENGTH AXIS ORIENTED PERP TO SUPPORTSSHTG PER SCHED(2) JST BAYS MINNOMINAL MEMBER WIDTH AT PANELEDGES & BOUNDARIES PER SCHED-13SURE-BOARD PLYWOOD DIAPHRAGM SHEATHING0256-03-CU20 - S406 - 12NTSGAP PERDETAIL 12/-DIAPH BS PERPLAN & SCHED350 T 150-43 FLATBLKG, WHERESPECIFIEDSHTG PER PLAN &DETAIL 12/-MTL JST PER PLAN, TYPSECTIONGAP PERDETAIL 12/-H-CLIPSHTG PER PLAN &DETAIL 12/-H-CLIP WHERE SPECIFIEDAFLAT BLKG WHERE SPECIFIEDADIAPHRAGM PANEL JOINTS0256-03-CU20 - S406 - 13NTSSIMP "S/HJCT"JST HGR, TYPDBL JSTOPNG"D"FOR "D" = 2'-8" MAX,USE (2) JOISTSFOR "D" = 4'-0" MAX,USE (3) JOISTSNOTE:FOR LARGER OPENINGS REFER TO FRAMING PLANS.SIMP "ST12" CENTEREDON JST, TYPES AROUNDOPNG, TYPSIMP "ST12" CENTEREDON MULTIPLE JST, TYPMULTIPLE JST EA SIDE OFOPENINGES ALONG BLKG & JSTFOR A DISTANCE OF 2'-0"@ EA CORNER OF OPNG350T 150-43FLAT BLKG,TYPOPENING AT FRAMING0256-03-CU20 - S406 - 23NTS or 1" = 1'-0"EQEQ4x8 BLKG W/ SIMP"HU" HGR EA END∠ 3x3x 38" W/(2) 58" Ø BOLTS112"3"112"SHTG PER PLAN& SCHED112"134"∠ SEE DETAILB BELOWJST PERPLANAHANGER @ SINGLE JOISTBHANGER @BLKGES ALONG BLKGROD HGR (38"Ø MIN)W/ NUT A&B ∠ROD HGR (38"Ø MIN)W/ NUT A&B ∠JST PERPLANSIMP 'L50' CLIP@ BACK OF JSTSIMP 'SJC8.25'1000S162-54HANGER @ BLKG0256-03-CU20 - S406 - 31NTS100# MAX100# MAXSHTG PER PLAN& SCHEDROOF JSTPER PLANROOF SHTG PERPLAN & SCHEDBLKGSIMP 'L50' CLIP@ BACK OF JSTSIMP 'SJC10.25'LINE OFMECH UNITBLKG TO MATCHDEPTH & GAGEOF JOISTROOF JSTPER PLANOPENING WIDTH≤(1) JST BAYSEE MECH DWGS FOR ANCHORAGE(MIN 38" Ø BOLTS TO BLKG EA CORNER)AAOPENING ≤(1) JST BAYOPENING ≤ (1) JST BAY1326-01-CI18_S-064_33NTSSHTG PER PLAN& SCHEDBDIAG BRACE @ BLKGSHTG PERPLAN & SCHEDROOF JST PERPLANUNISTRUT P1000 DIAG BRACEW/ (2)12" Ø MB TO HINGECONNECTOR (ALT: CABLEBRACE WO, PER MECH)UNISTRUT P1354A HINGE CONNECTORW/ 38" Ø MB TO JST (ALT: UNISTRUT SPF400 OR LS 500 @ CABLE BRACE WO,PER MECH)ADIAG BRACE @ SINGLE JST11ROOF JSTPER PLAN1000S162-54 BLKGSIMP 'L50' CLIP @BACK OF JST2"MAXES ALONG BLKGUNISTRUT P1000 DIAGBRACE W/ (2) 12"ØTHRU-BOLTS TO BLKG113"112"SIMP 'SJC 8.25'2"MAXUNISTRUT DIAG BRACE TOP CONNECTION0256-03-CU20 - S406 - 41NTSBLOCKING PANELSMETAL BRIDGINGJST PER PLANSHTG PER PLAN& SCHEDFASTENING @ BOT OF JSTSHALL BE DONE AFTERROOFING INSTALLATIONSIMP 'LTB' METAL BRIDGING W/ (2) #10SMS EA END @ 12'-0" OC OR MID SPAN,WHICHEVER IS LESS (METAL PIECES SHALLNOT TOUCH)JOIST BRIDGING & BLOCKING0256-03-CU20 - S406 - 42NTSJST PER PLANSHTG PER PLAN& SCHEDCONT 20 GA MTL BLKG PANELSW/ DEPTH TO MATCH JST @ 12'-0"OC OR MID-SPAN, WHICHEVER ISLESSSIMP 'L50' CLIP@ BACK OF JSTSIMP 'FC' CLIP@ JST CAVITYSHTG PERPLAN & SCHEDSEE MECH DWGS FORANCHORAGE (MIN 38"ØBOLTS @ 12" OC, MIN (2)BOLTS EA SIDEDBL JSTPER PLANEN ALONG BLKGCURB PER MECHLINE OF MECH UNITEQUIPMENT SUPPORT PARA JOIST0256-03-CU20 - S406 - 43NTSJST PER PLAN#10 SMS @ 12" OC IN (3)ROWS STGR, FULL LENGTHSIMP 'SJC10.25@ EA RNDBLKG AS REQD FOR ADDLCURB ATTACHMENT, MATCHDEPTH & GAGE OF JSTADDL JST WHEREBLKG OCCURSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-4063112132333434142Page 223 of 802 WEB STIFFENER0256-03-CU20 - S407 - 11NTS(2) #10 SMS SCREWS THRU WEB OFRIM TO WEB STIFFENER FLANGEWEB STIFFENER AT RIM TRACK(3) #10 SMS SCREWSTO JST WEB, TYP3 12" CLARK DIETRICH "QUICK TWIST"WEB STIFFENERWEB STIFFENER INSTALLATIONWEB STIFFENER AT JOIST LAPWEB STIFFENER AT BEARING POINT(3) #10 SMS, TYP6" x 16 GA CONT NOTCHED TRACKANCH BCKG TO (3) STUDS MINMTL STUD PER PLANNOTE:USE #10 SMS WHEN ATTACHINGTIES TO BACKING, UNOBACKING AT METAL STUDS0256-03-CU20 - S407 - 13NTSCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-4072131122232132333434142Page 224 of 802 HSS BM TO CMU WALL0256-03-CU20 - S412 - 21NTS or 1-1/2" = 1'-0"CMU WALL PER PLANNOTCH CMU FOR HSS6" MINEMBED7"x3" BENT PL 316 ES OF HSS W/ 58"Ø HEAD AB W/ LEVELING NUTSTO CMU BEYONDHSS HIP BM1"MAX1" NON-SHRINK GROUT31S-4113163 SIDESHSS BM TO CMU WALL0256-03-CU20 - S412 - 31NTS or 1-1/2" = 1'-0"CMU WALLHSS HIP BMEND PL 316"18PJP( 14 )ACORNER INTERSECTIONB'T' INTERSECTION 14HSS PER PLANHSS PER PLANHSS PER PLANHSS PER PLANHSS TO HSS CONNECTION0256-03-CU20 - S411 - 31NTSKIOSK BEAM @PEAK0256-03-CU20 - S411 - 331" = 1'-0"HSS 6x4PER PLANTYPBABABABA316"TYP B TOA BMCP-TYP ABM T&B316"TYP A TOA BM316"TYP B TOA BMRESTROOM JOIST TO WALL0256-03-CU20 - S411 - 411" = 1'-0"CMU WALL PER PLANPL 12" x 712" CONT W/ 58" Ø HEADED BOLTCENTERED BTWN JSTS & @ 12" MAX FROMENDS OF PL6" MINEMBEDPUNCH OUT4"4"STIFF CLIP LB8000 W/ (4) #8 SELF TAPPINGSCREWS TO MLT JOIST & WALL PL2"TYP1'-4" MINTO PUNCH OUT18 GA BENT PL CONT W/ #8SELF TAPPING SCREWS @ 6"OC TO WALL PLBS6 x 8.2CONT4 x 5.4 @ 4'-0" OC &2'-0" FROM EA CORNER316"CP5"EMBED6 x 8.2 W/ 58" ØHEADED BOLTS℄ 4 & CMUJOINT OR WEBRESTROOM HIP TO SUPPORT BEAMS0256-03-CU20 - S411 - 421" = 1'-0"HSS 10x4x 316316"HSS 8x4x 316 HIP ALIGN BOTOF HSS6 W/ BOT OF HSS10T&BTYP12"GAPHSS HORIZPER ELEV316HSS COLPER PLANL3 x 3 x 14" x 0'-3"T&BL3 x 3 x 14" x 0'-3"T&BTYP1414HSS HORIZ TO HSS COL0256-03-CU20 - S411 - 23NTSTYPHSS PER PLANHSS PER PLAN14" CAP PLHSS COL TO HSS BEAM0256-03-CU20 - S411 - 32NTSHEADER AT STUD WALL0256-03-CU20 - S411 - 221" = 1'-0"SILL SCREWS PERSW SCHEDHSS BMPER PLANWALL SHTGPER PLANESWALL SHTGPER PLANES(2) #10 SMS@ 24" OCHSS HEADER TO COLUMN0256-03-CU20 - S411 - 211" = 1'-0"TYP12"GAPL3 x 3 x 14" x 0'-4" T&BHSS HDR PER PLANMITER CUT ENDS TOMATCH COL ANGLE316(N) HSS COL PER PLAN℄ OF COL℄ OF COLCL OF COLCOL WIDTH +1"(STUD WIDTH MAX)COL WIDTH +1"(STUD WIDTH MAX)112"112"3"TYP3"112"112"℄ STL COL14" SMS @ 24"OC STGR38" CAP PL W/ 34" Ø BOLTS14"( 316 )@ PL WIDTH< COL WIDTH +1"@ CORNERLINE OF TOP PLHSS COL TO TOP PLATE CONN0256-03-CU20 - S411 - 12NTSSTUD TRACK TOMATCH ENDS3"STL COL PER PLAN℄ STL COLTRACK TOPPL, WOTOP PL PER PLAN3166"3"3"112"TIE PL @ METALSTUD TOP PL EASIDE, WOTIE PL PER SCHED BELOWFOR SIZE & BOLTSTIE PLATE SCHEDULEMARK TIE PLATE BOLTS REMARKSA14" x 4"(3) 34" ØB14" x 5"(4) 34" ØC38" x 5"(5) 34" ØTIE PLATE CONNECTION AND SCHEDULE0256-03-CU20 - S411 - 13NTS12" MIN1" MAXCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-411112131122232132333434142Page 225 of 802 PLAN VIEW CANOPY SUPPORT0256-03-CU20 - S412 - 31NTS or 1-1/2" = 1'-0"316C4 TO C66 x 8.2PER PLAN6 x 8.2PER PLANBENT PL 316x3"x6" W/ 58" ØA307 BOLT TO EA 6112"112"112"PLAN VIEW - HSS TO HSS0256-03-CU20 - S412 - 21NTS or 1-1/2" = 1'-0"HSS 6x4 PER PLANEND PL 316 x4"x6"HSS 6x2 PER PLANHSS COL BELOW316TYP18BM HSS TO HSS COL0256-03-CU20 - S412 - 12NTS or 1-1/2" = 1'-0"HSS 6x46 x 8.2CONT4 x 5.4 PER PLAN316"CP21S-412HSS 6x2HSS 4x4316"ADD 14 GA BREAK METAL PER 13/S-412TO ALL HSS ROOF FRAMING TOMATCH ROOF SLOPECANOPY SUPPORT0256-03-CU20 - S412 - 23NTS or 1-1/2" = 1'-0"6 x 8.2CONT4 x 5.4 PER PLAN316"CPHSS 4x4HEADERMTL JSTS TO HSS BM0256-03-CU20 - S412 - 111" = 1'-0"PUNCH OUT1'-4" MIN TYPTO PUNCH OUTEDGE SCREWS PER 12/S-406SHIM @ SLOPED SURE-BOARDHSS PERPLANSIMP 'L50' W/ (6) #12 SMS TO JST &(6) #12 SELF TAPPING SCREWS TOHSS TYPMTL ROOF JSTSPER PLANPLAN VIEW0256-03-CU20 - S412 - 12NTS or 1-1/2" = 1'-0"112"6 PER PLAN∠ 312 x312 x 14 x 3" W/ 58"Ø A307 BOLT EA LEGJSTS TO HSS BM0256-03-CU20 - S412 - 111" = 1'-0"EDGE SCREWS PER 12/S-406SHIM @ SLOPED SURE-BOARDHSS PER PLANSIMP 'L30' SKEWED W/ (2) #12 SMSTO JST & (2) #12 SELF TAPPINGSCREWS TO HSS TYPMTL JSTSPER PLANSURE-BOARD14 GA SHAPED BREAK MTL EA SIDEOF RIDGE - TACK WELD MIN 1"/FTEA LEGCITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & CAFEC. CECILA. MERCADOM. DOREMUSAS NOTED05/11/20230256-03-CU2091439-01S-412112131122232132333434142Page 226 of 802 E-001CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-001_GENERAL NOTES, LEGENDS, AND ABBREVIATIONS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJSURFACEMOUNT CABINETFLUSHMOUNT CABINETSURFACEMOUNT PANELFLUSHMOUNT PANELLCPLIGHTING CONTROL PANELDIMMER3-WAY4-WAYDPSTDUPLEX- FLOOR OUTLETGROUND FAULT CIRCUIT INTERRUPTTV OUTLET-FLOORMOUNTABOVE-CLGMOUNT J-BOXDROP CORD RECEPTPHONE/DATA COMBO FLOOR OUTLETPHONE/DATA COMBO OUTLETDATA FLOOR OUTLETTELEPHONE FLOOR OUTLETJUNCTION BOXTELEPHONE OUTLETMISCELLANEOUSCIRCUIT BREAKERFUSIBLE SWITCHSAFETY DISCONNECTTELEVISION OUTLETGROUNDDATA OUTLETFLOORMOUNT 208V, 1Ø RECEPTSINGLE RECEPT.DUPLEX RECEPT.DOUBLE DUPLEXPOWER/COMM.DUPLEX- HALF SWITCHEDSPECIAL CONFIGURATIONNOTE: INTERPRET IN CONTEXTSURFACE FLUOR.SWITCHESALETTER ADJACENT INDICATES(ARROW INDICATES DIRECTION)FIXTURE TYPESPSTRECESSED WALLMOUNTEXIT LIGHT- CEILINGEXIT LIGHT- WALLWALLPACKPHASEØWALL SURFACEMOUNT LINEAR TYPEUPLIGHT- FLUSH IN GRADEPOLE LIGHT- DECORATIVEPENDANT LINEAR FLUOR.UNDERCABINET LIGHTTANDEM-WIRED LAMPSBOLLARDSTRIP FIXTURE UONDIRECTIONAL FLOODEMERGENCY FIXTUREPOLE LIGHTTRACK LIGHTJTVCJTVGFIJLIGHT FIXTURESLEGENDCEILING SURFACEMOUNTWALL SURFACEMOUNTRECESSED DOWNLIGHTRECESSED WALLWASHRECESSED FLUOR.PENDANT MOUNT(E) POWER HOMERUNINDICATES LINE CONTINUESWIRE LINE- CONTINUESCONDUIT STUB (W/MARKER)VERTICAL CONDUIT RUNFLEXIBLE CONNECTIONSURFACEMOUNT RACEWAYCORD W/PLUGLOW VOLTAGELVCONDUIT SEALNEW POWER HOMERUN(3 HOTS & NEUT SHOWN)CONDUIT/WIREISOLATED GROUNDEXISTING TO REMAINNEWE2D34UNDERGROUNDNUMBERED SHEET NOTES: REFERS TO NOTESON SAME SHEET AS REFERENCEDETAIL REFERENCE:-DETAIL DESIGNATION-SHEET NUMBER REFERENCECONVENTIONSX-1MOUNTED ABOVE COUNTERMOUNTED ABOVE COUNTER*PPNLIGHT POWER PACKVACANCY SENSOROSGENERAL NOTES3103FEEDER SCHEDULE DESIGNATION(EXAMPLE: 3103 = 310 AMPERE, 600V, 3 CURRENT CARRYING CONDUCTORS,'CO14' INDICATES CONDUIT ONLY,PREFIXES: 'M' INDICATES MEDIUM VOLTAGE, QUANTITY (1) AND SIZE (4")SPEAKER- CLG FLUSHMOUNTSSOUNDVACANCY SENSOR WITH DIMMINGOSDWIRELESS ACCESS POINTWIFIWIAVAPAUXILIARY/MICROPHONEWALL FLUSHMOUNTVOLUME CONTROLWALL FLUSHMOUNTWIRELESS SYSTEM-WALL FLUSHMOUNTABBREVIATIONSA AMPEREAB AMP BREAKERABAND ABANDONEDABV ABOVEAC ALTERNATING CURRENTAC-# AIR CONDITIONERADJ ADJACENTAF AMP FUSE, AMP FRAMEAFF ABOVE FINISH FLOORAFG BOVE FINISH GRADEAIC AMPERES INTERRUPTINGCAPACITYAl ALUMINUMAS AMP SWITCH RATINGATS AUTOMATIC TIME SWITCHATS AUTOMATIC TRANSFERSWITCHAV AUDIBLE/AUDIO VISUALAWG AMERICAN WIRE GAGEBFG BELOW FINISH GRADEBIL BASIC IMPULSE LEVELBLDG BUILDINGC CONDUIT-C- CATV CONDUITCAB'T CABINETCATV CABLE TELEVISIONCB CIRCUIT BREAKER, CODEBLUECBC CA. BUILDING CODECEC CA. ELECTRICAL CODECA. ENERGY COMMISSIONCF COMPACT FLUORESCENTCFC CALIFORNIA FIRE CODECLG CEILINGCL CENTER LINECKT CIRCUITCNT'R CONTRACTORC.O. CONDUIT ONLY(W/PULLROPE)COND CONDUIT, CONDUCTORCR CRITICAL BRANCHCSFM CALIFORNIA SFMCT CURRENT TRANSFORMERCu COPPERCU-# CONDENSING UNITD DEPTHDC DIRECT CURRENTDF DRINKING FOUNTAINDIA DIAMETERDISC DISCONNECTDIST DISTRIBUTIONDPST DOUBLE POLE SINGLETHROWDW DISHWASHEREM EMERGENCY(E) EXISTINGEA EACHEB ELECTRONIC BALLASTEC ELECTRICAL CONTRACTOREC-# EVAPORATIVE COOLEREF-# EXHAUST FANEL EVENING LIGHTELEC ELECTRICALEM EMERG BATTERY BACKUPEMERGENCY BALLASTEMERG EMERGENCYEOL END OF LINEEQUIP'T EQUIPMENTES ENERGY SAVING(EXN) (E) IN (N) LOCATION(EXR) (E) TO BE (R)EXT EXTERIORF FLUORESCENT(F) FUTUREF-# FURNACEFA FIRE ALARMFACP FIRE ALARM CONTROL PANELFAT FIRE ALARM TERMINALFAU FORCED AIR UNITFBO FURNISHED BY OTHERSFC-# FAN COILFLA FULL LOAD AMPSFLR FLOORFLUOR FLUORESCENTFS FUSIBLE SWITCHFSAS FIRE STATION ALERTINGSYSTEMFVNR FULL VOLTAGENON-REVERSINGG GROUNDING CONDUCTORGC GENERAL CONTRACTORGD GARBAGE DISPOSALGFCI GROUND FAULT CIRCUITINTERRUPTERGFI GROUND FAULT CIRCUITINTERRUPTERGND GROUNDGRS GALVANIZED RIGID STEELGWS GANG WITH SWITCHH HEIGHT, HIGHHACR HEATING, AC & REFRIGHID HIGH INTENSITY DISCHARGEHO HIGH OUTPUTHOA HAND-OFF-AUTOhp HORSEPOWERHPF HIGH POWER FACTORHPS HIGH PRESSURE SODIUMIC INTERCOMID IDENTIFICATIONIF INSIDE FROSTIG ISOLATED GROUNDJ-BOX JUNCTION BOXk QUANTITY 1000kVA KILOVOLTAMPSkW KILOWATTLC LIGHTING CONTACTORLPS LOW PRESSURE SODIUMLRA LOCKED ROTOR AMPSLS LIFE SAFETY BRANCHLT LIGHTLTG LIGHTINGLV LOW VOLTAGEMC MECHANICAL CONTRACTORMCA MINIMUM CKT AMPSMCB MAIN CIRCUIT BREAKERMCTB MAIN CATV TERMINAL BOARDMCTC MAIN CATV TERMINALCABINETMECH MECHANICALMFR MANUFACTURERMFS MAIN FUSIBLE SWITCHMH METAL HALIDEMLO MAIN LUGS ONLYMOCP MAXIMUM OCPMSB MAIN SWITCHBOARDMT MOUNTMT HT MOUNTING HEIGHTMTS MANUAL TRANSFER SWITCHMTTB MAIN TELEPHONE TERMINALBOARDMTTC MAIN TELEPHONE TERMINALCABINETMW MICROWAVEN NEUTRAL (GROUNDEDCONDUCTOR)(N) NEWN3R NEMA 3RNC NORMALLY CLOSEDNEC NATIONAL ELECTRICAL CODENEMA NAT'L ELECMANUFACTURER'S ASSOCNIC NOT IN CONTRACTNL NIGHT LIGHTNO NORMALLY OPENNPF NORMAL POWER FACTORNTS NOT TO SCALEOC ON CENTEROCP OVERCURRENT PROTECTIONOD OUTSIDE DIAMETEROH OVERHEADOSA OFFICE of the STATEARCHITECTOSHPD OFFICE of STATEWIDEHEALTH PLANNING &DEVELOPMENTOVLD OVERLOADP POLEPA PUBLIC ADDRESSPB PULLBOXPC PULL CHAINPC PHOTOCELLPC PLUMBING CONTRACTORph PHASEPNL PANELPOC POINT OF CONNECTION-PP- POWER PRIMARY-PS- POWER SECONDARYPV PHOTOVOLTAIC(R) RELOCATE(D)RECEPT RECEPTACLEREF REFRIGERATORREQ'D REQUIREDRLA RATED LOAD AMPSRM ROOMRMC RIGID METAL CONDUITRMV REMOVERPLC REPLACERS RAPID STARTSC SIGNAL CABINETSCC SHORT CKT CURRENTSFM STATE FIRE MARSHALSHT SHEETSL SLIMLINE, SWITCH LEGSPEC SPECIFICATIONSPST SINGLE POLE SINGLE THROWSQ SQUARESTR'G STORAGESURF SURFACESVC SERVICESW SWITCHT TRANSFORMER, TERMINAL-T- TELEPHONE CONDUIT(TBR) TO BE REMOVEDTC TIME CLOCKTEL TELEPHONETELCO TELEPHONE COMPANYTS TIME SWITCHTSO TIME SWITCH OVERRIDETSP TWISTED SHIELDED PAIRTTB TELEPHONE TERMINALBOARDTTC TELEPHONE TERMINALCABINETTX TRANSFORMERTYP TYPICALTYP SIM TYPICAL SIMILARUC UNDERCABINET,UNDERCOUNTERUG UNDERGROUNDUGPS UNDERGROUND PULLSECTIONUL UNDERWRITERSLABORATORIESUON UNLESS OTHERWISE NOTEDUSA UG SVC ALERT 800-642-2444VVOLTVA VOLT AMPERESVAC VOLT ALTERNATINGCURRENTVHO VERY HIGH OUTPUTVOLT VOLTAGEVR VANDAL-RESISTANTW WIDTH, WATT, WIREWH-# WATER HEATERWP WEATHERPROOF (NEMA 3R)XFMR TRANSFORMER+48 INDICATES MOUNTINGHEIGHT AFFELECTRICAL DRAWING LISTE-001 ELECTRICAL NOTES, LEGEND, AND ABBREVIATIONSE-002 SINGLE LINE DIAGRAM AND FIXTURE SCHEDULEEK-101 ELECTRICAL KIOSK FLOOR PLANSET24101 ENERGY COMPLIANCE FORMS - INTERIOR LIGHTING (RESTROOM)ED-101~102 ELECTRICAL DEMOLITION SITE PLANSER-101 ELECTRICAL RESTROOM FLOOR PLANSELECTRICAL GENERAL NOTES, LEGEND, ABBREVIATIONS, ANDSCHEDULES1. CODE COMPLIANCE: ALL WORK SHALL CONFORM TO AND BE PERFORMED IN ACCORDANCE WITHCODES, STANDARDS, AND ORDINANCES AS SET FORTH BY THE AUTHORITIES HAVINGJURISDICTION AND THEIR LATEST ADOPTED EDITIONS (IN EFFECT AT TIME OF BUILDING PERMITAPPLICATION) OF THE FOLLOWING PUBLICATIONS:A. CALIFORNIA CODE OF REGULATIONS TITLE 24; INCLUDES 2019 CALIFORNIA ELECTRICALCODE, 2019 CALIFORNIA FIRE CODE, 2019 CALIFORNIA BUILDING CODE, ETC. WITH LOCALAMENDMENTS AS APPLICABLE.B. AMERICANS WITH DISABILITIES ACT (ADA).2. SAFETY: THE ELECTRICAL CONTRACTOR IS RESPONSIBLE TO MAINTAIN ALL EQUIPMENT IN A SAFEAND RESPONSIBLE MANNER. KEEP DEAD FRONT EQUIPMENT IN PLACE WHILE EQUIPMENT ISENERGIZED. CONDUCT ALL CONSTRUCTION OPERATIONS IN A SAFE MANNER FOR EMPLOYEES ASWELL AS OTHER WORKPERSONS OR ANYONE VISITING THE JOB SITE. PROVIDE BARRIERS, FLAGS,TAPE, ETC. AS REQUIRED FOR SAFETY. THE CONTRACTOR SHALL HOLD ALL PARTIES HARMLESSOF NEGLIGENT SAFETY PRACTICES, WHICH MAY CAUSE INJURY TO OTHERS ON OR NEAR THE JOBSITE.3. FIRE RATED ASSEMBLIES SHALL MAINTAIN RATINGS AS SPECIFIED IN THE CALIFORNIA BUILDINGCODE CHAPTER 7. CONTRACTOR SHALL PROVIDE AND INSTALL PHYSICAL ENCLOSURE AROUNDFIXTURES, PANELS, ETC. AS REQUIRED. ALL ASSEMBLIES TO BE PENETRATED SHALL BEINSTALLED WITH APPLICABLE THROUGH-PENETRATION FIRESTOP SYSTEM AS DETERMINED BY ULCLASSIFICATION. BEFORE CONSTRUCTION, VERIFY AND COMPLY WITH REQUIREMENTS OF LOCALAUTHORITY HAVING JURISDICTION.4. MOUNTING HEIGHTS SHALL BE AS FOLLOWS UNLESS OTHERWISE NOTED:+15" AFF: RECEPTACLES, TELEPHONE, TV & DATA OUTLETS. (MEASURED BOTTOM OF OUTLETBOX)+46" AFF: OUTLET ABOVE COUNTER (MEAUSRED TOP OF OUTLET BOX)+48" AFF: LIGHT SWITCHES. (MEASURED TOP OF OUTLET BOX)+48" AFF: FIRE ALARM MANUAL PULL STATIONS, T-STATS. (MEASURED TOP OF OUTLET BOX)THE LOWER OF +80" AFF TO BOTTOM OF LENS, OR 6" BELOW CEILING: FIRE ALARM VISUALS.ELECTRICAL SWITCHES: CONTROLS AND SWITCHES INTENDED TO BE USED BY THE OCCUPANT OFTHE ROOM OR AREA TO CONTROL LIGHT AND RECEPTACLE OUTLETS, APPLIANCES OR COOLING,HEATING AND VENTILATING EQUIPMENT, SHALL BE LOCATED NO MORE THAN 48 INCHESMEASURED FROM THE TOP OF THE OUTLET BOX NOR LESS THAN 15 INCHES MEASURED FROMTHE BOTTOM OF THE OUTLET BOX TO THE LEVEL OF THE FINISH FLOOR OR WORKING PLATFORM.[CBC 11B-308.1.1]ELECTRICAL RECEPTACLE OUTLETS: ELECTRICAL RECEPTACLE OUTLETS ON BRANCH CIRCUITSOF 30 AMPERES OR LESS AND COMMUNICATION SYSTEM RECEPTACLES SHALL BE LOCATED NOMORE THAN 48 INCHES MEASURED FROM THE TOP OF THE RECEPTACLE OUTLET BOX ORRECEPTACLE HOUSING NOR LESS THAN 15 INCHES MEASURED FROM THE BOTTOM OF THERECEPTACLE OUTLET BOX OR RECEPTACLE HOUSING TO THE LEVEL OF THE FINISH FLOOR ORWORKING PLATFORM [CBC 11B-308.1.2]BEFORE ROUGH-IN, VERIFY ALL MOUNTING HEIGHTS AND EXACT LOCATIONS FOR ALL EQUIPMENTELECTRICAL CONNECTIONS, STUB-UPS, RECEPTACLES, OUTLETS, ETC. WITH ARCHITECT OROWNER. PLACE DEVICES LOCATED ABOVE COUNTERS, SHELVING, ETC. AND IN BATHROOMS SO ASNOT TO CONFLICT WITH EDGES OF WAINSCOTING, COUNTER SPLASH, SHELVING, ETC.ARCHITECTURAL SHEETS SHALL GOVERN.4. LABEL PANELS, CABINETS, BACKBOARDS, MAIN DEVICES, SAFETY SWITCHES, CONTACTORS ANDOTHER SPECIFICALLY DESIGNATED EQUIPMENT SHOWN ON PLANS. USE ENGRAVED LAMINATEDPLASTIC NAMEPLATES ATTACHED BY SCREWS OR RIVETS. FOR FEEDERS, NEATLY AND INDELIBLYLABEL CONDUIT DESTINATIONS ON BOTH VISIBLE ENDS OF CONDUIT RUNS WHERE CONDUITSTERMINATE AT DESIGNATED ENCLOSURES, STRUCTURES OR EQUIPMENT (INCLUDING PULL ANDSPLICE BOXES).5. EQUIPMENT ANCHORAGE NOTEALL MECHANICAL AND ELECTRICAL EQUIPMENT SHALL BE ANCHORED OR BRACED TO MEET THEHORIZONTAL AND VERTICAL FORCES PRESCRIBED IN THE 2019 CBC, SECTIONS 1613A AND 1616AAND ASCE 7-10 SECTIONS 13.3, 13.4 & 13.6.THE ATTACHMENT OF THE FOLLOWING ITEMS SHALL BE DESIGNED TO RESIST THE FORCESPRESCRIBED ABOVE, BUT NEED NOT BE DETAILED ON THE PLANS PER 2019 CBC SECTION1616A.1.18:A. FURNITURE(EXCEPT STORAGE CABINETS AS NOTED IN 2019 CBC TABLE 13.5-1)B. TEMPORARY OR MOVABLE EQUIPMENT WITH EXCEPTIONS NOTED IN 2019 CBC SECTION1616A.1.18 ITEM 2.C. ARCHITECTURAL, MECHANICAL, AND ELECTRICAL COMPONENTS IN SEISMIC DESIGNCATEGORIES D, E, OR FTHAT MEET ALL OF THE CRITERIA LISTED IN 2019 SECTION 1616A.1.18 ITEM 3.D. EQUIPMENT WEIGHING LESS THAN 20 POUNDS SUPPORTED BY VIBRATION ISOLATORS.E. EQUIPMENT WEIGHING LESS THAN 20 POUNDS SUSPENDED FROM A ROOF OR FLOOR ORHUNG FROM A WALLFOR THOSE ELEMENTS THAT DO NOT REQUIRE DETAILS ON THE APPROVED DRAWINGS, THEINSTALLATION SHALL BE SUBJECT TO THE APPROVAL OF THE MECHANICAL/ELECTRICAL ENGINEER.PIPING, DUCTWORK, AND ELECTRICAL DISTRIBUTION SYSTEM BRACING NOTEPIPING, DUCTWORK, AND ELECTRICAL DISTRIBUTION SYSTEMS SHALL BE BRACED TO RESIST THEFORCES PRESCRIBED IN ASCE 7-10 SECTION 13.3 AS DEFINED IN ASCE 7-10 SECTION 13.6.8, 13.6.7,AND 13.6.5.5, ITEM 6, RESPECTIVELY.THE BRACING AND ATTACHMENTS TO THE STRUCTURE SHALL COMPLY WITH ONE OF THE OSHPDPRE-APPROVALS WITH AN OPA#, SUCH AS MASON INDUSTRIES (OPA 349), OR ISAT (OPA 485) ASMODIFIED TO SATISFY ANCHORAGE REQUIREMENTS OF ACI 318, APPENDIX D.COPIES OF THE MANUAL SHALL BE ON THE JOBSITE PRIOR TO STARTING HANGING AND BRACING OFTHE PIPE, DUCTWORK, AND ELECTRICAL DISTRIBUTION SYSTEMS.THE STRUCTURAL ENGINEER OF RECORD SHALL VERIFY THE ADEQUACY OF THE STRUCTURE TOSUPPORT THE HANGER AND BRACE LOADS.MREFER TO SPECIFICATIONS 26 0519 FOR ADDITIONAL INFORMATION.1. WIRE CONNECTORS SHALL BE MINIMUM 75 DEGREE CENTIGRADE RATED ANDPROPERLY SIZED FOR THE NUMBER OF CONDUCTORS BEING CONNECTED,TERMINATED, SPLICED, ETC. ALL ABOVE GRADE CONNECTORS SHALL BE SOLDERLESSLUG OR PLASTIC WIRE NUT TYPE, SCREW ON, PRESSURE CABLE TYPE (WIRE UT ORSPRING NUT TYPE) 600 VOLT, 105 DEGREE C, WITH SKIRT TO COVER ALL PORTIONS OFSTRIPPED WIRES. CONNECTOR SHALL BE U.L. RATED FOR NUMBER AND SIZE OFCONDUCTORS BEING JOINED TOGETHER AS SPLICED.2. WIRES AND CABLES FOR LINE VOLTAGE SYSTEM AND CONTROLS. WIRE AND CABLESHALL BE COPPER, 600 VOLT RATED THROUGH OUT. CONDUCTORS 14AWG OT 10AWG,SOLID OR STRANDED. CONDUCTORS 8 AWG AND LARGER, STRANDED3. ALL CONDUCTORS SHALL BE COPPER UNLESS OTHERWISE NOTED. MINIMUM SIZE FORINDIVIDUAL CONDUCTORS SHALL BE #12 AWG UNLESS OTHERWISE NOTED ON PANELSCHEDULE OR PLANS. SIZE #8 AWG AND LARGER SHALL BE STRANDED CONDUCTOR.INDIVIDUAL CONDUCTORS SHALL BE INSULATED WITH TYPE, XHHW, THW, THHN/THWN600 VOLT INSULATION UNLESS OTHERWISE NOTED.4. PROPER INSULATION TYPE SHALL BE USED FOR THE PROPER ENVIRONMENTALAPPLICATION (I.E. WATERPROOF, WET LOCATION, PLENUM TEMPERATURE RATED). ALLCONDUCTORS, WIRING CABLE WHERE INSTALLED BELOW FLOOR, SLAB ORUNDERGROUND SHALL BE CONSIDERED WET LOCATIONS, AND SHALL BE RATEDACCORDINGLY. NON WATERPROOF CABLING IS NOT ALLOWED IN ANY BELOW GRADEOR WET APPLICATION.5. GROUP THE COMMON NEUTRAL CONDUCTOR FOR MULTIPLE CIRCUITS WITH ITSASSOCIATED UNGROUNDED CONDUCTORS WHEN CONTAINED IN THE SAMEENCLOSURE. CEC 200.4(B)6. THE BRANCH CIRCUIT SERVING EMERGENCY LIGHTING AND POWER CIRCUITS SHALLNOT BE PART OF A MULTIWIRE BRANCH CIRCUIT. CEC 700.19.CONDUCTORS AND CABLESCONDUIT SYSTEMS USED ON THIS PROJECT SHALL BE AS FOLLOWS1. PVC SCHEDULE 40 - underground/below slab with GRS elbows and risers tape wrapped).2. ELECTRICAL METALLIC CONDUIT (EMT) - above grade/slab in building construction and whereexposed above 8'-0" aff.3. GALVANIZED RIGID STEEL (GRS) - where exposed below 8'-0" aff. and/or where subject tophysical damage.4. FLEXIBLE STEEL CONDUIT - above ceilings and/or concealed in building construction (seal tightflex rquired in exterior locations).5. MC CABLE ALLOWED IN OCCUPANCY R2 ZONES ONLY.REFER TO SECTION 260533 & 260500 OF SPECIFICATIONS FOR ADDITIONAL INFORMATION.CONDUITS SHALL BE MINIMUM 1/2" UNLESS OTHERWISE NOTED, 3/4" FOR ALL HOME RUNCONDUITS AND WHERE ROUTED BELOW SLAB OR UNDERGROUND. CONDUIT SIZES, WHERENOT NOTED ON THE DRAWINGS, SHALL BE SIZED FOR MAXIMUM 40% FILL PER CEC 310-6.ADDITIONAL CONDUIT REQUIREMENTS.- ROUTE CONDUIT(S) BELOW GRADE OR ABOVE CEILING SO THAT WALL OUTLETS,DEVICES, AND CONDUITS IN ALL EXPOSED BRICK WALL LOCATIONS SHALL BERECESSED MOUNTED INSIDE BRICK. LOCATE DEVICES AT CELL WITHREINFORCEMENT CENTER AT BRICK AND/OR ONE CELL OVER AWAY FROM JAMB.REFER TO ARCHITECTURAL AND STRUCTURAL PLANS FOR CMU WALL LOCATIONSSECTIONS, AND DETAILS.- NO CONDUITS OR PIPING IN ANY SPACE SHALL BE EXPOSED AT THE CEILING ANDWALL (COORDINATE WITH ALL DISCIPLINES PRIOR TO CONSTRUCTION). LOCATE ALLCONDUIT WITHIN WALLSCONDUIT SYSTEMS NOTESA. ALL 15 AND 20AMPERE RECEPTACLES FOR BOTH DAMP AND WET LOCATIONSREQUIRED TO BE LISTED WEATHER-RESISTANT (WR) TYPE PER CEC 406.9 (A) AND (B)B. CEC 406.9(A) RECEPTACLES IN DAMP LOCATIONS: RECEPTACLES INSTALLEDOUTDOORS IN A LOCATION PROTECTED FROM THE WEATHER OR IN OTHER DAMPLOCATIONS SHALL BE AN ENCLOSURE FOR THE RECEPTACLE THAT ISWEATHERPROOF WHEN THE RECEPTACLE IS COVERED (ATTACHMENT PLUG CAP NOTINSERTED AND RECEPTACLE COVERS CLOSE)C. CEC 406.9(B) RECEPTACLES OF 15 AND 20AMP, 125 AND 250 VOLTS INSTALLED IN AWET LOCATION SHALL HAVE AN ENCLOSURE THAT IS WEATHERPROOF WHETHER ORNOT THE ATTACHMENT PLUG CAP IS INSERTED. AN OUTLET BOX HOOD INSTALLEDFOR THIS PURPOSE SHALL BE LISTED AND SHALL BE IDENTIFIED AS 'EXTRA-DUTY"OTHER LISTED PRODUCTS, ENCLOSURES, OR ASSEMBLIES PROVIDINGWEATHERPROOF PROTECTION THAT DO NOT UTILIZE AN OUTLET BOX HOOD NEED TOBE MARKED "EXTRA DUTY"D. EXCEPTION: 15 AND 20AMP, 125 THROUGH 250 VOLT RECEPTACLES INSTALLED IN AWET LOCATION AND SUBJECT TO ROUTINE HIGH-PRESSURE SPRAY WASHING SHALLBE PERMITTED TO HAVE AN ENCLOSURE THAT IS WEATHERPROOF WHEN THEATTACHMENT PLUG IS REMOVED.E. ALL 15 AND 20AMPERE RECEPTACLES FOR BOTH DAMP AND WET LOCATIONSREQUIRED TO BE LISTED WEATHER-RESISTANT (WR) TYPE PER CEC 406.9.F. ALL GFCI PROTECTION MUST BE READILY ACCESSIBLE.RECEPTACLES AT DAMP AND WETLOCATIONE-003~E-005 ELECTRICAL DETAILSES-101 ELECTRICAL SITE PLANET24101 ENERGY COMPLIANCE FORMS - INTERIOR LIGHTING (KIOSK)A. UTILITY COMPANY CONTACTS: BEFORE CONSTRUCTION, COORDINATE & VERIFY ALL UTILITYCOMPANY REQUIREMENTS:PACIFIC GAS AND ELECTRIC (PG&E)JUSTIN McDONALD805-546-1271JKMO@PGE.COMAPPLICATION #124816031B. TRENCHING AND BACKFILLING FOR ALL CONDUIT SYSTEMS SHALL BE THE RESPONSIBILITY OFTHE ELECTRICAL CONTRACTOR. ALL CONDUITS SHALL HAVE MINIMUM COVER REQUIREMENTS ASSPECIFIED IN CEC 300-5. MORE STRINGENT DEPTH REQUIREMENTS MAY BE IMPOSED BY UTILITYCOMPANY AND / OR THIS SPECIFICATION. JOINT TRENCHING MAY BE UTILIZED WHEREPRACTICABLE AND WERE PERMITTED BY THIS SPECIFICATION.C. LOCATIONS OF EXISTING UNDERGROUND (UG) UTILITY SYSTEMS SHALL BE DETERMINED BYCALLING UNDERGROUND SERVICE ALERT (USA). WHEN PLANNING UNDERGROUND WORK, ANDBEFORE YOU DIG, CONTACT UNDERGROUND SERVICE ALERT (USA) AT LEAST 48 HOURS PRIOR TOEXCAVATION (WEEKENDS EXCLUDED) FOR THE LOCATION OF UNDERGROUND GAS AND ELECTRICLINES OR EQUIPMENT.D. MAINTAIN REQUIRED CLEARANCES FROM ALL SANITARY SEWER, WATER AND STORM DRAINPIPING. REFER TO CIVIL PLANS FOR EXACT LOCATIONS AND DEPTHS OF PIPING.E. ALL SITE UTILITY WORK SHALL BE INSTALLED PER THE UTILITY COMPANY ISSUED CONSTRUCTIONDRAWINGS AND SPECIFICATIONS SPECIFIC TO THIS PROJECT. ANY UTILITY WORK PERFORMEDWITHOUT PRIOR UTILITY COMPANY APPROVAL SHALL BE DONE AT THE CONTRACTOR'S RISK.GENERAL SITE PLAN NOTESE-006~E-008 EXISTING POLE IMAGESPage 227 of 802 E-002CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-002_SINGLE LINE DIAGRAM AND FIXTURE SCHEDULE.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJSINGLE LINE DIAGRAM AND FIXTURE SCHEDULEREFERENCE NOTES1. NEW WALL HUNG PG&E APPROVED UNDERGROUND PULL SECTION[RYCO #PB400-1 OR EQUAL] AND TWO METER SECTION WITH CIRCUITBREAKERS (22KAIC) [ RYCO #WCBHM22-1] NEMA 3R. 400AMP SERVICE,120/240V, 1Ø, 3W.2. NEW 200AMP PANEL MOUNTED INSIDE BUILDING RESTROOM PLUMBINGSHAFT SEE FLOOR PLAN FOR LOCATION.3. NEW SERVICE ENTRANCE RATED LOAD CENTER PANEL FOR KIOSK.SEE FLOOR PLAN FOR LOCATION4. NEW 4" UNDERGROUND SERVICE CONDUIT TO PG&E SECONDARY SITEPULL BOX.5. PROVIDE 200AMP FRAME WITH A 100AMP TRIP BREAKER.SINGLE LINE DIAGRAM NOTESA. ALL CONDUCTORS SHALL BE COPPER WITH TYPE [THHN/THWN]INSULATION UNLESS OTHERWISE NOTED.B. ALL SWITCHES, CIRCUIT BREAKERS AND OTHER EQUIPMENT, ASSPECIFIED, SHALL HAVE TERMINATION PROVISIONS LISTED ANDIDENTIFIED FOR USE WITH 75 DEG. CONDUCTORS, AND ALL FEEDERCONDUCTORS, AND CONDUITS, ARE SIZE BASED ON USE OF 75 DEG. CCOPPER WIRES TYPE THWN/THHN.C. DESIGN SHOWN IS BASED ON SQUARE D OR EATON PRODUCT.ENGINEER-APPROVED EQUAL ALTERNATE PRODUCT WILL BEACCEPTABLE.D. ALL EQUIPMENT SHALL HAVE AN APPROVED TESTING LABORATORYLABEL ATTACHED [UL, CSA, ETC.] (CEC 110-2).E. THE ELECTRICAL CONTRACTOR IS RESPONSIBLE FOR SUPPLYINGMETER/MAIN AND LOAD CENTER SIZED TO FIT IN THE AVAILABLE SPACEIN THE ELECTRIC ROOM. REFER TO ARCHITECTURAL PLANS FORDIMENSIONAL INFORMATION NOT SHOWN ON THE ELECTRICAL PLANS.CONTRACTOR SHALL SUBMIT A 1/4" SCALE DRAWING OF ALLSWITCHGEAR, AND TERMINATION CABINETS ON FLOOR PLAN WITHSUBMITTAL.F. PER CALIFORNIA TITLE 24 SECTION 130.5, WIRING PROVISIONS HAVEBEEN MADE FOR DISAGGREGATION OF THE ELECTRICAL CIRCUITS, THEOPTIONAL METERING HAS NOT BEEN PROVIDED FOR THIS PROJECT.G. REFER TO PANEL SCHEDULES FOR INDIVIDUAL BRANCH CIRCUITVOLTAGE DROP AND/OR SINGLE LINE DIAGRAM FOR FEEDER VOLTAGEDROP CALCULATIONS.H. BRANCH CIRCUIT/FEEDER DISTANCE IS SHOWN FOR REVERENCE ONLYAS THE BASIS OF VOLTAGE DROP CALCULATIONS. CONDUCTORDISTANCE AS INDICATED SHALL NOT BE USED FORBIDDING/CONSTRUCTION PURPOSES. SHOULD THE FEEDER DISTANCEEXCEED THE LENGTH NOTED PER INSTALLATION CONDITIONS, NOTIFYTHE ENGINEER OF RECORD. TYPICAL.M(N)200A2P(3) #2 THWN & (1) #8 GND.1153(1) 1-1/2"C(PVC 40)(3)#3/0 THWN AND (1)#6 CU GROUND.2003(1)2"C (PVC 40)2003PANEL(N)1153PANEL(N)21-32ARC FLASH SIGNAGE1GROUND/BOND DETAILNOTE:IN ACCORDANCE WITH CEC 110.16. PROVIDE ARC FLASH PROTECTION WARNING LABELS ON EACH SWITCHBOARD, PANELBOARD,AND TRANSFORMER. LABELS SHALL BE PER ANSI Z535.4 GUIDELINES PER THE ABOVE EXAMPLE.WARNINGARC FLASH HAZARDLINE SIDEof MAINFLASH PROTECTION BOUNDARY:INCIDENT ENERGY RANGE:HAZARD RISK CATEGORY:40 inchesCLASS 24 - 8 cal/cm²LINE SIDEof MAINFLASH PROTECTION BOUNDARY:INCIDENT ENERGY RANGE:HAZARD RISK CATEGORY:20 inchesCLASS 00 - 2 cal/cm²LOCATION:BUS NAMEPROTECTIVE DEVICE:UPSTREAM DEVICEPSE TQS#: #####.#Date Issued: April 2004Study Rev. :0SINGLE LINE DIAGRAM"MR""MK"142-#81-2-LIGHTING FIXTURE SCHEDULEMAX.VA.CATALOG NO.MANUFACTURERILLUSTRATIONTYPELAMPING MOUNTING DESCRIPTIONVOLTAGEAKENALLFS824R 2TB MPA DB33L40K 120V120 37 LED, 40K WALL2FT LINEAR LED LIGHT, HIGHIMPACT RESISTANT LENSB1LITHONIABLWP4 40L ADP EZ1LP840MVOLT35 LED, 40KSURFACE4FT LINEAR WRAP, 0-10VDIMMINGSWHANDELMANOL12.9WBCORDOVA 9" WALLBRACKET120 30(3)10W LEDBULB,4000KWALLDECORATIVE EXTERIOR WALLLIGHT (9"WX28"HX 12"PROJECTION)AMBER GLAZING ATPERFORATED METAL, CLEARGLAZING AT WINDOWS.SDBEGA 24813 K4 BRZ MGU MVOLT10.4 LED, 40KRECESSED LED RECESSED CEILING DOWNLIGHTS, VORTEX REFLECTOR,ASYMMETRIC BEAMDISTRIBUTION, BRONZE FINISH,0-10V DIMMING, MARINE GRADEUNDERCOATSGTARGETTIKPLM RP HE MW L2RGBW 1DU2525KIDU2521 1E25241E0388 DX8PLEAD50TGDMXSLESAU11120 15wLED, RGBW IN-GRADE,CONCRETEPOURAPPLICATIONMINI RGBW IN-GRADE LIGHTING,PROVIDE 1-50W DMX POWERSUPPLY (PS041) FOR TWO "SG".REFER TO SITE PLAN (50FTDIRECT BURIAL LENGTH), DMXCONTROLSPHANDELMANCUSTOM FIXTUREWITH (2)35W LEDPACKAGE120 70W LED, 40KCONCRETEBASEDECORATIVE POLE, 2-14"X30"LED HEAD, WITH A 5" DIAMTERX 16FT POLE. INCLUDESBANNER ARM AND 120V OUTLETLITHONIABLWP2 86L ADP EZ1LP840MVOLT7 LED, 40K WALL,+9.5" AFF2FT LINEAR WRAP, 0-10VDIMMINGB2BONDING OF "OTHER METALPIPING AND METAL WATERPIPE" PER 2019 CEC250.104(A)(B)#1/0 @ METER/MAIN M/M COPPER GROUND BONDINGJUMPER. OCCURRING AT SERVICE ENTRANCEEQUIPMENT. SIZED PER 2019 CEC TABLE 250.102(C)(1).#4 [M/M) & #8 [MK] COPPERGROUNDING CONDUCTOR. SIZEDPER 2019 CEC TABLE 250.66#2 COPPERGROUND AT"MTTB""UFER"CONCRETE-ENCASEDELECTRODE, 1/2" MIN.DIAMETER. PER 2019CEC 250.52(A)(3)PER 2019 CEC 250.50GROUNDING ELECTRODESPRESENT ATSTRUCTURE/BUILDINGSHALL BE BONDEDTOGETHER TO FORM THEGROUNDING ELECTRODESYSTEM. WHEREGROUNDING ELECTRODESIDENTIFIED IN 2019 CEC250.52(A)(1) THROUGH (A)(6)ARE NOT PRESENT ATSTRUCTURE/BUILDINGPROVIDE ONE OR MORE OFTHE ELECTRODESINDICATED."METAL UNDERGROUND WATERPIPE" 3/4" MINIMUM PER 2019 CEC250.52(A)(1)"METAL BUILDING/STRUCTUREFRAME" PER 2019 CEC250.52(A)(2)"ROD AND PIPE ELECTRODES"3/4" MINIMUM PER 2019 CEC250.52(A)(5)(a)(b)"GROUND ROD" 5/8"DIA. X 10FTELECTRODE PER 2019 CEC250.52(A)(5)(b)#6 [M/M] & #8 [MK] COPPERGROUNDING CONDUCTOR. SIZEDPER 2019 CEC TABLE 250.122#6 COPPER GROUNDINGCONDUCTOR PER 2019 CEC250.66(A)#4 COPPER GROUNDINGCONDUCTOR PER 2019 CEC250.66(B)SUPPLEMENTAL ELECTRODEREQUIRED PER 2019 CEC250.53 (D)(1)(2)#6 COPPER GROUND PERPER 2019 CEC 250.53 (E)BONDING OF "STRUCTURALSTEEL" PER 2019 CEC250.104(C)NOTES:- GROUND RINGS NOT SHOWN. SEE 2019 CEC 250(A)(5)(4).- PLATE ELECTRODES NOT SHOWN. SEE 2019 CEC 250 (A)(6).- OTHER LISTED ELECTRODES NOT SHOWN. SEE 2019 CEC 250(A) (7).SERVICE EQUIPMENTENCLOSURE FULLLENGTH GROUND BUSSERVICE EQUIPMENT ENCLOSURE FULLLENGTH NEUTRAL BUS ON AT M/M#4M(N)100A2P2-"M/M"25E-0055AVAILABLE FAULT CURRENT: 10kAIC400A, 120/240V, 1Ø, 3-WIRE, 100kAIC BRACING22E-0055E-003Page 228 of 802 E-003CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-003~E-005_ELECTRICAL DETAILS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL DETAILS3RECESSED LIGHTING MOUNTING DETAILSCALE: 7METAL PIPE THROUGH CONCRETE OR BLOCK WALL/FLOORSCALE: 2FIXTURE TYPE 'SG' WIRING DIAGRAMSCALE: 6DATA CABINETSCALE: 4FIXTURE TYPE "SG" MOUNTING DETAILSCALE: NTS5FIXTURE TYPE 'SP' MOUNTING DETAILSCALE: 9TYP. WALL SURFACE MOUNTED LIGHTING FIXTURESCALE: 1POLE MOUNTED CAMERASCALE: NTS8SURFACE MOUNTING DETAIL AT CONCRETE WALLSCALE: 20'18'±36"24"PCC FOUNDATIONELECTRICAL PULL BOX LID FLUSH WITH GRADEFOR FINISHED SURFACES, 1" ABOVE GRADE INOTHER AREAELECTRICALCONNECTIONPACK GROUT IN GAP BETWEEN BASE PLATE ANDFOUNDATION AFTER PLUMBING THE FIXTURE.ALLOW DRAINAGE FROM INSIDE POLEINSTALLATION NOTES:1.CAMERA: SECURITY LINES US PD i4P, FURNISHEDBY CITY.2.POLE MOUNT: GRAINGER 3/4" WIDE, T-BOLT HOSECLAMP; PK5 OR APPROVED EQUAL.3.POLE: (PAA240) LUMINIS 5" DIAMETER X MIN .124WALL. 6061-T6 ALUMINUM ALLOY, 18" HEIGHT,RATED FOR MIN 80 MPH WIND LOAD WITHREINFORCED CASE BASE PLATE AND CASTALUMINUM BASE COVER. PROVIDE END CAP.4.ANCHOR BOLTS: GALVANIZED STEEL, 3/4" Ø X 30"WITH 4" LEG, (4) TOTAL WITH GALVANIZED NUTSAND WASHERS (8) TOTAL.5.PCC FOUNDATION: CLASS 3 CONCRETE6.PULL BOX: SHALL BE 11"X17" CONCRETE PULLBOX MARKED "ELECTRICAL" AND INCLUDEVANDALISM PROOF BOLTS.7.CONDUIT: 2" MIN.8.PULL BOX: SHALL BE 11"X17" CONCRETE PULLBOX MARKED "FIBER" AND INCLUDE VANDALISMPROOF BOLTS.1234567XMANUFACTURER & MODEL NO.:CAMERA: SECURITY LINES i4POD-PPOLE: LUMINIS PAA420-NTW (CONFIRM WITH CITY THELATEST CAMERA AND POLE MODEL NO. BEFORE ORDERING.POLE COLOR: POWDER COATED DARK FOREST GREENGENERAL NOTES:A. VERIFY CAMERA SYSTEM VOLTAGE BEFORE ORDERING.B. INSTALL LIGHT/POLE PER MANUFACTURER'SDIRECTIONS AND SECTION 86 OF THE STANDARDSPECIFICATIONS.C. CONDUCTORS, CONDUIT, GROUND ROD, ANDCIRCUITRY MUST COMPLY WITH CAMERA LOADINGREQUIREMENTS.D. INSTALL POLE AT THE LOCATION INDICATED BE THEPLANS OR AS DIRECTED BY THE ENGINEER.8NOTES :1. MAXIMUM DIAMETER OF OPENING = 12".2. ANNULAR SPACE = MINIMUM 0", MAXIMUM 1-1/4".3. MINIMUM 1/2" DEPTH HILTI FS-ONE INTUMESCENT FIRESTOP SEALANT,CP 601S ELASTOMERIC FIRESTOP SEALANT, OR CP 606 FLEXIBLEFIRESTOP SEALANT IS REQUIRED ON BOTH SIDES OF A WALLASSEMBLY.4. W-RATING APPLIES ONLY WHEN CP 601S ELASTOMERIC FIRESTOPSEALANT OR CP 604 SELF-LEVELING FIRESTOP SEALANT IS USED.1. CONCRETE FLOOR OR WALL ASSEMBLY (2-HR. FIRE-RATING):A. ANY LIGHTWEIGHT OR NORMAL WEIGHT CONCRETE FLOOR OR WALL (MINIMUM 4-1/2" THICK).B. ANY UL/cUL CLASSIFIED CONCRETE BLOCK WALL.2. PENETRATING ITEM TO BE ONE OF THE FOLLOWING:A. MAXIMUM 10" NOMINAL DIAMETER STEEL PIPE (SCHEDULE 10 OR HEAVIER).B. MAXIMUM 10" NOMINAL DIAMETER CAST IRON PIPE.C. MAXIMUM 4" NOMINAL DIAMETER COPPER PIPE OR TUBING.D. MAXIMUM 4" NOMINAL DIAMETER STEEL CONDUIT.E. MAXIMUM 4" NOMINAL DIAMETER EMT.3. MINIMUM 3" THICKNESS MINERAL WOOL (MINIMUM 4 PCF DENSITY)TIGHTLY PACKED FOR NOMINAL 4" DIAMETER (AND SMALLER), ANDMINIMUM 4" THICKNESS MINERAL WOOL (MINIMUM 4 PCF DENSITY)TIGHTLY PACKED FOR PIPES GREATER THAN NOMINAL 4" DIAMETER.4. MINIMUM 1/2" DEPTH HILTI FS-ONE INTUMESCENT FIRESTOP SEALANT, CP601S ELASTOMERIC FIRESTOP SEALANT, CP 604 SELF-LEVELING FIRESTOPSEALANT, OR CP 606 FLEXIBLE FIRESTOP SEALANT.5. MINIMUM 1/2" BEAD HILTI FS-ONE INTUMESCENT FIRESTOP SEALANT, CP601S ELASTOMERIC FIRESTOP SEALANT, OR CP 606 FLEXIBLE FIRESTOPSEALANT APPLIED AT POINT OF CONTACT. (NOT REQUIRED WHEN CP 604SELF-LEVELING FIRESTOP SEALANT IS USED, ITEM NO. 4).52134SECTION A-AATOP VIEWAF-RATING = 2-HR.T-RATING = 0-HR.L-RATING AT AMBIENT = LESS THAN 1 CFM/SQ. FT.L-RATING AT 400° F = 4 CFM/SQ. FT.W-RATING = CLASS I (SEE NOTE NO. 4 BELOW)91"32"9.5"NEMA 1CABINET, 600 LB.MAXIMUM WEIGHT.CONCRETE WALLPROVIDE HILTI 3/8" DIA. X 2-1/2" (NOMINALEMBEDMENT) HILTI KB-TZ2 WITH INSTALLATION PERICC REPORT NUMBER ICC-ESR-4266, 6 MINIMUM ONEEACH AT MOUNTING STUDS.REFERENCE NOTES1. CEILING FINISH MATERIAL, SEE ARCHITECTURALREFLECTED CEILING PLANS FOR TYPE AND DEPTH.2. PROVIDE STEEL FRAMING ABOVE AS REQUIRED TOMATCH CEILING FRAMING, SEE FRAMING PLANS FORREQUIRED FRAMING.3. RECESSED HOUSING WITH EXPANDABLE MOUNTINGBARS.4. FIXTURE TRIM5. OUTLET BOX / BRANCH CIRCUIT6. ATTACH EXPANDABLE MOUNTING BARS WITH #10 X 1"SMS, PROVIDE A MINIMUM OF (4) PER MOUNTING BAR.HARD LID CEILINGAT STUD WALLAT CMU WALLREFERENCE NOTES123HEIGHTSEE ARCH. PLANSFOR MOUNTINGOUTLET BOXPROVIDE #10x1" HEX HEADSELF-TAPPING SCREWS AT FIXTURE MOUNTINGPOINTS. (MINIMUM OF 2) TO BACKING OR WALLSTUDSMETAL WALL STUD, SEE ARCH. PLANS.WALL FINISH, SEE ARCH. PLANS.WALL STUD BACKING PER14-X/S105.1. SMALL SURFACE MOUNTED LIGHT FIXTURE. (20 LBS. ORLESS)2. CONCRETE MASONRY WALL.3. 3/8" DIA. HILTI KB3 , PER ICC ESR-2302. PROVIDE MINIMUM2-1/2" EMBEDMENT.NOTE:FLUSH MOUNTED OUTLET BOX IS NOT SHOWN FORCLARIFICATION.LIGHTING FIXTURE PER FIXTURESCHEDULE ON SHEET X/E105.PLANPLANREFERENCE NOTES1. EC SHALL PROVIDE (N) DEDICATED 20A, 120VPOWER CIRCUIT TO RECEPTACLE ENCLOSEDINSIDE CABINET.2. SYSTEM ELECTRONICS TO BE PROVIDED ANDINSTALLED BY OTHERS.3. (N) RACEWAY FOR HORIZONTAL CABLING TO USERSTATIONS AND INCOMING FIBER OPTIC CABLE.4. INSTALL FIBER OPTIC SPLICE TRAY, LEVITON OPT-X1000i SERIES OR EQUIVALENT. FUSION SPLICE ALLFIBER CABLE ACCORDING.5. DOUBLE HINGED IDF CABINET CHATSWORTH CUBE- IT, 24''W X 30''L X 27.9''D (12419-X48) OREQUIVALENT WITH TEMPERED GLASS FRONTPANEL. THERMOSTATICALLY CONTROLLEDFAN/FILTER KIT AND SURGE-PROTECTED OUTLETKIT SHALL BE INSTALLED.6. (N) INCOMING FIBER OPTIC CABLE, PROVIDESERVICE LOOP INSIDE CABINET.7. DUPLEX FIBER OPTIC PATCH CORD. LC-LC,CONNECTOR TYPE PER CITY OF SLOREQUIREMENTS.8. CABLE PROVIDED BY OTHERS TO SUPPORTLOGICAL STACKED SWITCH. PROVIDED ONLYWHEN (2) OR MORE NETWORK SWITCHES AREINSTALLED INTO CABINET. INSTALLED BYELECTRICAL CONTRACTOR.57263184MANUFACTURER PROVIDEDBONDING JUMPER TOGROUND BAR AND DOORHARDWARE (QTY 2)MANUFACTURER PROVIDED GROUNDBAR (BONDED TO CHASSIS)MANUFACTURER PROVIDEDFAN/FILTER KIT WITH LINEVOLTAGE THERMOSTATCONTROL4'-9" 4-#4 MIN VERT. #3 REBAR TIESAT 12" ON CENTER3" MIN.18"3/4" MIN. DRYPACKFINISH GRADELIGHTING POLE, BASEPLATE. REFER TOMANUFACTURERSUBMITTAL(3)#3 TIES IN TOP 5°CHAMFER EDGES3" MIN.RED+24VDCBLACKYELLOW w/ BLACK STRIPEWHITEYELLOWFCS PS10POWERSUPPLYFRESCO NETWORKDETACHABLE PIGTAILHARNESSWHITE w/ BLACKSTRIPEDMX/RDM NETWORKDETACHABLE PIGTAILHARNESSTO EARTH GROUND ONLYIN STATION BACKBOXBLACKREDBLACKDMX COMMONDMX SHIELDDMX DATA +DMX DATA -BLACK w/ORANGEHNWHITEGREENDMX/RDM NETWORKTERMINATION SWITCHONACUITYFRESCO PANEL#FCS-7TSN-X-DWHTO "LCP" RELAY PANELMOUNT INSIDE IP68 WET LIST DIRECT BURIALVAULT. REFER TO PLAN FOR LOCATION. ONEPOWER SUPPLY REQUIRED FOR TWO FIXTURETYPE "SG"FIXTURE TYPE "SG" ASSHOWN ON SITE PLANDMX CABLE: BELDEN SHIELD CABLE 2-18GAUGE #5300F1-300V (DAISY CHAIN)C5 C5 C5 C51"C (EMT) DMX TOFRESCO PANEL"3/4C (EMT) TO"LCP" RELAYPANELDMX TO NEXTDRIVERINSTALLATION DIAGRAM FOR CONCRETE POUR APPLICATION PERMANUFACTURER REQUIRMENTSNEW 11"X17" ELECTRICAL PULL BOX PER CITY OF SLOENGINEERING STANDARD 7520. LID FLUSH WITH GRADE FORFINISHED SURFACES, 1" ABOVE GRADE IN OTHER AREA. PROVIDE2-AMP FUSE IN ADVANCE OF LIGHT.2" CONDUIT WITH WITHBELL END. REFER TOSITE PLAN FORCONTINUATIONNOTES1. GALV. ANCHOR BOLTS & TEMPLATE FURNISHED BY EC;BOLTS INSTALLED AND CONCRETE BASE FURNISHEDAND INSTALLED WITH REBAR BY GC2. CONDUIT SHALL BE 3/4" MINIMUM SIZE AND MINIMUM24" BELOW FINISH GRADE (UON) PER CITYREQUIREMENTS3. TIES SHALL HAVE AT EACH END A 135 DEGREE HOOKBEND WITH A SIX-BAR DIAMETER BUT NOT LESS THAN3 INCH EXTENSION THAT ENGAGES THELONGITUDINAL REINFORCEMENT AND PROJECTS INTOTHE INTERIOR OF THE STIRRUP OR HOOP.4. ADD #6 SOLID UFER GROUND TO EACH BASE. LOCATEAT 11"X17" PULL BOX NEXT TO EACH LIGHT POLE.2"CONDUIT WITH BELL ENDGROUND ROD3" CLRTYP.ELECTRICAL PULL BOX LID FLUSH WITH GRADEFOR FINISHED SURFACES, 1" ABOVE GRADE INOTHER AREA5 -#4 VERTICAL#3 TIE BOT &MID HEIGHT3 - #3 TIES @ 1 1/2" OC IN TOP 5" OF FOOTINGPage 229 of 802 E-004CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-003~E-005_ELECTRICAL DETAILS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL DETAILSCONDUITS2"BRANCH CIRCUIT, FEEDERMIN. 4", ROCK FREE FILL (SAND)NATIVE SOIL BACKFILLWARNING TAPE24"2"12"12"4"2"(MIN)NOTE: SOIL COMPACTION SHALL BE 95%COORDINATE UTILITY TRENCH DETAILS WITH UTILITY COMPANIES18" MIN54" MINNATIVE SOIL BACKFILLROCK FREE FILLAC PAVING,WHERE OCCURRINGPFINISHED GRADETC18"3"MINPPRIMARYSECONDARYSTTELEPHONECCABLE TVLEGEND WARNING TAPEDDISTRIBUTIOND12" MIN12"GS7"6" MIN6"7"12"RGGAS, WHERE OCCURRINGNOT BE UNDERMINEDSO THAT FOOTINGS WILLLOCATE PIPE TRENCHMIN.GENERAL NOTESPASS THROUGH THE POUR JOINTNO PIPE SHALLFOOTING PAD1'-6"9"6"MIN4"MIN2"MIN121'-6" MIN.BACKFILL PER SPECIFICATIONSPLACE CONCRETE FILL AROUNDSLEEVES BEFORE POURINGFOOTING PADS, FILL SHALL BESAME WIDTH AS FOOTING AND FULLWIDTH OF PIPE.PROVIDE METAL SLEEVES WITHI.D. 2" GREATER THAN THE O.D.OF THE PIPE.NO EXCAVATIONBELOW THIS LINEFTG.DEPTHPERSTRUCT.1. CONCRETE FILL TO BE THE SAME WIDTH AS FOOTING AND FULL WIDTH OF PIPETRENCH. (BACKFILL PER SPECIFICATIONS).2. CENTER PIPE IN PVC OR GALVANIZED METAL SLEEVE THAT HAS A MIN. I.D. 2"GREATER THAN THE PIPES O.D.3. WATERPROOF OPENING AROUND PIPE PER GENERAL SPECIFICATIONS.4. COORDINATE INSTALLATION WITH STRUCTURAL ENGINEER.6"24"CRUSHED ROCK SUMPBELL END3" DIA DRAIN6"HOLEFINISHED GRADEREINFORCED BOX EXTENSION,AS REQUIRED#15 ROOFING PAPER BETWEEN GROUT ANDCRUSHED ROCKGROUT OPENINGMINIMUM 2" THICKGROUTALTERNATE CONDUIT ENTRYWHERE NUMBER OF BENDS INRUN ALLOWS3"Ø x 30"L PERFORATED PIPE FOR SUMPDRAINSURROUND PIPE 2" EACH SIDE AND 6" AT BASEWITH PEA GRAVEL.30"MIN. CONDUIT DEPTHMINIMUM INTERIOR BOX DEPTHREINFORCED CONCRETE COVER(TO SUIT APPLICATION) WITHHOLD DOWN BOLTS. LABELCOVER AS REQUIRED.PRECAST REINFORCED CONCRETEBOX. SIZE PER PLANS.SEAL AROUND CONDUIT, BOX ANDEXTENSION JUNCTION.12TYPICAL BRANCH CIRCUIT TRENCH DETAILSCALE: 11CITY OF SLO STANDARD 6035SCALE: 15TYPICAL CONCRETE PULL BOX DETAILSCALE: 13TYPICAL UTILITY TRENCH DETAILSCALE: 14TYPICAL CONDUIT NEAR/THRU FOOTING DETAILSCALE: 18NOT USEDSCALE: 17TYP. UNDERGROUND CONDUITS & TRANSITIONSSCALE: BELOW TOPOF SLABGRS, TAPE WRAPPED, OR PVCCOATED RISER TO EQUIPMENTOR BOX TERMINATIONCONDUIT RUN IS 150' GREATERTOP OF ELBOWTOP OF SLABFINISH GRADETOP OF SLAB/FINISH GRADENOTES:UNDERGROUND CONDUITS AND TRANSITION TO ABOVE GRADE/SLAB SHALL BE ASFOLLOWS:1. PVC ELBOWS ALLOWED IF TOP OF ELBOW IS MINIMUM 18" BFG OR BELOW TOP OF SLAB,OTHERWISE GRS, TAPE WRAPPED, ELBOWS ARE REQUIRED.2. GRS ELBOWS ARE REQUIRED IF CONDUIT RUN IS 150' GREATER.3. GRS RISERS ARE REQUIRED FROM ELBOW BELOW GRADE TO EQUIPMENT (DEVICE,OUTLET, PANEL, CABINET, ETC.) ABOVE GRADE.4. GRS ELBOWS/RISERS TO BE TAPED WRAPPED (1/2" LAPPED) TO 3" ABOVE FINISH GRADEOR TOP OF SLAB.TOP OF ELBOWPVCPVCPVC ELBOWPERMITTEDU.O.NPVC ELBOWPERMITTEDU.O.N24" MIN OR AS DEEMED BYAPPLICATION WHICHEVER ISGREATER4"18" MIN18" MINGRS, TAPE WRAPPED,TO EQUIPMENT OR BOXTERMINATIONSOILCONCRETE BLDG. PADGRS, TAPE WRAPPED,OR PVC COATED RISERTO EQUIPMENT OR BOXTERMINATION18" MIN AT SLABAND 24" MIN ATFINISH GRADECONCRETEBLDG.PAD/SOILGRS, TAPE WRAPPEDCONDUIT RUN IS LESS THAN 150'PVCCONDUIT RUN IS LESS THAN 150'Page 230 of 802 E-005CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-003~E-005_ELECTRICAL DETAILS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL DETAILS21NOT USEDSCALE: 20LOCKABLE RECEPTACLE PLUG BOXSCALE: 24LIGHTING CONTROL RELAY SCHEDULESCALE: 22FIXTURE TYPE SP SUBMITTALSCALE: 26METER BOARD, "M/M" CUTSHEETSCALE: PACK ANNULAR SPACECOMPLETELY WITH MINERAL FIBER.CAULK OPENINGS AIRTIGHT FROMWALL SURFACE TO CONDUIT WITHNON-HARDENING ACOUSTICALSEALANT BOTH SIDES OF WALL. SEESPECIFICATIONS FOR SEALANTREQUIREMENTS.METAL SLEEVE IN CONCRETEWALL, 1" TO 1-1/4" LARGERTHAN O.D. OF CONDUIT.NOTE: NO MULTIPLE CONDUITPENETRATIONS ALLOWED. PACK ANDCAULK EVERY CONDUIT INDIVIDUALLY.19SEALED CONDUIT PENETRATIONSCALE: 32 SWITCHING RELAY NEMA 1 ENCLOSURELIGHTING CONTROL PANEL SCHEDULEFLUSH "LCP"SURFACEXLOCATED: PLUMBING CHASERELAY CIRCUITCONTROL NOTESNO. NO.LOAD DESCRIPTIONDESCRIPTIONR1R2R3R4RESTROOM EXTERIOR1,2NOTES:1. PROGRAM RELAY FOR DUSK 'ON' WITH PROGRAMMED 'OFF' PER OWNER TIME SCHEDULE.2. EXTEND 0-10V WIRES TO FIXTURE(S) FOR DIMMING CONTROL.* INCLUDE EXTERIOR PHOTOCELL INSTALLED ACCORDING TO MANUFACTURER'S RECOMMENDATION TO CONTROL DUSKTO DAWN, AND DUSK TO TIME CLOCK OFF OPERATIONS.* PROVIDE LOW VOLTAGE OVERRIDE SWITCH ADJACENT TO PANEL WITH WEATHER PROOF LOCKABLE COVER. PROGRAMSWITCH FOR 2-HOUR OVERRIDE OF ALL EXTERIOR LIGHTING RELAYS. LABEL SWITCH "OVERRIDE".CONTROL POWER CIRCUIT: MR-8_ACUITY #ARP INTEN32NLT 24SPR MVOLT HLK SM DTCR5R6R7R8(4,5)MISSION PLAZA POLE LIGHTMISSION PLAZA NW OUTLET PEDESTALMISSION PLAZA NE OUTLET PEDESTALMISSION PLAZA STEP LIGHTSMISSION PEDESTAL OUTLETSMISSION STRING LIGHT RECEPTACLESMISSION IN-GRADEDUSK ON / TIMECLOCK OFF 2DUSK ON / TIMECLOCK OFF 2DUSK ON / TIMECLOCK OFF 22MR-3MR-12MR-14MR-13AMR-18MR-20MR-22MR-24DUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFR9R10R11R12AMPHITHEATRE RECEPTACLER13R14R15R16CREEK LIGHTSCREEK LIGHTSSOUTHWEST PATH LIGHTSMISSION POLE RECEPTACLEMISSION POLE LIGHTAMPHITHEATRE RECEPTACLEDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFMR-26MR-28MR-30MR-32MR-34MR-27MR-29MR-31DUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFR17R18R19R20SOUTH WEST PATH LIGHTSR21R22R23R24SPARESPARESPARESPAREBROAD STREET AND POLE LIGHTS SOUTH CREEKDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFMR-33MR-35MR-37DUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFF2222222222222222222R25-R32 (SPACES)DUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFDUSK ON / TIMECLOCK OFFAMPHITHEATRE STEP LIGHTSBROAD STREET AND POLE LIGHTS SOUTH CREEK25TEMP POWER PANEL SCHEDULESCALE: OUTLET A: PEDESTAL TL310-WCS-PED WITH (2)20A 120V WEATHER RESISTANT/TAMPERRESISTANT RECEPTACLE. #GFCI/WR/TR. COLOR FINISH: RAL6009 OR PANTONE 5535OUTLET B: PEDESTAL TL310-WCS-PED. PROVIDE WITH (1)50A 120/ 240V 4-WIRE CALIFORNIA STYLERECEPTACLE. WILL REQUIRE 14" DEEP SPECIALIZED HOUSING (NEMA 14-50). #9-50A. COLORFINISH: RAL6009 OR PANTONE 5535OUTLET C: RECESSED/DEEP HOUSING TO FLUSH MOUNT AT CONCRETE #TL310-WCS. PROVIDE(2)20AMP 125/250V NEMA 14-20R. COLOR FINISH SELECTED BY LANDSCAPE ARCHITECT.ABCMISSION PEDESTAL OUTLETSMR-13BPage 231 of 802 E-006CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-006~E-008_EXISTING POLE IMAGES.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJEXISTING SITE POLE IMAGES2PLAZA 2SCALE: 1PLAZA 1SCALE: 4PLAZA 4SCALE: 3PLAZA 3SCALE: 6PLAZA 6SCALE: 5PLAZA 5SCALE: 8PLAZA 8SCALE: 7PLAZA 7SCALE: NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMP FUSE INADVANCE OF LIGHT INSIDE EXISTING ROUND PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMP FUSE INADVANCE OF LIGHT INSIDE EXISTING ROUND PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMP FUSE INADVANCE OF LIGHT INSIDE EXISTING ROUND PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMPFUSE IN ADVANCE OF LIGHT INSIDE EXISTING ROUND PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMP FUSE INADVANCE OF LIGHT INSIDE EXISTING ROUND PULL BOX.Page 232 of 802 E-007CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-006~E-008_EXISTING POLE IMAGES.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJEXISTING SITE POLE IMAGES2PLAZA 10SCALE: 1PLAZA 9SCALE: 4PLAZA 12SCALE: 3PLAZA 11SCALE: 6PLAZA 14SCALE: 5PLAZA 13SCALE: 8PLAZA 16SCALE: 7PLAZA 15SCALE: NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMPFUSE IN ADVANCE OF LIGHT INSIDE EXISTING PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUNDROD, AND 2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REMOVE EXISTING PATIO AROUND WOOD POST, DISCONNECT AND REMOVE EXISTING POST LIGHTAT EXISTING NOVO PATIO. NOVO RESTAURANT WILL REPLACE EXISTING WOOD PATIO TO REPLACEOPENING.Page 233 of 802 E-008CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_E-006~E-008_EXISTING POLE IMAGES.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJEXISTING SITE POLE IMAGES2PLAZA 18SCALE: 1PLAZA 17SCALE: 4SCALE: 3PLAZA 19SCALE: 6SCALE: 5SCALE: 8SCALE: 7SCALE: NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE GROUND ROD, AND 2-AMPFUSE IN ADVANCE OF LIGHT INSIDE EXISTING PULL BOX.NOTE: REPLACE EXISTING POST LIGHT WITH NEW FIXTURE TYPE SP, PROVIDE NEW PULL BOX, GROUND ROD, AND2-AMP FUSE IN ADVANCE OF LIGHT INSIDE NEW PULL BOX.Page 234 of 802 SS SS SS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SS SS SS SS SS SS SS WL WL 24" OLIVE18" TREE4" TREE26" TREE4" TREE26" PINE28" TREE26" TREE26" TREE26" TREE6",10",12" TRCOCOCOWM 1762215.98TR 12XDL 1805215.16 OUTLET RIS ICV3175215.22OUTLET RIS ATTWVWVSLB WM WMPGECTV PGE WMELECELECICVWVWVICVICVMP TREE48" BASEBENCHBENCH BENCH 2 STEPSDOOR 11'± TALL ARCHED METALTOG: 205.26'INV BOX: 204.40'TOG: 207.93'iNV BOX (FULL): 207.76''WM CATV PGE TEL GAS-ELE PANEL-WATER CONDUIT-ELE CONDUIT-EMERGENCY CONDUITEMBENCH BENCH BENCH 5 ICVS2" BFPTOG: 214.93'///8" PINEVERY 10'WVSCOTREE 14"BOLLARDWSC BELL 3 STEPS11 STEPS10 ST E P S BENCHICVTOG+204.81'INV=203.16'8 STEP S ICVICVELEC COICVICV 18" TREE2P 18" TREE10" OAK8" TREE26" EUK16" TREE36" TREE28" TREE24" PINE26" PINETRASHTRASH2" BFPBOELEC OUTLETSCONCRETE STATUE10" PINE12" OAK10" OAKPATIO FF: 205.44'10" OAKUTIL METAL FENCE WITHWOODEN POST8 STEPSWALK ///DRINKING FOUNTAIN///////////////////// WLWLWLWLWLWL 40" TREE GRANITE CURBCO10" TREECO4 STEPS4" TREELIFT IN SWTELTRASH ICV12" TREECTV UTIL UTIL WMWV14" TREE 10" TREEWVWVWVUTILUTIL WMGAS 3 FIRE VALVESS16" TREE8" 3P TREE8" & 14"2P TREEWMPAC BELLWMWVSUTIL TC: 202.97'FL: 201.97'INV: 199.87'BENCH BENCH FIRE ALARMON WALL11 STEPS5 STEPSBENCHBENCHBENCHBENCHTRASHBENCHBENCHTRASH20" TREE10" TREEBOULDER PATH OUTLINE12" TREE40" TREE6" TREE8" TREE28" TREE2P 6" TREE6" TREE4" TREE6" TREE-2 ICVs-HOSE BIBELECMP 4" TREE8" TREE14" OAK12" TREE12" TREE12" TREE3P 6"TREESTONE WALL3.8'± TALLWALL LIGHTS AT APPROXIMATELYEVERY 10 FEET.4 STEPSTRASH5 STEPS6 STEPSBENCH2" PVC PIPEBELOW BRIDGEAREA LIGHTBELOW BRIDGEELE ELEC BOXBELOW BRIDGEELE 1" ELE C O N D UIT BELOW B RID G E TOG: 193.41'HANGING FISH ARTELE ELE ELE ELE ELE 3" PVC PIPECONCRETE BRIDGE FOOTINGELEC CONDUITBELOW BRIDGEAREA LIGHTBELOW BRIDGEWOODEN WALLON BRIDGEELEC22" TREE16" TREE18" TREE22" TREE BIKE RACKTOG: 197.57'2 STEPS9 STEPS7 STEPSHANGING ART PIECED STONE WALLVARIED HEIGHTLAYERED STONE WALLPLANTER UTL2" CONDUIT40" TREEWVHOSE BIBELECOVERHEADTRELLI S O V E R H E A D -EXPOSED 2" CON.-HOSE BIBTRASH8 STEP S -ELEC B O X -ELEC O U T L E T -ICV -AREA L I G H T 1.5" CONDUIT6" PVCDRIVEWAY ART PIECEEXPOSED 1' CMPWOODEN RETAINING WALL10" TREE40" TREE20" TREE36" & 30"2P TREEELECUTL 3 ICVsCONDUIT BOXICV8'± TALL WALL6" WALL DRAINBENCH2P 6"TREE8" TREEHOSE BIBWALKPATIODI WEEPLIFT IN SIDEWALKWALKWAY EETBROAD STREET BROAD STREET 27.5'27.5'25'25'TRASHFLCONCRETE MOW STRIPWALK DOOR7 STEPS.5'± CONCRETE WALL2'± CONCRETE WALL8 STEPSTCD TCD TCD TCD TCD TCD TCD RIM=215.85'INV 10"=210.27'RIM=214.49'INV 12"=201.57'RIM=202.60'INV 8"=196.2'RIM=206.19'INV 12" DROP (NE)=198.99'INV 12" (NE-SW) 8" (SE)=194.54'MONTEREY STREETELEC66351213177238(TBR)(E)131816PG&E #24816CITY #221632(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)A-2A-4A-4A-2A-2A-2B-4 UNDER STAIRSA-2,4B-4,6B-3(E)(E)LIGHTS ON BRIDGE ARE CIRCUIT A-4B-4,6A-4A-4A-415284251026278191124459(TBR)(TBR)8223A-7,8,9,10,12,12,14,15,18,19,2029A-2,4, B-1,3B-1B-1B-3B-1B-1B-1A-4, B1, B3(E)A-2A-2,4(E)(E)2116A-6A-6A-6A-6A-6A-10A-9,14,1630(E)A-4B-4,6B-1B-1B-1B-1B-1B-3B-3B-3B-3B-1B-3B-36A-7,9,11,12,18,19,20A-1050AA-8(E)A-7,9,11,12,18,20B-21/23B-17A-4JB-4JA-4B-4,6B-4,6A-9A-9A-9A-9A-912A-14A-14A-14373120MATCHLINE3334736A-6A-6[B-4](E)(TBR)A-4A-2A-8(E)A-8(E)A-9A-9A-7A-7A-7MATCHLINE(((E)(E)(E)(E)(E)(E)(E)(E)(E)(E)7E-0068E-0062E-0071E-0073E-007(TBR)3E-0086E-00635E-0076E-0077E-0078E-0071E-0082E-008373737373774E-0077(TBR)(E)7777777ED-101CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_ED-101~ED-102_ELECTRICAL DEMOLITION SITE PLANS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL DEMOLITION SITE PLANREFERENCE NOTES1. EXISTING 50A 120/125V SINGLE PHASE 4WOUTLETS TO REMAIN.2. EXISTING POST WITH OUTLET TO REMAIN.3. EXISTING ROUND PULLBOX TO REMAIN.4. EXISTING ELECTRICAL PULLBOX FOR BRANCHCIRCUIT TO POLE MOUNTED SECURITY CAMERAS.5. EXISTING POLE MOUNTED SECURITY CAMERAS TOREMAIN.6. EXISTING STEP LIGHTS TO REMAIN.7. EXISTING POST LIGHT TO BE REMOVED ANDREPLACE. REFER TO IMAGE FOR REQUIREMENTS.8. EXISTING POST LIGHT TO BE REMOVED (REFER TOES-101 FOR LOCATION).9. DISCONNECT/REMOVE EXISTING LIGHT ON WOODPOST IN EXISTING PATIO. (TYPICAL OF 4LOCATION).10. REMOTE METER PG&E 1009777621 MOUNTEDOUTSIDE BUILDING.11. EXISTING TELEPHONE PULL BOX TO BERELOCATED IF REMAIN . COORDINATE WITH AT&T.12. EXISTING BRANCH CIRCUIT CONDUIT TOMONUMENT FROM EXISTING POST LIGHT. BRANCHCIRCUIT WILL NEED TO BE RECONNECTED DUE TOREMOVAL OF POLE LIGHT.13. EXISTING SECONDARY PG&E PULL BOX TO BEREPLACE WITH NEW. PG&E TO VERIFY SIZE.14. EXISTING AT&T COPPER RISES TO THIS POST.COORDINATE WITH AT&T TO REMOVE.15. EXISTING SUB-SURFACE TRANSFORMER T-249.16. EXISTING STREET COBRA LIGHT.17. EXISTING PG&E SECONDARY CONDUIT(S)BETWEEN TRANSFORMER AND PULL BOXES.18. PROTECT EXISTING CONDUITS IN THIS AREA.19. EXISTING PULL BOX TO REMAIN. RE-USE TOCONNECT NEW POLE MOUNTED LIGHT.20. EXISTING HOMERUN TO EXISTING DECORATIVEPOST LIGHT. INTERCEPT EXISTING BRANCHCIRCUIT AND EXTEND TO TEMPORARY PANEL.21. RE-ROUTE EXISTING BRANCH CIRCUIT CONDUITTO RE-POWER EXISTING AND NEW DECORATIVEPOLE LIGHTS.22. EXISTING PULL BOX TO BE RELOCATED ANDREPLACE. INTERCEPT EXISTING BRANCH CIRCUITSAND EXTEND TO TEMPORARY PANEL. REFER TOSITE PLAN FOR NEW LOCATION.23. EXISTING ELECTRICAL PULL BOX LABEL AS WATERVALVE TO BE REPLACE WITH NEW CONCRETEPULL BOX. INTERCEPT EXISTING BRANCHCIRCUITS AND EXTEND TO TEMPORARY PANEL.24. EXISTING BRANCH CIRCUITS. VERIFY EXACTROUTING, INTERCEPT EXISTING HOMERUN TORESTROOM BUILDING, AND EXTEND TOTEMPORARY PANEL.25. REMOVE AND DISCONNECT EXISTING ELECTRICALPULL BOX.26. DISCONNECT AND REMOVE EXISTING 200AMPPANELBOARD WITH (2)100AMP FEED BREAKER TOFEED EXISTING PANEL "A" AND PANEL "B".27. COORDINATE WITH PG&E TO REMOVE EXISTINGSECONDARY SERVICE CONDUITS.28. DISCONNECT / REMOVE ALL LIGHTS, PLUGS, ANDANY POWER IN BATHROOM. COORDINATE WITHOWNER IF ANY EQUIPMENT IN THE EQUIPMENTROOM WILL NEED TO BE SALVAGED.29. EXISTING PANEL AND CIRCUITS IN THE ADOBEROOM TO BE REMAIN. REFER TO NOTE 22 FOREXISTING HOMERUN BRANCH CIRCUITS.30. EXISTING OUTLET TO BE REMOVED.31. EXISTING SITE LIGHTING PULL BOX TO REMAIN.32. EXISTING AT&T PULL BOX TO REMAIN.33. FIELD LOCATED EXACT LOCATION OF EXISTINGBRANCH CIRCUIT UNDERGROUND IN THIS AREA.INTERCEPT EXISTING BRANCH CIRCUITS ANDEXTEND TO NEW PULL BOX SHOWN ON ES-101.34. FIELD LOCATE ROUTING OF HOME RUN TOEXISTING PULL BOX (NOTE 22)35. THIS LIGHT WILL NOT BE IN OPERATION WHENRESTROOM WILL BEING BUILT.36. EXISTING ELECTRICAL PULL BOX TO BERELOCATED PER ELECTRICAL PLAN. FIELD VERIFYWHAT THE EXISTING BRANCH CIRCUIT IS FEEDINGAND INFORM ENGINEER.37. VERIFY BRANCH CIRCUIT TO THIS EXISTING POLE.MARK PANEL AND CIRCUIT NUMBER PRIOR TODEMOLITION OF RESTROOM BUILDING.NORTHSCALE:ELECTRICAL DEMOLITION SITE PLAN1"=20'PANEL "A"PANEL "B"SEE SHEET ED-102FOR CONTINUATIONSHEET ED-101SEE SHEET ED-102FOR CONTINUATIONPage 235 of 802 SSSSSSSSSSSSSS SSSSSSSS SLBGM26" TREE22" TREE20" TREE6",10",12" TREES24" TREE48" TREE26" TREE12" TREE20" TREE24" TREE16" TREE8" PINEWVW V WVWV1063208.72PM YLLW 2IN PLU 1064208.57PM YLLW 2IN PLU1065208.66PM YLLW2INPLA T 1066208.75PM YLLW2INPLA T1304214.93PM NG1305214.82PM NGICVBENCH BENCHBENCHBENCH///////// 7 STEPS4 STEPS4 STEPS4 STEPS4 STEPSTRASHCONCRETEPILLARSICVELECWEIRBENCH TSB TRASH//////SPGE PGETSBICVELECTRAIL SIGN12" TREE4P 4" TREE18" TREEFLAG POLE 12 STEPSTRELLIS OVERHEADTRASHICV1'± TALL PLANTERTEL GAS GAS GAS MISSION SIGNUTIL VLTSBOLLARD LID-ELEC CONDUIT-HOSE BIBBENCHBENCHBENCHBENCHSIGN WITH NATIVEFISH INFOREE18" TREETOG: 204.68'INV: 203.58'RAIL ON STONE WALL .5± TALL7 STEPSTRASHELECTRELLI S O V E R H E A D 8 STEP S BUILDINGOVERHEADEXPOSEDFOOTING-ELEC B O X -ELEC O U T L E T -ICV -AREA L I G H T DUITUTIL6" PVC1'CMP1'± TALL PLANTER8'± TALL WALLCHORRO STREET MONTEREY STREET25'25'25'25'25'25'25'25'35'BIKE RACKTRASHWALLPLAQUEFOUNTAINPED8 STEPSTSTSSMH RIM=207.92'INV 8"=202.59(E)A-9A-9MATCHLINE127191821311109812154321A-9A-9-7A-9A-7A-7MATCHLINEA-9A-11A-18/20A-9(E)1415A-9A-9A-1216(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)E)1E-0062E-0064E-0063E-0065E-006111ED-102CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:34am - Chris - K:\ENG\2020\20-8170\20-8170_ED-101~ED-102_ELECTRICAL DEMOLITION SITE PLANS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL DEMOLITION SITE PLANREFERENCE NOTESNORTHSCALE:ELECTRICAL DEMOLITION SITE PLAN1"=20'1. EXISTING POST LIGHT TO BE REPLACE WITH NEW. REFER TO IMAGE FORREQUIREMENTS.2. EXISTING RECEPTACLE PEDESTAL TO REMAIN. VERIFY EXACT LOCATION.3. EXISTING PUMP IS THE SAME CIRCUIT AS THE RECEPTACLE CKT 11.4. EXISTING FOUNTAIN TO REMAIN.5. (E)1"BRANCH CIRCUIT CONDUIT PER AS-BUILT.6. EXISTING OUTLET PEDESTAL TO REMAIN WITH DEDICATED CIRCUIT FROM PANEL "D".VERIFY EXACT LOCATION.7. ORIGINALLY CIRCUITED TO CIRCUIT A-7. RE-CIRCUIT TO EXISTING LIGHTING CIRCUITA-9.8. EXISTING PULL BOXES FROM PANEL "D".9. (E)METER/PANEL "D".10. (E)SECURITY CAMERA MOUNTED ON POLE IN THIS LANDSCAPE AREA.11. EXISTING 1-1/4"C BRANCH CIRCUIT CONDUIT PER AS-BUILT.12. (E) OUTLET PEDESTAL WITH DEDICATED CIRCUIT FROM PANEL "D".13. ORIGINALLY CIRCUITED TO CIRCUIT A-12. RE-CIRCUIT TO LIGHTING CIRCUIT A-9.14. EXISTING STEP LIGHT TO REMAIN. ORIGINALLY CIRCUITED TO A-11. RE-CIRCUIT TOEXISTING LIGHTING CIRCUIT A-9.15. (E)1-1/2"BRANCH CIRCUIT CONDUIT PER AS-BUILT.16. EXISTING LIGHT AT STAIRS TO REMAIN. (TYPICAL)17. EXISTING RECEPTACLE PEDESTAL. VERIFY EXACT LOCATION.18. EXISTING STEP LIGHT TO REMAIN.19. EXISTING PULL BOX TO REMAIN.SHEET ED-102SEE SHEET ED-101FOR CONTINUATIONSEE SHEET ED-101FOR CONTINUATIONPage 236 of 802 AAEE1155BBDD224433CC45PANEL "MK"JJJJ323232MK-2,4MK-12,14MK-6,8,10AAEE1155BBDD224433CCB2B2B2B2SWSWSWSWSDSDSDSDSDSDSDSDD,OS33333"MK"3333331111MK-1,31EK-101CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:35am - Chris - K:\ENG\2020\20-8170\20-8170_EK-101_ELECTRICAL KIOSK FLOOR PLANS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL KIOSK FLOOR PLANSREFERENCE NOTES1. PROVIDE 24 HOUR PROGRAMMABLE TIMER FOR EXTERIOR LIGHTINGCONTROLLERS (LEVITON #021-VPT24-1P2 OR APPROVED EQUAL.)2. PROVIDE 4S BOX, RING, COVER PLATE AND 3/4" C.O. (EMT)(OVERHEADTO TERMINAL CABINET FOR FUTURE DATA BY TENANT.3. PROVIDE 4S BOX, RING, COVER PLATE AND 3/4" C.O. (PVC 40) (U.G.) TOPANEL FOR FUTURE USE.4. NEW LOAD CENTER PROVIDE PER PANEL SCHEDULE ON THIS SHEET.5. PROVIDE FLUSH MOUNTED CABINET WITH FOR CITY FIBER, 12"W X 4"D X18"H.2KIOSK POWER/SIGNAL PLANSCALE: 1/4"=1'0"1KIOSK LIGHTING PLANSCALE: 1/4"=1'0"Page 237 of 802 AADD1122BBCCJLCPJ JWATER HEATER7PANELBOARD, "MR"METER/MAIN, "M/M"164"LCP"+42"+42"2J2JJGFI+48"4FIXTURE TYPE 'SG" PROGRAMMABLECONTROLLER, DMX INTERFACE. (6.3" WX 3.6"H1.8"D)MR-5A,5BJJ866GFI+42"48MR-4,6,8MR-2MR-7A,7B5A5BRESTROOM102P. CHASE103RESTROOM1017A7BAADD1122BBCC4OSabcOSPCOSPCSDSDSDAAAAAB1B1ASDSDSDSDSDSDSDSWSWSKYLIGHTSKYLIGHTJLCP MR-1JMR-11,a1,a1,c1,c1,c1,b1,b1,b"MR"5111111113131RESTROOM102P. CHASE103RESTROOM101ER-101CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:35am - Chris - K:\ENG\2020\20-8170\20-8170_ER-101_ELECTRICAL RESTROOM FLOOR PLANS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL RESTROOM FLOOR PLANSREFERENCE NOTES1. CONNECT TO WATER HEATER PER PLUMBING PLANS.2. CONNECT TO ELECTRIC HAND DRYER VERIFY EXACT LOCATION TOARCHITECTURAL PLANS PRIOR TO ROUGH-IN.3. CONNECTION TO FIXTURE TYPE SG CONTROLLER.4. PROVIDE CONNECTION TO LIGHTING CONTROL PANEL ROUTE ALLEXTERIOR LIGHTS AND OUTLETS PER SCHEDULE.5. ROUTE THROUGH "LCP".6. CONNECT TO IRRIGATION CONTROL. VERIFY EXACT LOCATION WITHLANDSCAPE CONSTRUCTION PLANS PRIOR TO ROUGH-IN.7. PROVIDE BLACK FINISH 26U WALL MOUNTED DATA CABINET WITHTEMPERED GLASS DOOR STYLE (CHATSWORTH 48"HX24"WX30"DCUBE-iT CABINET #12419-748 OR APPROVED EQUAL). FURNISH WITHSTANDARD FAN AND FILTER KIT (#40972-001), VERTICAL CABLINGSECTION (2)11U #40970-711 AND (1)4U #4097-704. REFER TO DETAIL6/E-003 FOR ADDITIONAL INFORMATION.2RESTROOM POWER/SIGNAL PLANSCALE: 1/4"=1'0"1RESTROOM LIGHTING PLANSCALE: 1/4"=1'0"OSPCOSLINE VOLTAGE CEILING MOUNT MOTION SENSOR, DUALTECHNOLOGY (PIR/MICROPHONICS) (SENSOR SWITCHCMR PDT 10 CM COVER)LINE VOLTAGE CEILING MOUNT MOTION SENSOR, DUALTECHNOLOGY (PIR/MICROPHONICS) WITH PHOTOCELLWITH DIMMING (SENSOR SWITCH #CMR PDT 10 ADC CMCOVERPage 238 of 802 MONTEREY ST.MURRAYADOBEROWROWWWWWWWWWWSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS24" OLIVE18" TREE4" TREE26" TWVWVWVWV18" TREE2P 18" TREE10" OAK8" TREE26" EUK16" TREE36" TREE28" TREEWLWL ENCH14" OAK12" TREE12" TREE12" TREE123A661793A3ASP18(E)LIMIT OF WORK2713-EK-101-ER-101RESTROOMBUILDINGKIOSK BUILDING81619373A242325"M/M""PR""LCP""PK"1E-0031E-0031026313B1414LVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLV2828SG SGSGSGSP4SPSGSGSGSGSGSGSGSGCP2120VVVVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLV LVLVLV E3C222LVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVC1E3C1E3C1E129E2E2E3E1E1E127SP55(2)2"C.738630323333LVLVLVLV 1134(TBR)(TBR)(TBR)35E132,34[A-6]MR-16,181233MR-3,9,10,13A,13B1013A13B32,3432,3432,34MR-32 [A-6]MR-32 [A-6]4#10+ GND4#10+GND4#10+GND2#10+10CU GND2#10+GND[B-4,6]6#10+10CU GND(E)2"C WITH (E)2#10+10CU GND AND (N)4#10MR-15,17,18,20,26,28,30104#10+GND[A-2,4, B-1,3,4,6][A-7,8,9,10,11,12,14,16][A-18,20,B-21,23](1)2"C (PVC40)-16#8+ GND(1)2"C (PVC40)-2#6,2#8+GNDMR-36/38,40/42MR-10,35,3731MR-12,27,29,31,33,35,37,1210#8+8GND16#8+GND10MR-102#10+GNDVLV2#10+GND&DMXMR-12(2)2"C(PVC40)1236C28AA6B28B283#8+GND(1)1"C(PVC40)MR-39/41MR-23/253#8+GND(1)1"C(PVC40)MR-19/21,14/16(1)1"C(PVC40)(6)#10 THWNAND (1)#10CU GND.92#10+GND2#10+GND2#10+GND4#10+GNDE3332#10+GND2#10+GND1414V V V V LV LV LV LVLVLV LV LV LVLVLVLVLVLVLVLV LV LV LVLVLV LV V LV LVLV4LC503TYPICAL FOR ALL"SG" FIXTURESE439C140ES-101CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:35am - Chris - K:\ENG\2020\20-8170\20-8170_ES-101_ELECTRICAL SITE PLAN.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJELECTRICAL SITE PLANNORTHSCALE:ELECTRICAL SITE PLAN1/8"=1'-0"REFERENCE NOTES1. EXISTING CITY COMMUNICATION MANHOLE PER CITY STANDARD 9030. FIELD VERIFY EXACT LOCATION.2. STUB 2" FIBER CONDUIT WITH NEW FIBER PER SPECIFICATION AND PULL STRING INTO MANHOLE.3. NEW POLE LIGHT WITH NEW 11"X17" PULL BOX.A. PROVIDE SEPARATE CIRCUIT FOR POLE MOUNTED RECEPTACLE.B. SHARE CIRCUIT WITH POLE MOUNTED RECEPTACLE.4. RECONNECT EXISTING POWER AT ART SCULPTURE. INTERCEPT EXISTING BRANCH CIRCUIT AND EXTEND TO NEWPULL BOX AT NEW STREET LIGHT.5. NEW 20' GREEN POLE FOR CAMERA BY CITY POLICE. 24" X 24" X 48" DEEP CONCRETE BASE.6. PROVIDE NEW 2" CONDUIT (UON) TO CAMERA POLE FOR FIBER CABLE PER CITY STANDARD 6035. PROVIDE NEWFIBER CABLE PER SPECIFICATION.7. INTERCEPT EXISTING 2" BRANCH CIRCUIT CONDUIT AND EXTEND TO NEW PULL BOX ADJACENT TO TEMPORARYPOWER.8. TERMINAL CABINET AND 2" FIBER CONDUIT FOR KIOSK. INSTALL CONDUIT PER CITY STANDARD 6035.9. PANEL AND FEEDER TO KIOSK FROM PANEL "FR".10. (3)2"C HOME RUN BRANCH CIRCUIT CONDUIT TO PANEL "FR" INTERCEPT AND EXTEND ALL EXISTING BRANCHCIRCUIT WHEN NEW METER SERVICE AND BREAKERS ARE INSTALL IN THE NEW RESTROOM.11. EXISTING PG&E BOX TO BE REPLACE WITH NEW #3 SECONDARY PULL BOX PER PG&E REQUIREMENTS. PROVIDEPAVER PULL BOX PER WUNDERCOVERS OR APPROVED EQUAL. (ESTIMATE 24"X36" COVER).12. NEW PG&E 4" SECONDARY SERVICE CONDUIT. TRENCH PER PG&E REQUIREMENTS.13. PROVIDE 4FT LONG STRUCTURE FOR TEMPORARY 200AMP METER SERVICE (PER PG&E GREEN BOOK 0635374).MOUNT NEW 200AMP, 120/240V SINGLE PHASE, 42 AMP SPACE, NEMA 3R. REFER TO TEMP PANEL SCHEDULE ONSHEET E-005 DETAIL 25. RECONNECT ALL SITE BRANCH CIRCUIT. PROVIDE LIGHTING RELAY CABINET WITHPHOTOCELL WITH 2-HOUR BY-PASS SWITCH TO TURN ON EXTERIOR RECEPTACLES AND EXTERIOR LIGHTSTHROUGH PHOTOCELL DURING RESTROOM CONSTRUCTION. FURNISHED ALL RELAY/CONTACTOR FOR ACOMPLETE WORKING SYSTEM. NOTE: CONTRACTOR MUST PROVIDE TEMPORARY POWER FIRST FOR EXISTINGLIGHTS AND LIGHTS TO REMAIN BEFORE DEMOLITION OF EXISTING RESTROOM.14. ADD GFCI DUPLEX OUTLET WITH WHILE -IN-USE COVER AT POLE FOR OWNER FURNISHED STRING LIGHTS.CONNECT TO "LCP". REFER TO POLE WITH LANDSCAPE CONSTRUCTION DRAWINGS.15. (E) RECEPTACLE IN THIS AREA. PROVIDE NEW 6" ROUND PULL BOX. SPLICE EXISTING BRANCH CIRCUIT BELOWPULL BOX. PROVIDE PAVER COVER PULL BOX BY WUNDERCOVER OR APPROVED EQUAL. FIELD VERIFY EXACTLOCATION.16. (E) LOCATION OF PULL BOX. RELOCATED AND PROVIDE NEW ELECTRICAL PULL BOX. INTERCEPT AND EXTEND ALLBRANCH CIRCUIT FROM EXISTING LOCATION AND EXTEND TO NEW PULL BOX.17. (E) EXISTING 20' CAMERA POLE.18. INTERCEPT (E) EXISTING BRANCH CIRCUIT CONDUIT AS SHOWN ON DEMOLITION SITE PLAN. WE ARE UNSUREHOW THIS IS ROUTED TO EXISTING RESTROOM. INTERCEPT EXISTING BRANCH CIRCUIT AND EXTEND TO EXISTINGPULL BOX. EXTEND BRANCH CIRCUIT TO TEMPORARY POWER PANEL WHILE RESTROOM IS BEING INSTALLED.19. NEW CONDUITS FOR EXISTING BRANCH CIRCUIT. INTERCEPT AND EXTEND TO TEMPORARY PANEL WHILERESTROOM IS BEING INSTALLED.20. PULL BOX FOR IN-GRADE POWER AND CONTROL WIRING FOR FIXTURE TYPE "SG".21. 1"CONDUIT (PVC40) WITH 120V BRANCH CIRCUIT AND 300V DMX CONTROL WIRING CONDUIT FOR FIXTURE TYPE"SG" PER MANUFACTURER REQUIREMENTS. REFER TO DIAGRAM. PROVIDE 120V AND DMX TO EACH POWERSUPPLY. DAISY CHAIN DMX.22. FIXTURE TYPE "SG" PROGRAMMABLE CONTROLLER. MOUNT ADJACENT TO LIGHT SWITCH.23. DATA CABINET FOR FIBER TERMINATION.24. NEW PG&E APPROVED COMMERCIAL RATED 400AMP METER/MAIN ENCLOSURE, "M/M". REFER TO SINGLE LINEDIAGRAM.25. PANEL BOARD AND LIGHTING CONTROL PANEL AT RESTROOM CHASE.26. EXISTING PG&E SECONDARY CONDUIT (ASSUMED STREET LIGHT).27. INTERCEPT EXISTING BRANCH CIRCUIT TO EXISTING POLE LIGHTS AS SHOWN ON DEMOLITION PLAN. EXTEND TONEW PULL BOX.28. LOCKABLE RECEPTACLE PLUG BOX. FIELD VERIFY EXACT LOCATION WITH LANDSCAPE ARCHITECT PRIOR TOROUGH-IN. REFER TO DETAIL 20/E-005.29. CONNECT TO NEW ART KIOSK MONITOR. COORDINATE WITH MANUFACTURER FOR INSTALLATIONREQUIREMENTS. PROVIDE 120V CONNECTION AND (1)CAT6 UNDERGROUND RATED CABLE FROM DATA CABINET.30. EXISTING BRANCH CIRCUITS IN THE ADOBE ALL HOME RUN TO EXISTING PULL BOX SHOWN ON NOTE 16.31. PROVIDE NEW PULL BOX TO REPLACE WATER VALVE COVER. INTERCEPT EXISTING BRANCH CIRCUIT TO EXISTINGLIGHTS AS SHOWN ON DEMOLITION PLAN AND EXTEND NEW BRANCH CIRCUITS TO TEMPORARY POWER PANELVIA PULL BOX WHILE NEW RESTROOM IS BEING INSTALLED.32. PROVIDE NEW BRANCH CIRCUIT SO EXISTING POLE LIGHTS AND THE ART LIGHTS WILL BE IN OPERATION WHENNEW RESTROOM IS UNDER CONSTRUCTION.33. 20AWG 8 CONDUCTOR DIRECT BURIAL LEAD CABLE WITH DISCONNECT TO CONNECT FROM DRIVER TO FIXTURE.INSTALL 34"C (PVC 40) UNDER CONCRETE OR PAVERS BUT AT LANDSCAPE AREA CAN BE DIRECT BURIAL. (1) PERFIXTURE.34. REPLACE EXISTING ELECTRICAL PULL BOX AND RELOCATE TO NEW PAVER AREA. FIELD VERIFY WHAT THEEXISTING BRANCH CIRCUIT IS FEEDING AND INFORM ENGINEER.35. EXISTING TELEPHONE PULL BOX AND RELOCATE. COORDINATE WITH AT&T. VERIFY WITH CITY OF SLO IF THEYWANT THIS BOX. THIS WAS USED FOR EXISTING TELEPHONE BOOTH.36. INSTALL 2"C BETWEEN TEMPORARY 200AMP NEMA3R LOAD CENTER AND PG&E SECONDARY PULL BOX. PROVIDEWITH (3)#3/0 THWN AND (1)#6 CU GROUND. COORDINATE WITH PG&E. PG&E WILL SPLICE A SECONDARY PULL BOX.37. EXISTING SECONDARY CONDUIT TO EXISTING SUB-SURFACE TRANSFORMER T-249 TO REMAIN.38. INSTALL 2" (PVC 40) SPARE CONDUIT AND STUB TO EXISTING PULL BOX. SPARE CONDUIT WILL BE FOR FUTUREADOBE RENOVATION.39. PROVIDE PULL BOX FOR FUTURE POWER CONNECTION TO ELECTRIFIED BOLLARDS. PROVIDE (2)1"CONDUIT TOPANEL "PR" WITH PULL STRINGS.40. PROVIDE PULL BOX FOR FUTURE SIGNAL CONNECTION TO ELECTRIFIED BOLLARDS. STUB 1"CONDUIT TORESTROOM BUILDING PLUMBING SHAFT. LABEL CONDUIT STUB AS "SIGNAL BOLLARDS". COORDINATE EXACTLOCATION WITH CITY PRIOR TO ROUGH--NPULL BOX LEGENDC1C2E1E2E3V11"X17"X24" CONCRETE PULL BOX FLUSH IN GRADE. LABEL LID "SIGNAL"24"X36"X24" CONCRETE PULL BOX FLUSH IN GRADE. LABEL LID "SIGNAL"17"X30"X24" CONCRETE PULL BOX FLUSH IN GRADE. LABEL LID "ELECTRICAL"16.5"X9.5" X12" IP68 WET-LISTED DIRECT BURIAL VAULT HOUSING FORREMOTE POWER SUPPLY. (Q-TRAN #Q-VAULT-5 [PLATE COVEROPTION]-[RING OPTION]) OR APPROVED EQUAL OPTIONS SELECTED BYLANDSCAPE ARCHITECT.NOTE: FIELD VERIFY EXACT LOCATION OF EACH PULL BOXES SHOWN ON PLANWITH LANDSCAPE ARCHITECT PRIOR TO ROUGH-INFIBER OPTIC CONDUIT BEN MUST HAVE A MINIMUM RADIUS OF 36"17"X30"X24" PAVER PULL BOX FLUSH IN GRADE. LABEL LID "ELECTRICAL"(WUNDERCOVERS OR EQUAL)11"X17"X24" PAVER PULL BOX FLUSH IN GRADE. LABEL LID "ELECTRICAL"(WUNDERCOVERS OR EQUAL)E411"X17"X24" PAVER PULL BOX FLUSH IN GRADE. LABEL LID "ELECTRICAL"Page 239 of 802 ET24101CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:35am - Chris - K:\ENG\2020\20-8170\20-8170_ET24101~ET24102_ENERGY COMPLIANCE DOCUMENTATIONS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJENERGY COMPLIANCE DOC. - INTERIOR LIGHTING (RESTROOM)10.18.2022Page 240 of 802 ET24102CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKAS NOTEDMAY 12 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTSTRCJ May 11, 2023 - 12:35am - Chris - K:\ENG\2020\20-8170\20-8170_ET24101~ET24102_ENERGY COMPLIANCE DOCUMENTATIONS.dwgEXPIRES: 06/30/23THOMA #20-8170ARETMA.ECFNO. 10757EL TSOEATESIGERIWLTLIEAR OLICRTILFCAAINHOMNAREEGINORPDNAOIEFSSL San Luis Obispo, CA 93406P.O. Box 1167 - 3562 Empleo St.THOMA ELECTRIC, INC.Phone: (805) 543-3850cad@thomaelec.comFax: (805) 543-3829CJCJENERGY COMPLIANCE DOC. - INTERIOR LIGHTING (KIOSK)10.18.2022Page 241 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKCONSTRUCTION DOCUMENTSAS NOTEDAPRIL 24, 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS689 Tank Farm Rd., Ste 240SLO, CA 93401BMA JOB# 22203.00OFF: (805) 544-4269BMA Mechanical +M 33,682BRANDON RODGER S MECHANICALEXP 6/30/23REGISTERED PROFESSIONAL ENG IN E ER STATE OF CALIFORNIAP1.0PROJECT TEAM LISTPLUMBING ABBREVIATIONSPLUMBING LEGENDWATER HEATER SCHEDULEPLUMBING FIXTURE SCHEDULEPLUMBING GENERAL NOTESxxxxxxxxSERVICE WATER HEATING STANDARDS AND CODE MEASURESUTILITY SIZINGPLUMBING NOTES, SCHEDULES,LEGEND & ABBREVIATIONSCSCSITMCSPage 242 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKCONSTRUCTION DOCUMENTSAS NOTEDAPRIL 24, 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS689 Tank Farm Rd., Ste 240SLO, CA 93401BMA JOB# 22203.00OFF: (805) 544-4269BMA Mechanical +M 33,682BRANDON RODGER S MECHANICALEXP 6/30/23REGISTERED PROFESSIONAL ENG IN E ER STATE OF CALIFORNIAP2.0PLUMBINGDETAILSGREASE INTERCEPTORABUILDING WATER SUPPLYCLEANOUT TO GRADEFLOOR CLEANOUTWALL CLEANOUTTRAP PRIMERVALVE IN YARD BOXWH-1123456789CSCSITMCSPage 243 of 802 AADD1122BBCCAADD1122BBCCP3.0CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKCONSTRUCTION DOCUMENTSAS NOTEDAPRIL 24, 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS689 Tank Farm Rd., Ste 240SLO, CA 93401BMA JOB# 22203.00OFF: (805) 544-4269BMA Mechanical +M 33,682BRANDON RODGER S MECHANICALEXP 6/30/23REGISTERED PROFESSIONAL ENG IN E ER STATE OF CALIFORNIAGENERAL NOTESREFERENCE NOTESPLUMBING FLOOR PLANS (RESTROOMS) - WASTE & WATERSCALE: 1/4" = 1' - 0"HOT & COLD WATER WASTE & VENTCSCSITMCSPLUMBING FLOOR PLANS(RESTROOMS) WASTE & WATERPage 244 of 802 AAEE1155BBDD224433CCAAEE1155BBDD224433CCP3.1CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKCONSTRUCTION DOCUMENTSAS NOTEDAPRIL 24, 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS689 Tank Farm Rd., Ste 240SLO, CA 93401BMA JOB# 22203.00OFF: (805) 544-4269BMA Mechanical +M 33,682BRANDON RODGER S MECHANICALEXP 6/30/23REGISTERED PROFESSIONAL ENG IN E ER STATE OF CALIFORNIAGENERAL NOTESREFERENCE NOTESPLUMBING FLOOR PLANS (KIOSK) - WASTE & WATERSCALE: 1/4" = 1' - 0"COLD WATER WASTE & VENTPLUMBING FLOOR PLANS(KIOSK) WASTE & WATERCSCSITMCSPage 245 of 802 CITY SPECIFICATION NO.DATE:PROJECT TITLE:SHEET TITLE:SHEET NO.DESIGNED BY:DRAWN BY:CHECKED BY:APPROVED BY:SCALE:PLAN FILE NO. / LOCATIONMISSION PLAZA RESTROOM & KIOSKCONSTRUCTION DOCUMENTSAS NOTEDAPRIL 24, 20230256-03-CU2091439-01100% CONSTRUCTION DOCUMENTS689 Tank Farm Rd., Ste 240SLO, CA 93401BMA JOB# 22203.00OFF: (805) 544-4269BMA Mechanical +M 33,682BRANDON RODGER S MECHANICALEXP 6/30/23REGISTERED PROFESSIONAL ENG IN E ER STATE OF CALIFORNIASSSIIIIIGGGGGGGGEEEEEEERRRRREERREGISSIIGGERRGGGGGGEEERRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR2222222222222888888888886666666666,,,,3333333,682222222222288888888866666666,,22222222222222228888888888666666666,,,3333333636663633336666363633336EERRRRRRRRRRRRRRRRRRRRRRRRRRRRRRREEEEEEEEEEEEEERRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRREEEEEEEEEEEEEEE AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAARRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR 66666666666666666666666666666EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEn1.0CSCSPSCSPLUMBING ENERGY COMPLIANCEPage 246 of 802 63(&,$/3529,6,216 )25 &,7<2)6$1/8,62%,632 0LVVLRQ3OD]D5HVWURRPDQG.LRVN 6SHFLILFDWLRQ1R -81( 38%/,&:25.6'(3$570(17 (1*,1((5,1*',9,6,21 3DOP6WUHHW 6DQ/XLV2ELVSR&$ Page 247 of 802 0LVVLRQ3OD]D5HVWURRPDQG.LRVN 6SHFLILFDWLRQ1R $SSURYDO'DWH-XQHNS E D ARCHI ST A T T AA EOF C A L I F O RNIAKAKKTAA H R YR N ANNEHI CK S C-38079 02 - 28 - 2021 RENEWAL DATE 2025 Page 248 of 802 7$%/(2)&217(176 127,&(72%,''(56, %,'68%0,66,21, %,''2&80(176,, 352-(&7,1)250$7,21,, 48$/,),&$7,216,,, $:$5'9 $&&2002'$7,219 %,')2506$ %,',7(0/,67$ /,672)68%&2175$&7256( 38%/,&&2175$&7&2'(6(&7,2167$7(0(17) 38%/,&&2175$&7&2'(6(&7,2148(67,211$,5() 38%/,&&2175$&7&2'(6(&7,2167$7(0(17) /$%25&2'(6(&7,2167$7(0(176) 121&2//86,21'(&/$5$7,21+ %,''(5$&.12:/('*(0(176- 48$/,),&$7,216. 63(&,$/3529,6,216 ',9,6,21,*(1(5$/3529,6,216 *(1(5$/ &2175$&7$:$5'$1'(;(&87,21 6&23(2):25. &21752/2)0$7(5,$/6 /(*$/5(/$7,216$1'5(63216,%,/,7<727+(38%/,& 3526(&87,21$1'352*5(66 3$<0(17 ',9,6,21,,*(1(5$/&216758&7,21 :$7(532//87,21&21752/ (;,67,1*)$&,/,7,(6 ',9,6,21,,,($57+:25.$1'/$1'6&$3( /$1'6&$3($1',55,*$7,21 $6,7()851,6+,1*6.......................................................14 ',9,6,219685)$&,1*6$1'3$9(0(176.............................................................15 $63+$/7&21&5(7( 20 *5$1,7(&5(7( .........................................................9 ',9,6,219,,,0,6&(//$1(286&216758&7,21...............................................................16 Page 249 of 802 &21&5(7(&85%6$1'6,'(:$/.6 ',9,6,21;,,,$33(1',&(6 $33(1',;$)2502)$*5((0(17 $33(1',;%±7(&+1,&$/63(&,),&$7,216.............21 Page 250 of 802 127,&(72%,''(56 L 127,&(72%,''(56 %,'68%0,66,21 6HDOHGELGVZLOOEHUHFHLYHGE\WKH&LW\RI6DQ/XLV2ELVSRDWWKH3XEOLF:RUNV $GPLQLVWUDWLRQ2IILFHORFDWHGDW3DOP6WUHHW6DQ/XLV2ELVSR&DOLIRUQLD XQWLO DPRQ$XJXVW DWZKLFKWLPHWKH\ZLOOEHSXEOLFO\RSHQHGDQGUHDGDORXG3XEOLFELGRSHQLQJPD\EH DFFHVVHGYLD0LFURVRIW7HDPVYLGHRDQGFRQIHUHQFHFDOOXVLQJWKHOLQNEHORZ ,16(57/,1.+(5( RUMRLQE\SKRQHZLWKWKLVQXPEHU,16(57180%(5$1'&21)(5(1&(,' 6XEPLWELGLQDVHDOHGHQYHORSHSODLQO\PDUNHG 0,66,213/$=$5(675220$1'.,26.63(&,),&$7,2112 $Q\ELGUHFHLYHGDIWHUWKHWLPHDQGGDWHVSHFLILHGZLOOQRWEHFRQVLGHUHGDQGZLOOEH UHWXUQHGWRWKHELGGHUXQRSHQHG%LGVUHFHLYHGE\)D[RU(PDLOZLOOQRWEHFRQVLGHUHG %\VXEPLVVLRQRIELG\RXDJUHHWRFRPSO\ZLWKDOOLQVWUXFWLRQDQGUHTXLUHPHQWVLQWKLV QRWLFHDQGWKHFRQWUDFWGRFXPHQWV $OOELGVPXVWEHVXEPLWWHGRQWKH%LG,WHP/LVWIRUPVSURYLGHGDQGVXEPLWWHGZLWKDOO RWKHU%LG)RUPVLQFOXGHGLQWKHVH6SHFLDO3URYLVLRQV (DFKELGPXVWEHDFFRPSDQLHGE\HLWKHUD FHUWLILHGFKHFN FDVKLHU VFKHFN ELGGHU VERQG PDGHSD\DEOHWRWKH&LW\RI6DQ/XLV2ELVSRIRUDQDPRXQWHTXDOWRWHQSHUFHQWRIWKH ELGDPRXQWDVDJXDUDQW\*XDUDQW\ZLOOEHIRUIHLWHGWRWKH&LW\6DQ/XLV2ELVSRLIWKH ELGGHUWRZKRPWKHFRQWUDFWLVDZDUGHGIDLOVWRHQWHULQWRWKHFRQWUDFW 7KH&LW\RI6DQ/XLV2ELVSRUHVHUYHVWKHULJKWWRDFFHSWRUUHMHFWDQ\RUDOOELGVRU ZDLYHDQ\LQIRUPDOLW\LQDELG $OOELGVDUHWREHFRPSDUHGEDVHGRQWKH&LW\(QJLQHHU VHVWLPDWHRIWKHTXDQWLWLHVRI ZRUNWREHGRQHDVVKRZQRQWKH%LG,WHP/LVW %LGVZLOORQO\EHDFFHSWHGIURPELGGHUVWKDWDUHOLFHQVHGLQFRPSOLDQFHZLWKWKH SURYLVLRQVRI&KDSWHU'LYLVLRQ,,,RI%XVLQHVVDQG3URIHVVLRQV&RGH August 3, 2023 https://teams.microsoft.com/l/meetup-join/19%3ameeting_MDBjMjk2M2ItZGU3Yi00YjhkLWFmMGYtOWMwMTJmNzM4N2I3%40thread.v2 /0?context=%7b%22Tid%22%3a%22a78b182d-94e4-4507-a9a9-330dcb148164%22%2c%22Oid%22%3a%22a8add278-38fa-47c3-8727- acd5a57b58ec%22%7d or join by phone with this number: 1(209)645-4516 with Conference ID:616 131 907# Submit bid in a sealed envelope plainly marked: Page 251 of 802 127,&(72%,''(56 127,&(72%,''(56 LL 7KHDZDUGRIWKHFRQWUDFWLIDZCDUGHGZLOOEHWRWKHORZHVWUHVSRQVLYHELGVXEPLWWHGE\ DUHVSRQVLEOHFRQWUDFWRUZKRVHELGFRPSOLHVZLWKWKHUHTXLUHPHQWVSUHVFULEHG,IWKH FRQWUDFWLVDZDUGHGWKHFRQWUDFWZLOOEHDZDUGHGZLWKLQFDOHQGDUGD\VDIWHUWKH RSHQLQJRIWKHELGV )DLOXUHWRUDLVHGHIHFWVLQWKHQRWLFHWRELGGHUVRUELGIRUPVSULRUWRELGRSHQLQJ FRQVWLWXWHDZDLYHURIWKRVHGHIHFWV %,''2&80(176 $FRS\RIWKHSODQVDQGVSHFLDOSURYLVLRQVPD\EHGRZQORDGHGIUHHRIFKDUJHIURPWKH &LW\¶VZHEVLWHDW ZZZVORFLW\RUJJRYHUQPHQWGHSDUWPHQWGLUHFWRU\SXEOLFZRUNVSXEOLFZRUNVELGV SURSRVDOV 1RSULQWHGFRSLHVDUHDYDLODEOHIRUSXUFKDVHDWWKH&LW\RIILFH 6WDQGDUG6SHFLILFDWLRQVDQG(QJLQHHULQJ6WDQGDUGVUHIHUHQFHGLQWKH6SHFLDO 3URYLVLRQVPD\EHGRZQORDGHGIUHHRIFKDUJHIURPWKH&LW\¶VZHEVLWHDW ZZZVORFLW\RUJJRYHUQPHQWGHSDUWPHQWGLUHFWRU\SXEOLFZRUNVGRFXPHQWV RQOLQHFRQVWUXFWLRQGRFXPHQWV <RXDUHUHVSRQVLEOHWRREWDLQDOOLVVXHGDGGHQGDSULRUWRELGRSHQLQJ$GGHQGDZLOOEH DYDLODEOHWRGRZQORDGDWWKH&LW\¶VZHEVLWHOLVWHGDERYHRUDWWKHRIILFHRIWKH&LW\ (QJLQHHU &RQWDFWWKHSURMHFWPDQDJHU6KHOVLH0RRUHDWRUWKH3XEOLF:RUNV 'HSDUWPHQWDWSULRUWRELGRSHQLQJWRYHULI\WKHQXPEHURIDGGHQGD LVVXHG <RXDUHUHVSRQVLEOHWRYHULI\\RXUFRQWDFWLQIRUPDWLRQLVFRUUHFWRQWKHSODQKROGHUVOLVW ORFDWHGRQWKH&LW\¶VZHEVLWHDW ZZZVORFLW\RUJJRYHUQPHQWGHSDUWPHQWGLUHFWRU\SXEOLFZRUNVSXEOLFZRUNVELGV SURSRVDOV 352-(&7,1)250$7,21 ,QJHQHUDOWKHSURMHFWFRQVLVWVRIGHPROLWLRQRIWKHH[LVWLQJUHVWURRPEXLOGLQJWUHOOLV VWUXFWXUHDQGVLWHLPSURYHPHQWVIRUWKHFRQVWUXFWLRQRIDQHZUHVWURRPDQGNLRVN EXLOGLQJZLWKDGMDFHQWSOD]DDQGSDWLR 7KHSURMHFWHVWLPDWHGFRQVWUXFWLRQFRVWLV &RQWUDFWWLPHLVHVWDEOLVKHGDVZRUNLQJGD\V Page 252 of 802 127,&(72%,''(56 127,&(72%,''(56 LLL 7KHIL[HGOLTXLGDWHGGDPDJHVDPRXQWLVHVWDEOLVKHGDWSHUGD\IRUIDLOXUHWR FRPSOHWHWKHZRUNZLWKLQWKHFRQWUDFWWLPH ,QFRPSOLDQFHZLWKVHFWLRQRIWKH/DERU&RGHWKH6WDWHRI&DOLIRUQLD'HSDUWPHQW RI,QGXVWULDO5HODWLRQVKDVHVWDEOLVKHGSUHYDLOLQJKRXUO\ZDJHUDWHVIRUHDFKW\SHRI ZRUNPDQ&XUUHQWZDJHUDWHVPD\EHREWDLQHGIURPWKH'LYLVLRQRI/DERUDW KWWSVZZZGLUFDJRYRSUO'3UH:DJH'HWHUPLQDWLRQKWP 7KLVSURMHFWLVVXEMHFWWRFRPSOLDQFHPRQLWRULQJDQGHQIRUFHPHQWE\WKH'HSDUWPHQWRI ,QGXVWULDO5HODWLRQV 48$/,),&$7,216 <RXPXVWSRVVHVVDYDOLG&ODVV%&RQWUDFWRU V/LFHQVHDWWKHWLPHRIWKHELGRSHQLQJ <RXDQGDQ\VXEFRQWUDFWRUVUHTXLUHGWRSD\SUHYDLOLQJZDJHPXVWEHUHJLVWHUHG ZLWKWKH'HSDUWPHQWRI,QGXVWULDO5HODWLRQVSXUVXDQWWR6HFWLRQRIWKH /DERU&RGH <RXPXVWKDYHH[SHULHQFHFRQVWUXFWLQJSURMHFWVVLPLODUWRWKHZRUNVSHFLILHGIRUWKLV SURMHFW3URYLGHWKUHHVLPLODUUHIHUHQFHSURMHFWVFRPSOHWHGDVHLWKHUWKHSULPHRU VXEFRQWUDFWRU$OOUHIHUHQFHGSURMHFWVPXVWKDYHEHHQFRPSOHWHGZLWKLQWKHODVWILYH \HDUVIURPWKLVSURMHFW¶VELGRSHQLQJGDWH 7ZRRIWKHWKUHHUHIHUHQFHSURMHFWVPXVWKDYHEHHQFRPSOHWHGXQGHUFRQWUDFW ZLWKDFLW\FRXQW\VWDWHRUIHGHUDOJRYHUQPHQWDJHQF\DVWKHSULPHFRQWUDFWRU 7ZRRIWKHWKUHHUHIHUHQFHGSURMHFWVPXVWLQFOXGHSXEOLFIDFLOLWLHVEXLOGLQJ FRQVWUXFWLRQ 2QHRIWKHWKUHHUHIHUHQFHGSURMHFWVPXVWLQFOXGHEULFNSDYLQJ 3ODVWHUZRUN5HVWRUHU4XDOLILFDWLRQV&RPSDQ\VSHFLDOL]LQJLQSHULRGSODVWHU UHVWRUDWLRQZLWKPLQLPXP>WHQ@\HDUVRIGRFXPHQWHGH[SHULHQFH )DLOXUHWRSURYLGHUHIHUHQFHSURMHFWVDVVSHFLILHGLQWKLVVHFWLRQDQGDVUHTXLUHGRQWKH TXDOLILFDWLRQIRUPLVFDXVHWRUHMHFWDELGDVEHLQJQRQUHVSRQVLYH 7KH&LW\UHVHUYHVWKHULJKWWRUHMHFWDQ\ELGEDVHGRQQRQUHVSRQVLYHQHVVLIDELGGHU IDLOVWRSURYLGHDELGWKDWFRPSOLHVZLWKDOOELGGLQJLQVWUXFWLRQV 7KH&LW\UHVHUYHVWKHULJKWWRUHMHFWDUHVSRQVLYHELGEDVHGRQWKHQRQUHVSRQVLELOLW\RI WKHELGGHULIWKH'LUHFWRURI3XEOLF:RUNVRU'HVLJQHHILQGVDIWHUSURYLGLQJQRWLFHDQGD KHDULQJWRWKHELGGHUWKDWWKHELGGHUODFNVWKH Two of the referenced projects must include public facilities building construction. One of the three referenced projects must include brick paving. Plasterwork Restorer contracted to work on the Murray Adobe must have a minimum 10 years of documented experience. Page 253 of 802 127,&(72%,''(56 127,&(72%,''(56 LY NQRZOHGJH H[SHULHQFH RULVRWKHUZLVHQRWUHVSRQVLEOHDVGHILQHGLQ6HFWLRQRIWKH6DQ/XLV2ELVSR 0XQLFLSDO&RGHWRFRPSOHWHWKHSURMHFWLQWKHEHVWLQWHUHVWRIWKH&LW\ 5HMHFWHGELGGHUVPD\DSSHDOWKLVGHWHUPLQDWLRQ$SSHDOPXVWFRPSO\ZLWKWKH UHTXLUHPHQWVLQWKLV1RWLFHWR%LGGHUV ,WLVWKH&LW\RI6DQ/XLV2ELVSR¶VLQWHQWWRDZDUGWKHFRQWUDFWWRWKHORZHVWUHVSRQVLYH ELGVXEPLWWHGE\DUHVSRQVLEOHELGGHU,ILQWKHELGGHU¶VRSLQLRQWKHFRQWUDFWKDVEHHQRU PD\EHLPSURSHUO\DZDUGHGWKHELGGHUPD\SURWHVWWKHFRQWUDFWDZDUG 3URWHVWVPXVWEHILOHGQRODWHUWKDQILYHZRUNLQJGD\VDIWHUHLWKHU ELGRSHQLQJGDWH QRWLILFDWLRQRIUHMHFWHGELG 3URWHVWPXVWEHLQZULWLQJDQGUHFHLYHGE\WKHSURMHFWPDQDJHUORFDWHGDW 3DOP6WUHHW 6DQ/XLV2ELVSR&$ 9DOLGSURWHVWVPXVWFRQWDLQWKHIROORZLQJLQIRUPDWLRQ WKHUHDVRQVIRUWKHSURWHVW DQ\VXSSRUWLQJGRFXPHQWDWLRQ WKHUXOLQJH[SHFWHGE\WKH&LW\WRUHPHG\WKHSURWHVW $Q\SURWHVWQRWFRQWDLQLQJDOOUHTXLUHGLQIRUPDWLRQZLOOEHGHHPHGLQYDOLGDQGUHMHFWHG 7KH&LW\ZLOOFRQVLGHUDGGLWLRQDOGRFXPHQWDWLRQRURWKHUVXSSRUWLQJLQIRUPDWLRQ UHJDUGLQJWKHSURWHVWLIVXEPLWWHGLQFRPSOLDQFHWRWKHVSHFLILHGWLPHOLPLWV$Q\WKLQJ VXEPLWWHGDIWHUWKHVSHFLILHGWLPHOLPLWZLOOEHUHMHFWHGDQGQRWEHFRQVLGHUHG 7KH'LUHFWRURI3XEOLF:RUNVRU'HVLJQHHPD\UHTXHVWDGGLWLRQDOLQIRUPDWLRQWREH VXEPLWWHGZLWKLQWKUHHGD\VRIWKHUHTXHVWXQOHVVRWKHUZLVHVSHFLILHGDQGZLOOQRWLI\WKH SURWHVWHURIUXOLQJZLWKLQWHQGD\VRIGHWHUPLQDWLRQ ,IWKHSURWHVWHULVQRWVDWLVILHGZLWKUXOLQJWKHSURWHVWHUPD\DSSHDOWKHUXOLQJWRWKH&LW\ &RXQFLOLQFRPSOLDQFHZLWK&KDSWHURIWKH&LW\RI6DQ/XLV2ELVSR0XQLFLSDO&RGH 3XUVXDQWWRWKH3XEOLF5HFRUGV$FW*RYHUQPHQW&RGHHWVHTWKH&LW\ZLOO PDNHSXEOLFUHFRUGVDYDLODEOHXSRQUHTXHVW Page 254 of 802 127,&(72%,''(56 127,&(72%,''(56 Y $:$5' 7KHORZHVWELGGHUZLOOEHGHWHUPLQHGLQFRPSOLDQFHZLWK3XEOLF&RQWUDFW&RGH6HFWLRQ FZLWKWKH3XEOLFO\'LVFORVHG)XQGLQJ$PRXQWRIXVLQJ727$/ 352-(&7%,' $VDFRQGLWLRQWRH[HFXWLQJDFRQWUDFWZLWKWKH&LW\WZRERQGVHDFKHTXDOWRRQH KXQGUHGSHUFHQWRIWKHWRWDOFRQWUDFWSULFHDUHUHTXLUHGLQFRPSOLDQFHZLWK6HFWLRQ RIWKH6WDQGDUG6SHFLILFDWLRQV <RXPD\VXEVWLWXWHVHFXULWLHVIRUPRQH\VZLWKKHOGXQGHUWKHFRQWUDFWLQFRPSOLDQFHZLWK WKHSURYLVLRQVRIWKH3XEOLF&RQWUDFW&RGH6HFWLRQ $&&2002'$7,21 ,IDQ\DFFRPPRGDWLRQVDUHQHHGHGWRSDUWLFLSDWHLQWKHELGSURFHVVSOHDVHFRQWDFW $UJHOLD&KDQJDWRUE\7HOHFRPPXQLFDWLRQV'HYLFHIRUWKH'HDIDW 5HTXHVWVVKRXOGEHPDGHDVHDUO\DVSRVVLEOHLQWKHELGGLQJSURFHVVWRDOORZ WLPHIRUDFFRPPRGDWLRQ Page 255 of 802 %,')2506 $ %,')2506 $OOELGIRUPVPXVWEHFRPSOHWHGDQGVXEPLWWHGZLWK\RXUELG)DLOXUHWRVXEPLWWKHVH IRUPVDQGUHTXLUHGELGERQGLVFDXVHWRUHMHFWWKHELGDVQRQUHVSRQVLYH6WDSOHDOOELG IRUPVWRJHWKHU 7+(81'(56,*1('DJUHHVWKDWWKH\KDYHFDUHIXOO\H[DPLQHG WKHORFDWLRQRIWKHSURSRVHGZRUN WKHSODQVDQGVSHFLILFDWLRQV UHDGWKHDFFRPSDQ\LQJLQVWUXFWLRQVWRELGGHUV DQGSURSRVHWRIXUQLVKDOO PDWHULDOV ODERU WRFRPSOHWHDOOWKHUHTXLUHGZRUNVDWLVIDFWRULO\LQFRPSOLDQFHZLWK SODQV VSHFLILFDWLRQV VSHFLDOSURYLVLRQV IRUWKHSULFHVVHWIRUWKLQWKHELGLWHPOLVW %,',7(0/,67 0,66,213/$=$5(675220$1'.,26.63(&,),&$7,2112 ,WHP,WHP8QLWRI(VWLPDWHG,WHP3ULFH7RWDO 1R66'HVFULSWLRQ0HDVXUH4XDQWLW\LQILJXUHVLQILJXUHV 75$)),&&21752//6 :$7(532//87,21 &21752//6 6$:&87$1''(02 (;,67,1*3$9(0(17&85% $1'6,'(:$/. /6 '(02(;,67,1*%8,/',1* /6 '(020,6&:$//6)(1&( &21&5(7(75(//,6(7&/6 &/($5$1'*58% 64)7 528*+*5$',1*&87),// &< 35(&,6(*5$',1* 64)7 &203$&7('68%*5$'(6 6,'(:$/. 3/$=$6) &21&5(7(&85% /) +270,;$63+$/73$7&+ 3$9,1*64)7 %5,&.81,73$9,1* 64)7 &85%3$,17 /) ´:+,7(75$)),&675,3( /) 5(/2&$7(675((76,*1 ($ Page 256 of 802 %,')2506 %,')2506 % ,WHP,WHP8QLWRI(VWLPDWHG,WHP3ULFH7RWDO 1R66'HVFULSWLRQ0HDVXUH4XDQWLW\LQILJXUHVLQILJXUHV 39&67250'5$,1 /) ´3(5)25$7('39&67250 '5$,1/) ´648$5(&$7&+%$6,1 $1'*5$7(($ 75(1&+'5$,1$1'*5$7( ($ ´:$7(56(59,&( ($ ´%$&.)/2:35(9(17,21 '(9,&(($ ´39&6(:(5/$7(5$/ /) &/$66$**5(*$7(%$6( &< &/$663(50($%/(%$6( &< 12*5$9(/6721( &< 126721( &< 3(50($%/(%5,&.81,7 3$9,1*64)7 *5$1,7(&5(7(3$9,1* 64)7 %5,&.('*(%$1' /) %5,&.('*(%$1'$7 3(50($%/(%5,&./) 02:&85% /) *5$1,7(3/$17(5&85% /) %5,&.67(36 64)7 &21&5(7(5(7$,1,1*&85% /) %5,&.6($7:$// /) 6721(6($7:$// /) %(1&+ ($ 75,3/(675($0:$67( 5(&(37$&/(($ 029($%/(%,67527$%/( ($ 3/$17(5327$ ($ 3/$17(5327% ($ %,.(5$&. ($ '5,1.,1*)2817$,1 ($ Page 257 of 802 %,')2506 %,')2506 & ,WHP,WHP8QLWRI(VWLPDWHG,WHP3ULFH7RWDO 1R66'HVFULSWLRQ0HDVXUH4XDQWLW\LQILJXUHVLQILJXUHV &867203(5)25$7('$57 )(1&( 64)7 &867203(5)25$7('$57 )(1&( 64)7 $57)(1&(6&5(:6 /6 )(1&(32676 /6 62,/35(3$5$7,21 &219(17,21$/64)7 3/$17,1*±6+58%$5($ 64)7 3/$17,1*±*5$666((' 64)7 75((6±´%2; ($ 75((±´%2; ($ 75((±´%2; ($ ,55,*$7,21'5,3$1'635$< 64)7 ,55,*$7,21&21752//(5 ($ 08/&+ 6) &217$,1(5 62,/3/$176,167$//($ '(&25$7,9(3,&.(7)(1&( /) 3/$17(5)(1&( /) 0,66,2167</(5$,/,1* /) /$1'6&$3,1*%28/'(5 ($ <($5/$1'6&$3( 0$,17(1$1&(($ 5(675220%8,/',1*± &RQWUDFWRUWRSURYLGHVFKHGXOH RIYDOXHVEDVHGRQ&6, VSHFLILFDWLRQGLYLVLRQIRUEXLOGLQJ /6 .,26.%8,/',1*&RQWUDFWRU WRSURYLGHVFKHGXOHRIYDOXHV EDVHGRQ&6,VSHFLILFDWLRQ GLYLVLRQIRUEXLOGLQJ /6 (/(&75,&$/$1' &20081,&$7,21 ,03529(0(176 /6 /,*+732/()281'$7,21 $1'/80,1$5(/6 6(&85,7<&$0(5$32/( $1')281'$7,21/6 Page 258 of 802 %,')2506 %,')2506 ' ,WHP,WHP8QLWRI(VWLPDWHG,WHP3ULFH7RWDO 1R66'HVFULSWLRQ0HDVXUH4XDQWLW\LQILJXUHVLQILJXUHV $5&+(2/2*,&$/ 021,725,1* 7RWDO3URMHFW%LG &RPSDQ\1DPH UHIHUVWRVHFWLRQLQWKH6WDQGDUG6SHFLILFDWLRQVZLWKPRGLILFDWLRQVLQWKH6SHFLDO3URYLVLRQVWKDWGHVFULEH UHTXLUHGZRUN Page 259 of 802 %,')2506 %,')2506 ( /,672)68%&2175$&7256 3XUVXDQWWR6HFWLRQRIWKH3XEOLF&RQWUDFWV&RGHDQGVHFWLRQ&RIWKH VWDQGDUGVSHFLILFDWLRQVWKH%LGGHULVUHTXLUHGWRIXUQLVKWKHIROORZLQJLQIRUPDWLRQIRU HDFK6XEFRQWUDFWRUSHUIRUPLQJPRUHWKDQSHUFHQWRIWKHWRWDOEDVHELG'R QRWOLVWDOWHUQDWLYHVXEFRQWUDFWRUVIRUWKHVDPHZRUN6XEFRQWUDFWLQJPXVWQRWWRWDOPRUH WKDQILIW\SHUFHQWRIWKHVXEPLWWHGELGH[FHSWDVDOORZHGLQVHFWLRQRIWKH VWDQGDUGVSHFLILFDWLRQV )RU6WUHHWV +LJKZD\VSURMHFWVVXEFRQWUDFWRUVSHUIRUPLQJOHVVWKDQWHQWKRXVDQG GROODUVZRUWKRIZRUNQHHGQRWEHPHQWLRQHG6XEFRQWUDFWRUVUHTXLUHGWRSD\ SUHYDLOLQJZDJHPXVWEHUHJLVWHUHGZLWKWKH'HSDUWPHQWRI,QGXVWULDO5HODWLRQV SXUVXDQWWR/DERU&RGHVHFWLRQWREHOLVWHG 127(,IWKHUHDUHQRVXEFRQWUDFWRUVZULWH³121(´DQGVXEPLWZLWKELG 1DPH8QGHU:KLFK 6XEFRQWUDFWRULV/LFHQVHG /LFHQVH1XPEHU ',53XEOLF :RUNV 5HJLVWUDWLRQ 1XPEHU $GGUHVVDQG3KRQH 1XPEHURI2IILFH0LOORU 6KRS 6SHFLILF 'HVFULSWLRQRI 6XEFRQWUDFW RI 7RWDO %DVH %LG $WWDFKDGGLWLRQDOVKHHWVDVQHHGHG Page 260 of 802 %,')2506 %,')2506 ) 38%/,&&2175$&7&2'(6(&7,2167$7(0(17 ,QFRPSOLDQFHZLWK3XEOLF&RQWUDFW&RGH6HFWLRQ&KDSWHU6WDWV WKHELGGHUKHUHE\GHFODUHVXQGHUSHQDOW\RISHUMXU\XQGHUWKHODZVRIWKH6WDWHRI &DOLIRUQLDWKDWWKHELGGHURUDQ\VXEFRQWUDFWRUWREHHQJDJHGE\WKHELGGHUKDVBBBB KDVQRWBBBBEHHQFRQYLFWHGZLWKLQWKHSUHFHGLQJWKUHH\HDUVRIDQ\RIIHQVHVUHIHUUHG WRLQWKDWVHFWLRQLQFOXGLQJDQ\FKDUJHRIIUDXGEULEHU\FROOXVLRQFRQVSLUDF\RUDQ\ RWKHUDFWLQYLRODWLRQRIDQ\VWDWHRUIHGHUDODQWLWUXVWODZLQFRQQHFWLRQZLWKWKHELGGLQJ XSRQDZDUGRIRUSHUIRUPDQFHRIDQ\SXEOLFZRUNVFRQWUDFWDVGHILQHGLQ3XEOLF &RQWUDFW&RGH6HFWLRQZLWKDQ\SXEOLFHQWLW\DVGHILQHGLQ3XEOLF&RQWUDFW&RGH 6HFWLRQLQFOXGLQJWKH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLDRUWKH7UXVWHHVRIWKH &DOLIRUQLD6WDWH8QLYHUVLW\7KHWHUPELGGHULVXQGHUVWRRGWRLQFOXGHDQ\SDUWQHU PHPEHURIILFHUGLUHFWRUUHVSRQVLEOHPDQDJLQJRIILFHURUUHVSRQVLEOHPDQDJLQJ HPSOR\HHWKHUHRIDVUHIHUUHGWRLQ6HFWLRQ 127(7KHELGGHUPXVWSODFHDFKHFNPDUNDIWHUKDVRUKDVQRWLQRQHRIWKHEODQN VSDFHVSURYLGHG7KHDERYH6WDWHPHQWLVSDUWRIWKH%LG6LJQLQJWKLV%LGRQWKH VLJQDWXUHSRUWLRQFRQVWLWXWHVLJQDWXUHRIWKLV6WDWHPHQW%LGGHUVDUHFDXWLRQHGWKDW PDNLQJDIDOVHFHUWLILFDWLRQPD\VXEMHFWWKHFHUWLILHUWRFULPLQDOSURVHFXWLRQ 38%/,&&2175$&7&2'(6(&7,2148(67,211$,5( ,QFRPSOLDQFHZLWK3XEOLF&RQWUDFW&RGH6HFWLRQWKH%LGGHUPXVWFRPSOHWH XQGHUSHQDOW\RISHUMXU\WKHIROORZLQJTXHVWLRQQDLUH +DVWKHELGGHUDQ\RIILFHURIWKHELGGHURUDQ\HPSOR\HHRIWKHELGGHUZKRKDVD SURSULHWDU\LQWHUHVWLQWKHELGGHUHYHUEHHQGLVTXDOLILHGUHPRYHGRURWKHUZLVH SUHYHQWHGIURPELGGLQJRQRUFRPSOHWLQJDIHGHUDOVWDWHRUORFDOJRYHUQPHQWSURMHFW EHFDXVHRIDYLRODWLRQRIODZRUDVDIHW\UHJXODWLRQ" <HV 1R ,IWKHDQVZHULV\HVDWWDFKDOHWWHUH[SODLQLQJWKHFLUFXPVWDQFHV 38%/,&&2175$&7&2'(6(&7,2167$7(0(17 ,QFRPSOLDQFHZLWK3XEOLF&RQWUDFW&RGH6HFWLRQ\RXKHUHE\VWDWHXQGHUSHQDOW\ RISHUMXU\WKDWQRPRUHWKDQRQHILQDOXQDSSHDODEOHILQGLQJRIFRQWHPSWRIFRXUWE\D IHGHUDOFRXUWKDVEHHQLVVXHGDJDLQVW\RXZLWKLQWKHLPPHGLDWHO\SUHFHGLQJWZR\HDU SHULRGEHFDXVHRI\RXUIDLOXUHWRFRPSO\ZLWKDQRUGHURIDIHGHUDOFRXUWZKLFKRUGHUV\RX WRFRPSO\ZLWKDQRUGHURIWKH1DWLRQDO/DERU5HODWLRQV%RDUG /$%25&2'(6(&7,2167$7(0(176 7KHELGGHUKDVGHOLQTXHQWOLDELOLW\WRDQHPSOR\HHRUWKHVWDWHIRUDQ\DVVHVVPHQWRI EDFNZDJHVRUUHODWHGGDPDJHVLQWHUHVWILQHVRUSHQDOWLHVSXUVXDQWWRDQ\ILQDO MXGJPHQWRUGHURUGHWHUPLQDWLRQE\DFRXUWRUDQ\IHGHUDOVWDWHRUORFDODGPLQLVWUDWLYH DJHQF\LQFOXGLQJDFRQILUPHGDUELWUDWLRQDZDUG$Q\MXGJPHQWRUGHURUGHWHUPLQDWLRQ WKDWLVXQGHUDSSHDOLVH[FOXGHGSURYLGHGWKDWWKHFRQWUDFWRUKDVVHFXUHGWKHSD\PHQW RIDQ\DPRXQWHYHQWXDOO\IRXQGGXHWKURXJKDERQGRURWKHUDSSURSULDWHPHDQV Page 261 of 802 %,')2506 %,')2506 * <HV 1R 7KHELGGHULVFXUUHQWO\GHEDUUHGXQGHU6HFWLRQRUXQGHUDQ\RWKHUIHGHUDORU VWDWHODZSURYLGLQJIRUWKHGHEDUPHQWRIFRQWUDFWRUVIURPSXEOLFZRUNV <HV 1R 127(7KHDERYH6WDWHPHQWVDQG4XHVWLRQQDLUHDUHSDUWRIWKH%LG6LJQLQJWKLV%LGRQ WKHVLJQDWXUHSRUWLRQFRQVWLWXWHVLJQDWXUHRIWKLV6WDWHPHQWDQG4XHVWLRQQDLUH%LGGHUV DUHFDXWLRQHGWKDWPDNLQJDIDOVHFHUWLILFDWLRQPD\VXEMHFWWKHFHUWLILHUWRFULPLQDO SURVHFXWLRQ Page 262 of 802 %,')2506 %,')2506 + 121&2//86,21'(&/$5$7,21 ,GHFODUHWKDW ,DPRI WKHSDUW\PDNLQJWKHIRUHJRLQJELGWKDWWKHELGLVQRWPDGHLQWKHLQWHUHVWRIRURQEHKDOI RIDQ\XQGLVFORVHGSHUVRQSDUWQHUVKLSFRPSDQ\DVVRFLDWLRQRUJDQL]DWLRQRU FRUSRUDWLRQWKDWWKHELGLVJHQXLQHDQGQRWFROOXVLYHRUVKDPWKDWWKHELGGHUKDVQRW GLUHFWO\RULQGLUHFWO\LQGXFHGRUVROLFLWHGDQ\RWKHUELGGHUWRSXWLQDIDOVHRUVKDPELGDQG KDVQRWGLUHFWO\RULQGLUHFWO\FROOXGHGFRQVSLUHGFRQQLYHGRUDJUHHGZLWKDQ\ELGGHURU DQ\RQHHOVHWRSXWLQDVKDPELGRUWKDWDQ\RQHUHIUDLQHGIURPELGGLQJWKDWWKHELGGHU KDVQRWLQDQ\PDQQHUGLUHFWO\RULQGLUHFWO\VRXJKWE\DJUHHPHQWFRPPXQLFDWLRQRU FRQIHUHQFHZLWKDQ\RQHWRIL[WKHELGSULFHRIWKHELGGHURUDQ\RWKHUELGGHURUWRIL[DQ\ RYHUKHDGSURILWRUFRVWHOHPHQWRIWKHELGSULFHRURIWKDWRIDQ\RWKHUELGGHURUWR VHFXUHDQ\DGYDQWDJHDJDLQVWWKHSXEOLFERG\DZDUGLQJWKHFRQWUDFWRIDQ\RQHLQWHUHVWHG LQWKHSURSRVHGFRQWUDFWWKDWDOOVWDWHPHQWVFRQWDLQHGLQWKHELGDUHWUXHDQGIXUWKHU WKDWWKHELGGHUKDVQRWGLUHFWO\RULQGLUHFWO\VXEPLWWHGKLVRUKHUELGSULFHRUDQ\ EUHDNGRZQWKHUHRIRUWKHFRQWHQWVWKHUHRIRUGLYXOJHGLQIRUPDWLRQRUGDWDUHODWLYH WKHUHWRRUSDLGDQGZLOOQRWSD\DQ\IHHWRDQ\FRUSRUDWLRQSDUWQHUVKLSFRPSDQ\ DVVRFLDWLRQRUJDQL]DWLRQELGGHSRVLWRU\RUWRDQ\PHPEHURUDJHQWWKHUHRIWRHIIHFWXDWH DFROOXVLYHRUVKDPELG ([HFXWHGRQLQBB ,GHFODUHXQGHUSHQDOW\RISHUMXU\XQGHUWKHODZVRIWKH6WDWHRI&DOLIRUQLDWKDWWKH IRUHJRLQJLVWUXHDQGFRUUHFW 6LJQDWXUHDQG7LWOHRI'HFODUDQW 6($/ 6XEVFULEHGDQGVZRUQWREHIRUHPH WKLVBBBBBBBGD\RIBBBBBBBBBBBBBB 1RWDU\3XEOLF &RPSDQ\1DPHBBBBBBBBBBBBBBBBBBBB Page 263 of 802 %,')2506 %,')2506 , 7+,63$*(,17(17,21$//<%/$1. Page 264 of 802 %,')2506 %,')2506 - %,''(5$&.12:/('*(0(176 %\VLJQLQJEHORZWKHELGGHUDFNQRZOHGJHVDQGFRQILUPVWKDWWKLVELGLVEDVHGRQWKHLQIRUPDWLRQFRQWDLQHG LQDOOFRQWUDFWGRFXPHQWVLQFOXGLQJWKHQRWLFHWRELGGHUVSODQVVSHFLILFDWLRQVVSHFLDOSURYLVLRQVDQG DGGHQGXPQXPEHUV1RWH<RXDUHUHVSRQVLEOHWRYHULI\WKHQXPEHURI DGGHQGDSULRUWRWKHELGRSHQLQJ 7KHXQGHUVLJQHGIXUWKHUDJUHHVWKDWLQFDVHRIGHIDXOWLQH[HFXWLQJWKHUHTXLUHGFRQWUDFWZLWKQHFHVVDU\ ERQGVZLWKLQHLJKWGD\VQRWLQFOXGLQJ6DWXUGD\V6XQGD\VDQGOHJDOKROLGD\VDIWHUKDYLQJUHFHLYHGD PDLOHGQRWLFHWKDWWKHFRQWUDFWLVUHDG\IRUVLJQDWXUHWKHSURFHHGVRIWKHFKHFNRUERQGDFFRPSDQ\LQJKLV ELGZLOOEHFRPHWKHSURSHUW\RIWKH&LW\RI6DQ/XLV2ELVSR /LFHQVHGLQDFFRUGDQFHZLWKDQDFWSURYLGLQJIRUWKHUHJLVWUDWLRQRIFRQWUDFWRUV/LFHQVH1R ([SLUDWLRQ'DWH 7KHDERYHVWDWHPHQWLVPDGHXQGHUSHQDOW\RISHUMXU\DQGDQ\ELGQRWFRQWDLQLQJWKLVLQIRUPDWLRQZLOOEH FRQVLGHUHGQRQUHVSRQVLYHDQGZLOOEHUHMHFWHG´E\WKH&LW\ 6LJQDWXUHRI%LGGHU 3ULQW1DPHDQG7LWOHRI%LGGHU ',5±3XEOLF:RUNV 5HJLVWUDWLRQ1R %XVLQHVV1DPH'%$ 2ZQHU/HJDO1DPH ,QGLFDWH2QH6ROHSURSULHWRU 3DUWQHUVKLS &RUSRUDWLRQ /LVW3DUWQHUV&RUSRUDWH2IILFHUV 1DPH 7LWOH 1DPH 7LWOH 1DPH 7LWOH %XVLQHVV$GGUHVV 6WUHHW$GGUHVV 0DLOLQJ$GGUHVV &LW\6WDWH=LS&RGH 3KRQH1XPEHU )D[1XPEHU (PDLO$GGUHVV 'DWH Page 265 of 802 %,')2506 %,')2506 . 48$/,),&$7,216 )DLOXUHWRIXUQLVKFRPSOHWHUHIHUHQFHLQIRUPDWLRQ217+,6)250DVVSHFLILHGLQWKLV SURMHFW¶V1RWLFHWR%LGGHUVDQGLQGLFDWHGEHORZLVFDXVHWRUHMHFWWKHELG$GGLWLRQDO LQIRUPDWLRQPD\EHDWWDFKHGEXWLVQRWDVXEVWLWXWHIRUWKLVIRUP 5HIHUHQFH1XPEHU &XVWRPHU1DPH &RQWDFW,QGLYLGXDO 7HOHSKRQH (PDLO 3URMHFW1DPH6LWH$GGUHVV ,VWKLVVLPLODUWRWKHSURMHFWEHLQJELG DQGGLGWKLVSURMHFWLQFOXGH FRQVWUXFWLRQRIDSXEOLFEXLOGLQJ" <HVƑ1RƑ 'HVFULEHWKHVHUYLFHVSURYLGHGDQGKRZWKLVSURMHFWLVVLPLODUWR WKDWZKLFKLVEHLQJELG 'DWHSURMHFWFRPSOHWHG :DVWKLVFRQWUDFWIRUDSXEOLFDJHQF\" <HVƑ1RƑ 5HIHUHQFH1XPEHU &XVWRPHU1DPH &RQWDFW,QGLYLGXDO 7HOHSKRQH (PDLO 3URMHFW1DPH6LWH$GGUHVV ,VWKLVVLPLODUWRWKHSURMHFWEHLQJELG DQGGLGWKLVSURMHFWLQFOXGH FRQVWUXFWLRQRIDSXEOLFEXLOGLQJ" <HVƑ1RƑ 'HVFULEHWKHVHUYLFHVSURYLGHGDQGKRZWKLVSURMHFWLVVLPLODUWR WKDWZKLFKLVEHLQJELG 'DWHSURMHFWFRPSOHWHG :DVWKLVFRQWUDFWIRUDSXEOLFDJHQF\" <HVƑ1RƑ 5HIHUHQFH1XPEHU &XVWRPHU1DPH &RQWDFW,QGLYLGXDO 7HOHSKRQH (PDLO 3URMHFW1DPH6LWH$GGUHVV ,VWKLVVLPLODUWRWKHSURMHFWEHLQJELG DQGGLGWKLVSURMHFWLQFOXGHEULFN SDYLQJZRUN"<HVƑ1RƑ 'HVFULEHWKHVHUYLFHVSURYLGHGDQGKRZWKLVSURMHFWLVVLPLODUWR WKDWZKLFKLVEHLQJELG 'DWHSURMHFWFRPSOHWHG :DVWKLVFRQWUDFWIRUDSXEOLF DJHQF\" <HVƑ1RƑ Page 266 of 802 %,')2506 %,')2506 / $77$&+%,''(5 6%21'72$&&203$1<%,' .QRZDOOPHQE\WKHVHSUHVHQWV 7KDWZHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB$635,1&,3$/DQG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB $6 685(7< DUH KHOG DQG ILUPO\ ERXQGXQWRWKH&LW\RI6DQ/XLV2ELVSRLQWKHVXPRI BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'ROODUV BBBBBBBBBBBBB WR EH SDLG WR VDLG&LW\RULWVFHUWDLQDWWRUQH\LWVVXFFHVVRUVDQGDVVLJQVIRUZKLFKSD\PHQWZHOODQGWUXO\WREHPDGHZH ELQGRXUVHOYHVRXUKHLUVH[HFXWRUVDQGDGPLQLVWUDWRUVVXFFHVVRUVRUDVVLJQVMRLQWO\DQGVHYHUDOO\ILUPO\E\ WKHVHSUHVHQWV 7+(&21',7,212)7+,62%/,*$7,21,668&+WKDWLIWKHFHUWDLQELGRIWKHDERYH ERXQGHQBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB WRFRQVWUXFWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB LQVHUWQDPHRIVWUHHWDQGOLPLWVWREHLPSURYHGRUSURMHFW GDWHGBBBBBBBBBBBBBBBBBBBBBLVDFFHSWHGE\WKH&LW\RI6DQ/XLV2ELVSRDQGLIWKHDERYH ERXQGHQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB KLV KHLUV H[HFXWRUV DGPLQLVWUDWRUVVXFFHVVRUVDQGDVVLJQVVKDOOGXO\HQWHULQWRDQGH[HFXWHDFRQWUDFWIRUVXFKFRQVWUXFWLRQDQG VKDOOH[HFXWHDQGGHOLYHUWKHWZRERQGVGHVFULEHGZLWKLQWHQGD\VQRWLQFOXGLQJ6DWXUGD\V6XQGD\VRU OHJDOKROLGD\VDIWHUWKHDERYHERXQGHQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBKDVUHFHLYHGQRWLFHE\DQGIURPWKH VDLG&LW\RI6DQ/XLV2ELVSRWKDWVDLGFRQWUDFWLVUHDG\IRUH[HFXWLRQWKHQWKLVREOLJDWLRQVKDOOEHFRPHQXOO DQGYRLGRWKHUZLVHLWVKDOOEHDQGUHPDLQLQIXOOIRUFHDQGYLUWXH ,1:,71(66:+(5(2)ZHKHUHXQWRVHWRXUKDQGVDQGVHDOVWKLVBBBGD\RIBBBBBBBBBB %LGGHU3ULQFLSDO 6LJQDWXUH 'DWH 7LWOH 6XUHW\ %LGGHU VVLJQDWXUHLVQRWUHTXLUHGWREHQRWDUL]HG6XUHW\ VVLJQDWXUHPXVWEHQRWDUL]HG (TXLYDOHQWIRUPPD\EHVXEVWLWXWHG (Rev. 6-30-14) Page 267 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 25*$1,=$7,21 6SHFLDOSURYLVLRQVDUHXQGHUKHDGLQJVWKDWFRUUHVSRQGZLWKWKHPDLQVHFWLRQKHDGLQJRI WKH6WDQGDUG6SHFLILFDWLRQV(DFKVSHFLDOSURYLVLRQEHJLQVZLWKDUHYLVLRQFODXVHWKDW GHVFULEHVRULQWURGXFHVDUHYLVLRQWRWKH6WDQGDUG6SHFLILFDWLRQV$Q\SDUDJUDSKDGGHG RUGHOHWHGE\DUHYLVLRQFODXVHGRHVQRWFKDQJHWKHSDUDJUDSKQXPEHURIWKH6WDQGDUG 6SHFLILFDWLRQVIRUDQ\RWKHUUHIHUHQFHWRDSDUDJUDSKRIWKH6WDQGDUG6SHFLILFDWLRQV ',9,6,21,*(1(5$/3529,6,216 *(1(5$/ $GGWR6HFWLRQ*(1(5$/ 7KHZRUNPXVWEHGRQHLQFRPSOLDQFHZLWKWKH&LW\RI6DQ/XLV2ELVSR'HSDUWPHQWRI 3XEOLF:RUNV 0LVVLRQ3OD]D5HVWURRPDQG.LRVN6SHFLDO3URYLVLRQV &LW\RI6DQ/XLV2ELVSR6WDQGDUG6SHFLILFDWLRQVDQG(QJLQHHULQJ6WDQGDUGV± HGLWLRQ 6WDWH RI &DOLIRUQLD 'HSDUWPHQW RI7UDQVSRUWDWLRQ 6WDQGDUG 6SHFLILFDWLRQV DQG 6WDQGDUG3ODQV±HGLWLRQ ,QFDVHRIFRQIOLFWEHWZHHQGRFXPHQWVJRYHUQLQJUDQNLQJPXVWFRPSO\ZLWKVHFWLRQ RIWKH&LW\RI6DQ/XLV2ELVSR¶V6WDQGDUG6SHFLILFDWLRQV )DLOXUHWRFRPSO\ZLWKWKHSURYLVLRQVRIWKHVHVHFWLRQVLVDPDWHULDOEUHDFKRIFRQWUDFW 6HFWLRQVWKURXJKRIWKH6WDQGDUG6SHFLILFDWLRQV 6HFWLRQWKURXJKRIWKH6WDQGDUG6SHFLILFDWLRQV 6HFWLRQRIWKH6WDQGDUG6SHFLILFDWLRQV 6HFWLRQRIWKH6WDQGDUG6SHFLILFDWLRQV DXWKRUL]HGZRUNLQJKRXUV 26+$FRPSOLDQFH &2175$&7$:$5'$1'(;(&87,21 $GG6HFWLRQ%&2175$&7(;(&87,21%XLOGLQJ3HUPLW %%XLOGLQJ3HUPLW 7KHFRQWUDFWRUPXVWREWDLQDQRIHHEXLOGLQJSHUPLWIURPWKH&RPPXQLW\'HYHORSPHQW 'HSDUWPHQW$OOUHTXLUHPHQWVRIWKHEXLOGLQJSHUPLWVKDOOEHDSSOLHGWRWKHSURMHFW7KH FRQWUDFWRULVUHVSRQVLEOHIRUFRRUGLQDWLQJLQVSHFWLRQZLWKWKHEXLOGLQJGLYLVLRQIRUWKHSURMHFW 5HTXHVWIRULQVSHFWLRQPXVWEHVFKHGXOHGKRXUVLQDGYDQFHRIWKHUHTXLUHGLQVSHFWLRQ 6&23(2):25. Page 268 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 $GGWR6HFWLRQ:25.'(6&5,37,21 &RPSO\ZLWKWKHSURYLVLRQVRI6HFWLRQV DQGIRUJHQHUDOPDWHULDOFRQVWUXFWLRQDQGSD\PHQWVSHFLILFV5HIHUWRWKHVH 6SHFLDO3URYLVLRQVLQFOXGLQJ$SSHQGL[%7HFKQLFDO6SHFLILFDWLRQVIRUPRGLILFDWLRQVWR WKHDERYH6HFWLRQV $GG6HFWLRQ$:25.'(6&5,37,213URMHFW6SHFLILF6LJQDJH 0DLQWDLQ5HYHQXH(QKDQFHPHQW)XQGLQJVLJQDJHLQZRUNDUHD5HWXUQ5HYHQXH (QKDQFHPHQW)XQGLQJVLJQVDWWKHHQGRIWKHSURMHFWRUXSRQWKH(QJLQHHU¶VUHTXHVW &21752/2):25. $GGWR6HFWLRQ$5($6)2586( <RXDUHDOORZHGWRXVH,16(5767$*,1*$5($WKHVRXWKVLGHRI0RQWHUH\6WUHHW EHWZHHQ%URDG6WUHHWDQG%URDG6WUHHW"!!IRUVWDJLQJRIHTXLSPHQWDQGPDWHULDOV<RX PD\XVH$'',7,21$/$5($!!GXULQJWKHSURMHFWZLWKWKHDSSURYDORIWKH(QJLQHHU &RRUGLQDWHWKHORFDWLRQRIWKHVHDUHDVZLWKWKHIHQFHGDQGVHFXUHGZRUNVLWHDVSHU 6HFWLRQ3XEOLF6DIHW\RIWKHVH6SHFLDO3URYLVLRQV &21752/2)0$7(5,$/6 $GGWR6HFWLRQ'(3$570(17$&&(37$1&( 7KH(QJLQHHUZLOOIXUQLVK6DOHV7D[VLJQVPRXQWHGWRPRYHDEOHEDUULFDGHV0DLQWDLQ 6DOHV7D[VLJQDJHLQZRUNDUHD5HWXUQ6DOHV7D[VLJQVDWWKHHQGRIWKHSURMHFWRU XSRQWKH(QJLQHHU¶VUHTXHVW /(*$/5(/$7,216$1'5(63216,%,/,7<727+(38%/,& $GGWR6HFWLRQ%38%/,&&219(1,(1&(7UDIILF&RQWURO3ODQ 8QOHVVVWDWHGRWKHUZLVHEHORZZRUNKRXUVDUH0RQGD\WKURXJK)ULGD\EHWZHHQ DPWRSP &RQWUDFWRUVKDOOSURYLGHWUDIILFFRQWUROSODQDQGWUDIILFFRQWURODSSOLFDWLRQDWRUEHIRUHWKH SUHFRQVWUXFWLRQPHHWLQJ7UDIILFFRQWUROSODQPXVWEHGUDZQWRVFDOH7UDIILFFRQWURO DSSOLFDWLRQPD\EHREWDLQHGRQWKH&LW\¶VZHEVLWH ZZZVORFLW\RUJJRYHUQPHQWGHSDUWPHQWGLUHFWRU\SXEOLFZRUNVGRFXPHQWV RQOLQHFRQVWUXFWLRQGRFXPHQWV Contractor to provide staging area plan for review and approval of City. The contractor will be allowed minimal area on Monterey Street and adjacent to the limits of work. The contractor must maintain pedestrian access through the plaza and vehicular access to the Warden Bridge. Contractor staging plan must show a fenced and secure work site per Section 7-1.04 Public Safety. The Engineer will furnish Sales Tax signs mounted to moveable barricades. Maintain Sales Tax signage in work area. Return Sales Tax signs at the end of the project or upon the Engineer's request. Page 269 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 8SRQDSSURYDORIWKHWUDIILFFRQWUROSODQWKH&LW\ZLOOLVVXHDQRIHH(QFURDFKPHQW 3HUPLW3HUPLWWHHLVUHVSRQVLEOHWRFRPSO\ZLWKDOOFRQGLWLRQVRIWKHWUDIILFFRQWUROSODQ &RPSOHWHZRUNXVLQJGXHGLOLJHQFHWRUHVWRUHIUHHIORZLQJRIWUDIILF $GGWR6HFWLRQ38%/,&6$)(7< <RXPXVWSURYLGHDULJLG¶PLQLPXPKLJKFKDLQOLQNRURWKHUULJLGZRUNVLWHIHQFH DURXQGDQ\H[WHULRUVWRUDJHDQGVWDJLQJDUHDVDQGSURYLGHRWKHUVXFKVDIHJXDUGVDQG IDFLOLWLHVWRNHHS0LVVLRQ3OD]DXVHUVIURPHQWHULQJWKHFRQVWUXFWLRQDUHD<RXPXVW FRQWURODQGPDLQWDLQ0LVVLRQ3OD]DDFFHVVDQGYHKLFXODUWUDIILFLQDVDIHPDQQHUDURXQG WKHZRUNVLWHDWDOOWLPHV<RXPXVWOHDYHWKHZRUNVLWHFOHDQDQGIUHHIURPKD]DUGVDW WKHHQGRIHDFKGD\DQGRQZHHNHQGV:DONZD\VPXVWEHVZHSWGDLO\$OOWRROVIRUPV VWDNHVKDUGZDUHSDLQWFDQVEXLOGLQJPDWHULDOVDQGRUDQ\RWKHULWHPVWKDWFRXOGEHD SRWHQWLDOKD]DUGWRFKLOGUHQDQG3OD]DXVHUVPXVWEHUHPRYHGIURPWKHZRUNVLWHDWWKH HQGRIHDFKGD\&RRUGLQDWHZRUNVLWHIHQFHZLWKVWDJLQJDUHDDVVSHFLILHGLQ6HFWLRQ ³$UHDVRI8VH´RIWKH6SHFLDO3URYLVLRQV 3526(&87,21$1'352*5(66 5HSODFHWKHVWSDUDJUDSKLQ6HFWLRQ$6&+('8/(*HQHUDOZLWK 3URYLGHD/HYHOVFKHGXOHIRUWKLVZRUN$RQHZHHNORRNDKHDGVFKHGXOHVKDOOEH SURYLGHGWRWKH(QJLQHHUEHIRUHFRPPHQFLQJWKHIROORZLQJZHHN¶VZRUN7KLVUHTXLUHPHQW VKDOOEHFRPSOHWHGLQRUGHUWRFRQWLQXHFRQVWUXFWLRQZRUN $GGWR6HFWLRQ35(&216758&7,21&21)(5(1&( 6FKHGXOHRI9DOXHVIRUDOOOXPSVXPELGLWHPV $GGWR6HFWLRQ%67$572)-2%6,7($&7,9,7,(66WDQGDUG6WDUW &RQWUDFWWLPHZLOOVWDUWRQWKHILUVW0RQGD\DIWHUSUHFRQVWUXFWLRQPHHWLQJ 3$<0(17 $GGWR6HFWLRQ$0($685(0(17*HQHUDO &RQWUDFWRUPXVWVXEPLWD6FKHGXOHRI9DOXHVIRUDOOOXPSVXPELGLWHPVRIZRUNDWWKH 3UHFRQVWUXFWLRQ0HHWLQJLQFRPSOLDQFHZLWK6HFWLRQ% $GGWR6HFWLRQ3$<0(176&23(ZLWK $Q\LWHPRIZRUNWKDWGRHVQRWKDYHVHSDUDWHELGLWHPLVFRQVLGHUHGLQFOXGHGLQWKH 3OD]D5HKDELOLWDWLRQELGLWHPFRVWRIZRUNDQGQRDGGLWLRQDOFRPSHQVDWLRQZLOOEHSDLG $GGWR6HFWLRQ&+$1*('48$17,7<3$<0(17$'-8670(176 *HQHUDO Page 270 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 8QLWSULFHDGMXVWPHQWVVSHFLILHGSHU6HFWLRQ%³,QFUHDVHVRI0RUH7KDQ 3HUFHQW´DQG6HFWLRQ&³'HFUHDVHVRI0RUH7KDQ3HUFHQW´RIWKH6WDQGDUG 6SHFLILFDWLRQVZLOOQRWDSSO\WRWKHIROORZLQJELGLWHPV 3D\PHQWIRULQFUHDVHGRUGHFUHDVHGTXDQWLWLHVVKDOOEHPDGHDWWKHELGLWHPSULFH ',9,6,21,,*(1(5$/&216758&7,21 :$7(532//87,21&21752/ $GGWR6HFWLRQ6WUHHW6ZHHSLQJ &&RQVWUXFWLRQ 6WUHHWVZHHSLQJVKDOOEHSHUIRUPHGKRXUVDQGGD\VDIWHUDSSOLFDWLRQRI7\SH,, VOXUU\VHDO7KH&RQWUDFWRUPXVWSRVWVWUHHWVIRUQRSDUNLQJLQDGYDQFHDQGGXULQJWKH KRXUDQGGD\VWUHHWVZHHSLQJ7KH&RQWUDFWRUPXVWVXEPLWDVWUHHWVZHHSLQJVFKHGXOH IRUDSSURYDOE\WKH(QJLQHHU6WUHHWVZHHSLQJPXVWEHGRQHLQDPDQQHUWKDWVWUHHW SDUNLQJLVDYDLODEOHZLWKLQIWIURPDIIHFWHGDGGUHVVHVXQOHVVDSSURYHGE\WKH (QJLQHHU '3D\PHQW 7KHOXPSVXPLWHPSULFHIRU6WUHHW6ZHHSLQJVKDOOLQFOXGHIXOOFRPSHQVDWLRQIRU IXUQLVKLQJDOOODERUPDWHULDOVWRROVHTXLSPHQWSHUVRQQHO³1R3DUNLQJ´QRWLFHVGRRU KDQJHUVDQGLQFLGHQWDOVDQGIRUGRLQJDOOWKHZRUNLQYROYHGZLWK6WUHHW6ZHHSLQJDQG QRDGGLWLRQDOFRPSHQVDWLRQWKHUHIRU (19,5210(17$/67(:$5'6+,3 $GGWR6HFWLRQ$ :KHQDUFKDHRORJLFDOPRQLWRULQJLVUHTXLUHGE\WKH(QJLQHHUWKHIROORZLQJDSSO\ <RXUDWWHQWLRQLVGLUHFWHGWR6HFWLRQRIWKH*XLGHOLQHVIRUWKH&DOLIRUQLD (QYLURQPHQWDO4XDOLW\$FW3XEOLF5HVRXUFHV&RGH6HFWLRQHWVHTWKDW SURYLGH IRU WKH SURWHFWLRQ DQG SUHVHUYDWLRQ RI KLVWRULFDO DQG DUFKDHRORJLFDO UHVRXUFHV KHUHLQDIWHU FDOOHG ³FXOWXUDO UHVRXUFHV´ <RX PXVW FRQIRUP WR WKH DSSOLFDEOHUHTXLUHPHQWVRIWKHVHVWDWXWHVDQGJXLGHOLQHVDVWKH\UHODWHWRWKH SURWHFWLRQDQGSUHVHUYDWLRQRIFXOWXUDOUHVRXUFHV <RX PXVW H[HUFLVH FDUH WR SURWHFW VLJQLILFDQW FXOWXUDO UHVRXUFHV IURP EHLQJ GDPDJHG,QDGGLWLRQWRRWKHUQRWLILFDWLRQVLQWKLV6HFWLRQ\RXDUHUHTXLUHGWRQRWLI\ will not apply to the following bid item(s): 6, 8, 11, and 12 Page 271 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 WKH(QJLQHHUIRUW\HLJKWKRXUVSULRUWRHQWHULQJDUHDVWKDWUHTXLUHFXOWXUDO UHVRXUFHPRQLWRULQJWRDOORZWLPHIRUPRQLWRUVWREHPRELOL]HG<RXPXVWQRWVWDUW DFWLYLWLHV WKDW UHTXLUH FXOWXUDO UHVRXUFH PRQLWRULQJ XQWLO WKHFXOWXUDO UHVRXUFH PRQLWRUDUULYHVWRWKHZRUNVLWHDQGWKH(QJLQHHUDXWKRUL]HVWKHVWDUWRIZRUN <RXPXVWZRUNZLWKWKHFXOWXUDOUHVRXUFHPRQLWRUWRHQVXUHV\VWHPDWLFUHPRYDORI H[FDYDWLRQVHGLPHQWVDOORZH[DPLQDWLRQRIWUHQFKVSRLOVDQGVLGHZDOOVDVWKH\ DUHUHPRYHGDQGH[SRVHGDQGSHUPLWGRFXPHQWDWLRQDQGHYDOXDWLRQRIFXOWXUDO UHVRXUFHVUHPDLQVDFFRUGLQJWRWKHWHUPVRIWKH&XOWXUDO5HVRXUFHV0RQLWRULQJ 3ODQ,ISRWHQWLDOO\VLJQLILFDQWUHPDLQVDUHHQFRXQWHUHG\RXPD\EHUHTXHVWHGWR DOWHUH[FDYDWLRQPHWKRGVWRDFFRPPRGDWHFXOWXUDOUHVRXUFHUHTXLUHPHQWVRUXVH DVPRRWKEODGHGEDFNKRHEXFNHWWRDYRLGFXWWLQJLQWRLQWDFWFXOWXUDOGHSRVLWV <RXDUHVWULFWO\SURKLELWHGIURPFROOHFWLQJSUHKLVWRULFRUKLVWRULFDODUWLIDFWVIURPWKH SURMHFWVLWH ,ISRWHQWLDOO\VLJQLILFDQWFXOWXUDOUHVRXUFHVDUHGLVFRYHUHGGXULQJFRQVWUXFWLRQ\RX PXVWIROORZWKHSURFHGXUHVIRUWKHWUHDWPHQWRIVXFKGLVFRYHULHVDVHVWDEOLVKHGLQ WKH&XOWXUDO5HVRXUFH0RQLWRULQJ3ODQ,QDGGLWLRQWKHIROORZLQJSURFHGXUHVPXVW EHLQVWLWXWHG D <RXPXVWLPPHGLDWHO\FHDVHDOOFRQVWUXFWLRQRSHUDWLRQVDWWKHORFDWLRQRI WKHGLVFRYHU\7KHZRUNPD\EHUHGLUHFWHGWRDORFDWLRQEH\RQGWKHFXOWXUDO UHVRXUFHGLVFRYHU\VLWH E <RXPXVWLPPHGLDWHO\QRWLI\WKH(QJLQHHU& F <RXPD\QRWUHVXPHZRUNLQWKHDUHDXQWLOJLYHQFOHDUDQFHE\WKH(QJLQHHU ,IKXPDQUHPDLQVDUHXQFRYHUHGZRUNZLWKLQWKHYLFLQLW\RIWKHILQGPXVWEHKDOWHG LPPHGLDWHO\<RXPD\QRWUHVXPHZRUNLQWKHDUHDXQWLOJLYHQFOHDUDQFHE\WKH (QJLQHHU (;,67,1*)$&,/,7,(6 $GG6HFWLRQ5HPRYH3DYHPHQW5HPRYHDQG5HSODFH$&7KH RXWOLQHRIWKHDVSKDOWFRQFUHWHSDYHPHQWDUHDWREHUHPRYHGPXVWEHFXWRQDQHDWOLQH ZLWKDSRZHUGULYHQGLDPRQGVDZWRDPLQLPXPGHSWKRIWKHH[LVWLQJDVSKDOWFRQFUHWH EHIRUHUHPRYLQJDOOH[LVWLQJDVSKDOW$VDQDOWHUQDWLYHWKH&RQWUDFWRUPD\XVHDJULQGLQJ GHYLFHVXFKDVD³]LSSHU´WRUHPRYHWKH$&SDWFKDUHD$OODUHDVRIUHPRYDOPXVWEH FXWDVPDUNHGLQWKHILHOGDQGPXVWEHXQLIRUPLQSDWWHUQVTXDUHUHFWDQJOH 3DYLQJLVQRWWREHGRQHZLWKRXWWKHLQVSHFWLRQRIWKH(QJLQHHU $PHFKDQLFDOWDPSLVWREHXVHGIRUFRPSDFWLQJWKHEDVHRUVXEJUDGHDQGERWWRPOLIWVRI WKH$&$UROOHULVWREHXVHGIRUWKHWRSOLIWRI$&9LEUDWLQJ3ODWHVDUHQRWDOORZHG Page 272 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 $GGLWLRQDO$&SDWFKUHSDLUDUHDVDQGH[WHQWVPD\EHLGHQWLILHGE\WKH(QJLQHHU 3DYHPHQWUHSDLUORFDWLRQVPXVWEHILHOGYHULILHGE\WKH(QJLQHHUEHIRUHWKHVWDUWRIZRUN 3DYHPHQWUHVWRUDWLRQPXVWFRPSO\ZLWKVHFWLRQDQG $GG6HFWLRQ$GREH3URWHFWLRQ± $TXDOLILHG+LVWRULF$UFKLWHFWRU$UFKLWHFWXUDO+LVWRULDQZLWKGHPRQVWUDWHGH[SHULHQFH ZRUNLQJZLWK$GREHVWUXFWXUHVVKDOOEHUHWDLQHGWRPRQLWRUDQGSURYLGHSURWHFWLRQ JXLGDQFHIRUDQ\ZRUNLQWKHLPPHGLDWHYLFLQLW\RIWKHSHULPHWHURIWKH0XUUD\$GREH 5HIHUWRKLVWRULDQUHSRUWLQ$SSHQGL[&IRUDGGLWLRQDOLQIRUPDWLRQ 7(0325$5<)$&,/,7,(6 ',9,6,21,,,($57+:25.$1'/$1'6&$3( /$1'6&$3($1',55,*$7,21 $GGWR6HFWLRQ'4XDOLW\$VVXUDQFH 1XUVHU\4XDOLILFDWLRQV&RPSDQ\VSHFLDOL]LQJLQJURZLQJDQGFXOWLYDWLQJWKH SODQWVZLWKWKUHH\HDUVGRFXPHQWHGH[SHULHQFH ,QVWDOOHU4XDOLILFDWLRQV&RPSDQ\VSHFLDOL]LQJLQLQVWDOOLQJDQGSODQWLQJWKHSODQWV ZLWK>ILYH@\HDUVH[SHULHQFH 7HVWLQJ/DERUDWRU\5HFRJQL]HGODERUDWRU\IRUVRLODQGSODQWGLVHDVHDQDO\VLVIRU RUQDPHQWDOKRUWLFXOWXUHDSSURYHGE\WKH,QVSHFWRU7HVWLQJODERUDWRU\LVWR SHUIRUPDOOZRUNLQDFFRUGDQFHZLWKWKHFXUUHQWPHWKRGVRIWKH$VVRFLDWLRQRI 2IILFLDO$JULFXOWXUDO&KHPLVWV $GGWR6HFWLRQ$*HQHUDO 7(675(32576 6RLOWHVWVVKDOOEHSHUIRUPHGE\DFHUWLILHGVRLOVDQDO\VWE\WKHVWDWHRI&DOLIRUQLD 3URYLGHWKHIROORZLQJWHVWVDQGVXEPLWWKHUHVXOWVWRWKH&LW\ ([LVWLQJ6LWH6RLO3URYLGHWZRVHSDUDWHWHVWVDWGLVWLQFWO\VHSDUDWHRQVLWH ORFDWLRQVIRUDJULFXOWXUDOVXLWDELOLW\IHUWLOLW\SDUWLFOHVL]HDQDO\VLVLQFOXGLQJ Page 273 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 UHFRPPHQGDWLRQVIRUVRLODPHQGPHQWDQGIHUWLOL]DWLRQGXULQJWKH PDLQWHQDQFHSHULRG ,PSRUW6RLO6XEPLWWHVWUHSRUWVRIUHSUHVHQWDWLYHVDPSOHVIRUDSSURYDOSULRU WRGHOLYHU\DQGIRUHYHU\\DUGVGHOLYHUHGWRWKHVLWH7HVWIRUDJULFXOWXUDO VXLWDELOLW\IHUWLOLW\SDUWLFOHVL]HDQDO\VLVLQFOXGLQJUHFRPPHQGDWLRQVIRUVRLO DPHQGPHQWDQGIHUWLOL]DWLRQGXULQJWKHPDLQWHQDQFHSHULRG 5HSODFH6HFWLRQ'2UJDQLF6RLO$PHQGPHQWVZLWK ),1(&203267 &RPSRVWIRUVRLODPHQGPHQWDQGSUHSDUDWLRQWREHDZHOOGHFRPSRVHGVWDEOH ZHHGIUHHRUJDQLFPDWWHUVRXUFHGHULYHGIURPZDVWHPDWHULDOVLQFOXGLQJ\DUG GHEULVZRRGZDVWHVRURWKHURUJDQLFPDWHULDOV&RPSRVWWRKDYHDGDUNEURZQ FRORUDQGDVRLOOLNHRGRU&RPSRVWH[KLELWLQJDVRXURUSXWULGVPHOOFRQWDLQLQJ UHFRJQL]DEOHJUDVVRUOHDYHVRULVKRWIXSRQGHOLYHU\RUUHZHWWLQJLVQRW DFFHSWDEOH &RPSRVWIDFLOLW\DQGFRPSRVWPDWHULDOPXVWPHHWWKHIROORZLQJUHTXLUHPHQWV ,QVSHFWHGDQGUHJXODWHGE\WKHORFDOHQIRUFHPHQWDJHQF\IRU&DO5HF\FOH7KH SDVWLQVSHFWLRQUHSRUWVWREHVXEPLWWHGYHULI\LQJFRPSOLDQFHZLWKWLWOH UHTXLUHPHQWVRIWKHSURFHVVWRIXUWKHUUHGXFHSDWKRJHQVSIUSIHFDOFROLIRUP DQGVDOPRQHOODWHVWLQJDQGSDWKRJHQDQGHSDFIUUHJXODWLRQV &HUWLILHGWKURXJKWKHXVFFVHDORIWHVWLQJDVVXUDQFHVWDSURJUDPDFRPSRVW WHVWLQJDQGLQIRUPDWLRQGLVFORVXUHSURJUDP $QDO\]HGE\DODERUDWRU\WKDWLVHQUROOHGLQWKHXVFRPSRVWLQJFRXQFLO¶VFRPSRVW DQDO\VLVSURILFLHQF\FDSSURJUDPDQGXVLQJDSSURYHGWHVWPHWKRGVIRUWKH HYDOXDWLRQRIFRPSRVWLQJDQGFRPSRVWWPHFF )DFLOLW\PXVWSURYLGHSURRIRIFRPSRVWWHVWLQJZLWKLQFDOHQGDUGD\VSULRUWR GHOLYHU\RIPDWHULDOWRSURMHFWVLWH $SSO\DIRXULQFKOLIWRIFRPSRVWGXULQJFXOWLYDWLRQ 5HSODFH6HFWLRQ()HUWLOL]HU $0(1'0(176$1'0<&255+,=$/)81*,,12&8/$17 $SSO\WRDOOQHZSODQWLQJKROHVLQFOXGLQJELRUHWHQWLRQDUHDV *UDQXODU7ULFP\FR5HYLYDO3OXVDSSOLHGDWWKHPDQXIDFWXUHU¶VUHFRPPHQGHGUDWHV EDVHGRQSODQWPDWHULDOFRQWDLQHUVL]H Page 274 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 5HYLVH6HFWLRQ&5HPRYH([LVWLQJ3ODQWV 5HYLVHWRLQFUHDVHUHPRYDOGHSWK5HPRYDORIH[LVWLQJSODQWVLQFOXGHVUHPRYLQJ WKHLUVWXPSVDQGURRWVLQFKHVRUODUJHULQGLDPHWHUWRDPLQLPXPGHSWKRI LQFKHVEHORZILQLVKHGJUDGH 5HYLVH6HFWLRQ'&XOWLYDWLRQ $OOSODQWLQJDUHDVWREHFXOWLYDWHG 5HYLVHWRLQFUHDVHFXOWLYDWLRQGHSWK5HSHDWFXOWLYDWLRQXQWLOWKHVRLOLVORRVHWRD PLQLPXPGHSWKRILQFKHV $GG5HPRYHQDWLYHVRLODVQHHGHGSULRUWRDGGLQJDPHQGPHQWVWRDOORZIRU DGGLWLRQRIFRPSRVWDPHQGPHQWDQGPXOFKWRDFKLHYHILQDOJUDGHV 3ODFHFRPSRVWDPHQGPHQWDQGWLOOWRDGHSWKRIWZHOYHLQFKHV3URYLGHDGGLWLRQDO DPHQGPHQWVRUDGMXVWVRLOSUHSDUDWLRQLIGLUHFWHGSHUWKHVRLODQDO\VLVSHU 6RLOV0DQDJHPHQW5HSRUWUHFRPPHQGDWLRQVDQGDSSURYHGE\RZQHURZQHU¶V UHSUHVHQWDWLYH 5ROOFRPSDFWVRLOWRDFKLHYHFRPSDFWLRQRIRIGU\ZHLJKWGHQVLW\LQDUHDVZKHUH SODQWLQJVDUHORFDWHG $IWHUQDWXUDOVHWWOHPHQWDQGOLJKWUROOLQJWKHFRPSOHWHZRUNWRFRQIRUPVWULFWO\WRWKH OLQHVJUDGHVDQGHOHYDWLRQLQGLFDWHGXQGHUWKHFRQWUDFWZLWKRXWDGGLWLRQDOFRVWWR WKH&LW\ )LQLVKJUDGLQJRIODQGVFDSHDUHDVILQHJUDGHDOOSUHSDUHGSODQWLQJDUHDVWROLQHV DQGJUDGHVVKRZQRQSODQVDQGDVVSHFLILHGZLWKLQWKLVVHFWLRQ)LQLVKJUDGHWR DFFRXQWIRUSODFHPHQWRIVSHFLILHGPXOFK 7RSRIILQLVKHGPXOFKVXUIDFHWREH´EHORZDGMDFHQWSHGHVWULDQRUELF\FOHSDWKV XQOHVVRWKHUZLVHVSHFLILHGRQFLYLOJUDGLQJSODQV $GGWR6HFWLRQ3$<0(17 7UHHVWREHSDLGDVHDFKUHJDUGOHVVRIVSHFLHV $GGWR6HFWLRQ%3ODQWV Page 275 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 &RQWUDFWRUWRVXEPLWSURRIRIDFTXLVLWLRQRISODQWPDWHULDOZLWKLQGD\VRI VLJQHGFRQWUDFW $Q\UHTXHVWVIRUSODQWPDWHULDOVXEVWLWXWLRQVPXVWEHDFFRPSDQLHGE\ GRFXPHQWDWLRQRILQDELOLW\WRORFDWHSODQWVLQFOXGLQJDOLVWRISODQWQXUVHULHV FRQWDFWHGPLQLPXPRIWKUHH 6XEVWLWXWLRQVPD\EHGHQLHGLISODQWPDWHULDOLVDYDLODEOHDWUHJLRQDOZKROHVDOH QXUVHULHV 6XEPLWSKRWRVRIDOOWUHHVIRUDSSURYDOE\/DQGVFDSH$UFKLWHFWSULRUWR SXUFKDVH $GGWR6HFWLRQ 5HPRYH6HFWLRQ$F7UHDWPHQWRI6RLOV 'RQRWDSSO\SUHHPHUJHQWKHUELFLGHIRUZHHGFRQWURO &RQWUDFWRUWRFDUU\RXWPDQXDOUHPRYDORIZHHGVSULRUWRSODQWLQJ $GGWR6HFWLRQ,1(57*5281'&29(56$1'08/&+(6 0XOFKWREHDSSOLHGWRDOOSODQWLQJDUHDV 0XOFKYDULHVE\DUHDW\SH $OOSODQWLQJDUHDV´GHSWKZDONRQEDUN±ILUEDUNPXOFK´SLHFHVDQGVPDOOHU 6XEPLWVDPSOHVDSSURYDO 0XOFKWREHIUHHRIZHHGVHHGVRUVXEVWDQFHVLQMXULRXVWRSODQWJURZWK $GG6HFWLRQ'F*5$1,7(&5(7(3$9,1* *(1(5$/ 6800$5< 6HFWLRQ,QFOXGHV&UXVKHGDJJUHJDWHEOHQGHGZLWK*UDQLWH&UHWH DGPL[WXUHVXUIDFLQJ 48$/,7<$6685$1&( ,QVWDOODWLRQVVTXDUHIHHWDQGRYHUXSWRVTXDUHIHHW±PXVWEHD Page 276 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 UHFRPPHQGHGLQVWDOOHUDWDPLQLPXP,QVWDOODWLRQVVTXDUHIHHWDQGRYHU ±PXVWEHDQ$SSURYHG,QVWDOOHU $Q LQVWDOOHU QRW DSSURYHG EXW ZLWK VXIILFLHQW H[SHULHQFH IRU WKH SURMHFWDV GHWHUPLQHGE\*UDQLWHFUHWH,QFPD\IXOILOOWKLVUHTXLUHPHQWE\SURYLGLQJD FXUUHQW OHWWHU IURP *UDQLWHFUHWH ,QF YHULI\LQJ WKHLU DELOLW\WR FRPSOHWH D VXFFHVVIXO LQVWDOODWLRQ IRU WKLVVSHFLILF SURMHFW )RU DVVLVWDQFH FRQWDFW *UDQLWH&UHWH,QFDW 3RURXV%DVH5RFN7HVWLQJ 7HVWLQJVKDOORFFXUGXULQJLQVWDOODWLRQDWWRQLQFUHPHQWVRIVKLSSLQJIRU VLHYHFRQIRUPDQFH5HVXOWVVKDOOEHVXEPLWWHGSULRUWRFRPSOHWLRQRIWKH VWRQHEDVHLQVWDOODWLRQ D 7KHVWRQHILHOGDUHDVKDOOKDYHDSHUPHDEOHUDWH QROHVVWKDQ´SHUKRXU7KHWHVWLQJVKDOOEH SHU 'LQ 3DUW $670 FRQVWDQW KHDGRU$670)WHVWLQJPHWKRGV E ,QDGGLWLRQWRWKHODEWHVWLQJDIWHULQVWDOODWLRQ RI DQ\ DJJUHJDWH EDVH FURVVVHFWLRQ GHVLJQHGWRFRQGXFWUDLQIDOOWRWKHVXEVRLOV DQGRU XQGHUGUDLQV\VWHP WKH ILQLVKHG DJJUHJDWH EDVH VKDOO EH WHVWHGLQ VLWXIRU LQILOWUDWLRQ UDWH XVLQJ PHWKRG $670 ) 7KHWHVWVKDOOEHSHUIRUPHGE\DUHJLVWHUHG *HRWHFKQLFDO (QJLQHHU RU FHUWLILHG DJURQRPLVW 7KH&RQWUDFWRULVUHVSRQVLEOHWRPHHWWKLVSHUIRUPDQFHVSHFLILFDWLRQEHIRUH SURFHHGLQJZLWKLQVWDOODWLRQDQGVKDOOEHDUWKHFRVWRIWKHRQVLWHWHVWLQJDQG WKHFRVWRIDQ\DGGLWLRQDOZRUNQHFHVVDU\WRDFKLHYHFRPSOLDQFHZLWKWKH VSHFLILFDWLRQ $OOWHVWUHVXOWVVKDOOEHORJJHGDQGGRFXPHQWHGE\WKH2ZQHU V7HFKQLFDO 5HSUHVHQWDWLYHRU*HRWHFKQLFDO(QJLQHHU,IDWDQ\WLPHWKHSURFHVVHGVWRQH EDVHGRHVQRWPHHWVSHFLILFDWLRQVLWVKDOOEHWKH&RQWUDFWRU VUHVSRQVLELOLW\ WRUHVWRUHDWKLVH[SHQVHWKHSURFHVVHGVWRQHEDVHWRWKHUHTXLUHGJUDGH FURVVVHFWLRQDQGGHQVLW\ $IWHUWKHFRQWUDFWRUKDVLQGHSHQGHQWO\FRQILUPHGFRPSOLDQFHZLWKDOOWKH DERYHWROHUDQFHVSODQDULW\DQGHOHYDWLRQYHULILHGE\DOLFHQVHGVXUYH\RUDQG FRPSDFWLRQJUDGDWLRQ SHUPHDELOLW\YHULILHGE\*HRWHFKQLFDO(QJLQHHUKH Page 277 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 VKDOOQRWLI\WKHDSSURSULDWHSDUW\DQGVFKHGXOHDILQDOLQVSHFWLRQIRUDSSURYDO 7KHFRQWUDFWRUVKDOOPDNHDYDLODEOHDQRUELWDOODVHUV\VWHPWRWKH,QVSHFWLRQ 7HDPIRUWKHLQVSHFWLRQSURFHVV 7KHFRPSDFWLRQUDWHIRUSRURXVEDVHURFNVKRXOGEH7KHFRPSDFWLRQ UDWHIRUQRQSRURXVEDVHURFNVKRXOGEH 02&.83 &RQVWUXFWPRFNXSRIVTXDUHIHHWPLQLPXPRIFUXVKHG DJJUHJDWHEOHQGHGZLWK*UDQLWH&UHWHDGPL[WXUHVXUIDFLQJ LQFOXGLQJEDVHFRXUVHDQGHGJLQJDWORFDWLRQDSSURYHGE\ 2ZQHU V5HSUHVHQWDWLYH%XLOGPRFNXSGD\VSULRUWR LQVWDOODWLRQ,QWHQWRIWKHPRFNXSLVWRGHPRQVWUDWHVXUIDFH ILQLVKWH[WXUHFRORUDQGVWDQGDUGRIZRUNPDQVKLS 1RWLI\2ZQHU V5HSUHVHQWDWLYHGD\VLQDGYDQFHRIPRFNXS FRQVWUXFWLRQ $OORZ2ZQHU V5HSUHVHQWDWLYHWRYLHZDQGREWDLQDSSURYDORI PRFNXSEHIRUHSURFHHGLQJZLWKUHVWRIFUXVKHGDJJUHJDWH EOHQGHGZLWK*UDQLWH&UHWHDGPL[WXUHVXUIDFLQJ $SSURYHGPRFNXSPD\UHPDLQDVILUVWLQSODFH FRQVWUXFWLRQ '(/,9(5<6725$*($1'+$1'/,1* 'HOLYHUDOO*UDQLWH&UHWH$GPL[WXUH>EDJV@>EXON@PDWHULDOVLQRULJLQDOXQRSHQHG SDFNDJLQJ3URWHFWPDWHULDOVDQGDJJUHJDWHIURPFRQWDPLQDWLRQZLWKIRUHLJQPDWWHU 6WRUHXQGHUZDWHUSURRIFRYHUDQGSURWHFWIURPGDPSQHVV ),(/'&21',7,216 'RQRWLQVWDOOFUXVKHGDJJUHJDWHEOHQGHGZLWK*UDQLWH&UHWH DGPL[WXUHVXUIDFLQJZKHQVXEEDVHLVZHWDWVDWXUDWHGILHOG FDSDFLW\ 'RQRWLQVWDOO*UDQLWH&UHWHPDWHULDOVZKHQUDLQZLOOIDOORQLW ZLWKLQKRXUVDIWHUWKHLQVWDOORUZKHQWKHWHPSHUDWXUH ZLOOJREHORZIUHH]LQJZLWKLQWKHQH[WILYHGD\VIROORZLQJ LQVWDOODWLRQ Page 278 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 352'8&76 &UXVKHGDJJUHJDWHEOHQGHGZLWKJUDQLWHFUHWHDGPL[WXUHVXUIDFLQJ PDWHULDOV *UDQLWH&UHWH,QF:HEVWHU6WUHHW6XLWH0RQWHUH\&$ 3KRQH)D[ ZZZJUDQLWHFUHWHFRP *UDQLWH&UHWHDGPL[WXUHLVDQDOOQDWXUDOSURGXFWDQGGRHVQRWFRQWDLQRLOV SRO\PHUVUHVLQVRUHQ]\PHV 'HFRPSRVHG*UDQLWH'*FUXVKHGDJJUHJDWH '*VKDOOKDYHD´PD[LPXPJUDGDWLRQSURGXFHG IURPQDWXUDOO\IULDEOHURFNJUDQLWHZLWKHQRXJKILQHV WR SURGXFH D VPRRWK ZDONLQJ VXUIDFH 0DWHULDOV VKRXOGEHIUHHIURPFOD\OXPSVRUJDQLFPDWWHUDQG GHOHWHULRXVPDWHULDO%OHQGVRIFRDUVHVDQGDQGURFN GXVWDUHQRWDFFHSWDEOH 8VHDVLQJOHVXSSO\VRXUFHIRUWKHHQWLUHTXDQWLW\UHTXLUHG *UDGDWLRQLQDFFRUGDQFHZLWK$670& &RORU6KRXOGKDYHJROGWR\HOORZKXHV 7REH VHOHFWHG E\ /DQGVFDSH $UFKLWHFW IURPPDQXIDFWXUHU¶VVWDQGDUGFRORUV 6XSSOLHU9LQH\DUG5RFN3URGXFWV+ROOLVWHU&$ >2UHTXDO@ $JJUHJDWHELQGHU3URYLGH*UDQLWH&UHWH$GPL[WXUH&RORU7R EHVHOHFWHGIURPPDQXIDFWXUHU¶VIXOOUDQJHRIFRORUV %DVHFRXUVHPDWHULDO $&ODVV,,3HUPHDEOH%DVH5RFN %6RIW VWRQH PDWHULDOV LH VDQGVWRQH OLPHVWRQH DQG VKDOH PDWHULDOVDUHQRWVXLWDEOH6WRQHVXSSOLHUVKDOOFHUWLI\WKDWDOO VXSSOLHGVWRQHZLOOEHFOHDQRIWKLVW\SHRIVWRQH$OOW\SHVRIVWRQH VKDOOPHHWWKHIROORZLQJVWDELOLW\UHTXLUHPHQWV 7(670(7+2' &5,7(5,$ /$$EUDVLRQ&DOLI7HVW 1RWWRH[FHHG Page 279 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 'XUDELOLW\,QGH[&DOLI7HVW 1RWOHVVWKDQ ,QDGGLWLRQLIVWRQHVWDELOLW\WRZDWHUDQGYHKLFOHVLVLQTXHVWLRQ 2ZQHU KDV WKH ULJKW WR SHUIRUP DGGLWLRQDO WHVWLQJ WR HQVXUH PDWHULDOVKDOODGKHUHWRUHTXLUHPHQWVRI&DOWUDQV6HFWLRQDV ZHOODVDGGLWLRQDODSSOLFDEOH$670WHVWV &$OOWHVWLQJIHHVVKDOOEHSDLGIRUE\WKH&RQWUDFWRU '3HUPHDEOH6WRQH6WRQHEDVHPDWHULDOVVKDOOEHZDVKHG IUDFWXUHGE\PHFKDQLFDOPHDQVZLWKHORQJDWHGFKDUDFWHUVRQ HDFKLQGLYLGXDOSDUWLFOHODUJHUWKDQ´0DWHULDOVVKDOOEHGHYRLG RIPLQHUDOILQHV$OOSDUWLFOHVVPDOOHUWKDQ´VKDOOEHSURGXFHG E\PDQXIDFWXUHGPHDQVRQO\5RXQGHGVDQGVRUDJJUHJDWHVDUH SURKLELWHG ('HOLYHU\0RLVWXUH&RQWHQW3URFHVVHGVWRQHVKDOOFRQWDLQWR RIWKHRSWLPXPPRLVWXUHFRQWHQWWRHQVXUHWKDWILQHVGRQRW PLJUDWH LQ WUDQVLW RU GXULQJ SODFHPHQW DQG WR IDFLOLWDWH SURSHU FRPSDFWLRQ7KHFRQWUDFWRUVKDOOHQVXUHWKDWDJJUHJDWHOHDYLQJWKH VRXUFHSODQWPHHWVWKLVUHTXLUHPHQW7KHFRQWUDFWRULVUHTXLUHGWR DSSO\ZDWHUWRWKHSURFHVVHGVWRQHRQVLWHWRDWWDLQDQGPDLQWDLQ WKLVPLQLPXPPRLVWXUHFRQWHQW $FFHVVRULHV $:DWHU )UHH IURP FRQWDPLQDQWV WKDW ZRXOG GLVFRORU RU EH GHOHWHULRXV WR FUXVKHG DJJUHJDWH EOHQGHG ZLWK *UDQLWH&UHWH DGPL[WXUHVXUIDFLQJ ,QVWDOODWLRQ'RQRWXVHDYLEUDWRU\SODWHWRFRPSDFWWKH*UDQLWH&UHWH8VHD ODZQUROOHUILOOHGZLWKZDWHUWRFRPSDFWWKH*UDQLWH&UHWH8VHDGUXPUROOHURU GXDOGUXPUROOHULQVWDWLFSRVLWLRQIRUGULYHZD\VDQGODUJHULQVWDOODWLRQV,WLV KLJKO\ UHFRPPHQGHG WR XVH D YROXPHWULF WUXFN IRU GULYHZD\V DQGODUJHU LQVWDOODWLRQVLISRVVLEOHWKHXVHRIDSDYHULVKLJKO\UHFRPPHQGHGDVZHOO (;(&87,21 (;$0,1$7,21 ([DPLQHJUDGLQJDQGVXEVRLOFRQGLWLRQV'RQRWSURFHHGXQWLOFRQGLWLRQVDUH DFFHSWDEOH 35(3$5$7,21 Page 280 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 ([FDYDWLRQ([FDYDWHWRGHSWKUHTXLUHGVRHGJHVRIFUXVKHGDJJUHJDWHEOHQGHG ZLWK*UDQLWH&UHWHDGPL[WXUHVXUIDFLQJZLOOPDWFKDGMDFHQWJUDGHVDQGKDYHD PD[LPXPFURVVVORSHRISHUFHQW 6XEJUDGH3UHSDUDWLRQ&RPSO\ZLWK&DOWUDQV6WDQGDUG6SHFLILFDWLRQV6HFWLRQ ±³6XEJUDGH3UHSDUDWLRQ´ %DVH&RXUVH,QVWDOODWLRQ&ODVV,,SHUPHDEOHEDVHURFNDWFRPSDFWLRQ ,QVWDOOSHUPDQXIDFWXUHU¶VUHFRPPHQGHGPHWKRG $GGWR6,7()851,6+,1*6 $GGWR6HFWLRQ$*HQHUDO 3URGXFW'DWD3URYLGHPDQXIDFWXUHU VVSHFLILFDWLRQVDQGGHVFULSWLYHOLWHUDWXUH LQVWDOODWLRQLQVWUXFWLRQVDQGPDLQWHQDQFHLQIRUPDWLRQ 0DQXIDFWXUHU4XDOLILFDWLRQV&RPSDQ\VSHFLDOL]LQJLQPDQXIDFWXULQJSURGXFWVVSHFLILHG LQWKLVVHFWLRQZLWKDWOHDVWWKUHH\HDUVRIGRFXPHQWHGH[SHULHQFH $GGWR6HFWLRQ%0DWHULDOV %HQFK 0RGHOSHU&LW\6WDQGDUG 7ULSOH6WUHDP:DVWH5HFHSWDFOH 0DQXIDFWXUHU%LJ%HOO\ 3URGXFW+&6&6&7ULSOH6WDWLRQ 2SWLRQV (QFORVHG+RSSHUIRU/DQGILOO:DVWH5HF\FOLQJDQG&RPSRVW )RRW3HGDO *UDSKLF:UDS 0RYHDEOH%LVWUR7DEOH±&LW\)XUQLVKHGDQG,QVWDOOHG 0DQXIDFWXUHUZHEVWDXUDQWVWRUHFRP 3URGXFW/DQFDVWHU7DEOH 6HDWLQJ$OOR\6HULHV´[´'LQLQJ+HLJKW2XWGRRU 7DEOHZLWK,QGXVWULDO&DIp&KDLUV &RORU&RSSHU 3ODQWHU3RW 0DQXIDFWXUHU7RXUQHVRO6LWHZRUNV 3URGXFW)ORUHQFH/LJKWZHLJKW*)5&3ODQWHU 7\SH$)&5 7\SH%)&5 %LNH5DFN 0DQXIDFWXUHU3HDN5DFNV 3URGXFWELNHVLQJOHVLGHGELNHUDFN ´ZKHHOVSDFLQJ Page 281 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 &RORU%ODFN3RZGHUFRDW 'ULQNLQJ)RXQWDLQ 0DQXIDFWXUHU0RVW'HSHQGDEOH)RXQWDLQV 3URGXFW6066)$ 2SWLRQV6DIHVWUHDPEXEEOHU &RORU%OXH 6WULQJ/LJKW3RVW 0DQXIDFWXUHUOLJKWSROHVSOXVFRP 3URGXFW+357$$96&$%)3IWWDOO[´EDVH2'[´WRS2'[ ´WKLFNURXQGWDSHUHGDOXPLQXP$UOHQ6W\OH$QFKRU%DVH/LJKW3ROH &RORU%ODFNSRZGHUFRDW 1ROLJKWIL[WXUHIRUWRSPRXQWLQJ 3ROHVKRXOGEHRUGHUHGZLWKKDQGKROHFXWRXWIRUUHFHSWDFOHSHUGHWDLO $OXPLQXPDFRUQSRVWFDSIRU´SRVWEODFNSRZGHUFRDWILQLVKDYDLODEOHIURP ZZZVLJQDWXUHVWUHHWVFDSHVFRP $GGWR6HFWLRQ&&RQVWUXFWLRQ (;$0,1$7,21 9HULI\SURSHULQVWDOODWLRQRIPRXQWLQJVXUIDFHVSUHLQVWDOOHGDQFKRUEROWVDQGRWKHU PRXQWLQJGHYLFHVDQGUHDG\WRUHFHLYHVLWHIXUQLVKLQJLWHPV ,167$//$7,21 ,QVWDOOVLWHIXUQLVKLQJVLQDFFRUGDQFHZLWKDSSURYHGVKRSGUDZLQJVDQGPDQXIDFWXUHU V LQVWDOODWLRQLQVWUXFWLRQV ',9,6,21,968%%$6(6$1'%$6(6 ',9,6,219685)$&,1*6$1'3$9(0(176 $63+$/7&21&5(7( $GGWR6HFWLRQ%0$7(5,$/67DFN&RDW $OOYHUWLFDOHGJHVWREHSDYHGDJDLQVWVKDOOEHWDFNFRDWHG7KHVHLQFOXGHEXWDUHQRW OLPLWHGWRFXUEIDFHVJXWWHUOLSVVZDOHHGJHVFURVVJXWWHUHGJHVDQGDVSKDOWFRQFUHWH HGJHV $GGWR6HFWLRQ+270,;$63+$/7'(6,*15(48,5(0(176 0L[YRLGVWREHWDUJHWHGDW765WREHPLQLPXPLQDFFRUGDQFHZLWK&70 Page 282 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 $GGWR6HFWLRQ3D\PHQW 7KHFRQWUDFWSULFHSDLGSHUVTXDUHIRRWRI+270,;$63+$/73$7&+3$9,1*VKDOO LQFOXGHIXOOFRPSHQVDWLRQIRUDOOODERUPDWHULDOVLQFOXGLQJKRWPL[DVSKDOWWRROV HTXLSPHQWDQGLQFLGHQWDOVIRUFRPSOHWLQJ$&SDWFKUHSDLUVWRWKHOHQJWKGHSWKDQG ZLGWKVKRZQRQWKHSODQV:RUNLQFOXGHVEXWLVQRWOLPLWHGWRVDZFXWWLQJJULQGLQJ UHPRYDODQGGLVSRVDORIH[LVWLQJSDYHPHQWFRPSDFWLRQRIXQGHUOD\LQJPDWHULDOVWDFN FRDWDQGSODFHPHQWDQGFRPSDFWLRQRIDVSKDOW ',9,6,219,6758&785(6 ',9,6,219,,'5$,1$*()$&,/,7,(6 ',9,6,219,,,0,6&(//$1(286&216758&7,21 &21&5(7(&85%6$1'6,'(:$/.6 $GGWR6HFWLRQ&RQVWUXFWLRQ <RXPXVWPHHWZLWKWKH(QJLQHHUWRFRPSOHWHWKHIROORZLQJFRRUGLQDWLRQWDVNV %HIRUHVDZFXWWLQJWRDJUHHRQWKHOLPLWVRIGHPROLWLRQDQGUHPRYDO $IWHUIRUPZRUNLVVHWWRYHULI\WKDWJUDGHVPHHWWKRVHVWDWHGRQWKH3ODQV 8SRQ FRPSOHWLRQ RI QHZ FXUE DQG VLGHZDON LQVWDOODWLRQ WR YHULI\ ILQLVKHG JUDGHV <RXPXVWJLYHWKH&LW\KRXUQRWLFHIRULQVSHFWLRQRIIRUPZRUNEHIRUHSRXULQJ FRQFUHWH <RXDUHUHVSRQVLEOHIRUVWRULQJH[LVWLQJVLJQVDQGER[HVIRUUHXVH /2&$/,1)5$6758&785( $GGWR6HFWLRQ(;&$9$7,21$1'5(6725$7,21*(1(5$/ 3URWHFWLRQDQGUHVWRUDWLRQRIVXUYH\PRQXPHQWVDQGEHQFKPDUNVPXVWFRPSO\ZLWK 6HFWLRQDQG ',9,6,21,;75$)),&&21752/'(9,&(6 Page 283 of 802 63(&,$/3529,6,216 63(&,$/3529,6,216 0$5.,1*6 $GGWR6HFWLRQ&$SSOLFDWLRQRI6WULSHVDQG0DUNLQJV 3UHIRUPHGWKHUPRSODVWLFLVRQO\DOORZHGZLWKWKHDSSURYDORIWKH(QJLQHHU ',9,6,21;(/(&75,&$/:25. ',9,6,21;,0$7(5,$/6 ',9,6,21;,,%8,/',1*&216758&7,21 %8,/',1*&216758&7,21 $GG6HFWLRQ*(1(5$/ 6HH$SSHQGL[%IRU7HFKQLFDO6SHFLILFDWLRQV ',9,6,21;,,,$33(1',&(6 $GG6HFWLRQ$33(1',&(6 5HIHUWR$SSHQGL[$)RUPRI$JUHHPHQW 5HIHUWR$SSHQGL[%6XSSOHPHQWDO7HFKQLFDO6SHFLILFDWLRQV Refer to Appendix C: Murray Adobe Recommendations for Phase 1 of Mission Plaza Concept Plan Page 284 of 802 $33(1',; $33(1',; $33(1',;$)2502)$*5((0(17 7+,6$*5((0(17PDGHRQBBBBBBBBBBBBBE\DQGEHWZHHQWKH&LW\RI6DQ/XLV 2ELVSRDPXQLFLSDOFRUSRUDWLRQDQGFKDUWHUFLW\6DQ/XLV2ELVSR&RXQW\&DOLIRUQLD KHUHLQDIWHUFDOOHGWKH2ZQHUDQG&203$1<1$0(KHUHLQDIWHUFDOOHGWKH&RQWUDFWRU :,71(66(7+ 7KDWWKH2ZQHUDQGWKH&RQWUDFWRUIRUWKHFRQVLGHUDWLRQVWDWHGKHUHLQDJUHHDVIROORZV $57,&/(6&23(2):25.7KH&RQWUDFWRUVKDOOSHUIRUPHYHU\WKLQJUHTXLUHGWR EHSHUIRUPHGVKDOOSURYLGHDQGIXUQLVKDOORIWKHODERUPDWHULDOVQHFHVVDU\WRROV H[SHQGDEOHHTXLSPHQWDQGDOOXWLOLW\DQGWUDQVSRUWDWLRQVHUYLFHVUHTXLUHGWRFRPSOHWH DOOWKHZRUNRIFRQVWUXFWLRQRI 0,66,213/$=$5(675220 &$)e63(&12 LQVWULFWFRPSOLDQFHZLWKWKHSODQVDQGVSHFLILFDWLRQVWKHUHIRULQFOXGLQJDQ\DQGDOO $GGHQGDDGRSWHGE\WKH2ZQHULQVWULFWFRPSOLDQFHZLWKWKH&RQWUDFW'RFXPHQWV KHUHLQDIWHUHQXPHUDWHG ,WLVDJUHHGWKDWVDLGODERUPDWHULDOVWRROVHTXLSPHQWDQGVHUYLFHVVKDOOEHIXUQLVKHGDQG VDLGZRUNSHUIRUPHGDQGFRPSOHWHGXQGHUWKHGLUHFWLRQDQGVXSHUYLVLRQDQGVXEMHFWWRWKH DSSURYDORIWKH2ZQHURULWVDXWKRUL]HGUHSUHVHQWDWLYHV $57,&/(,,&2175$&735,&(7KH2ZQHUVKDOOSD\WKH&RQWUDFWRUDVIXOO FRQVLGHUDWLRQIRUWKHIDLWKIXOSHUIRUPDQFHRIWKLV&RQWUDFWVXEMHFWWRDQ\DGGLWLRQVRU GHGXFWLRQVDVSURYLGHGLQWKH&RQWUDFW'RFXPHQWVWKHFRQWUDFWSULFHVDVIROORZV ,WHP 1R ,WHP8QLWRI 0HDVXUH (VWLPDWHG 4XDQWLW\ ,WHP3ULFH LQILJXUHV 7RWDO LQILJXUHV %,'727$/ 3D\PHQWVDUHWREHPDGHWRWKH&RQWUDFWRULQFRPSOLDQFHZLWKDQGVXEMHFWWRWKH SURYLVLRQVHPERGLHGLQWKHGRFXPHQWVPDGHDSDUWRIWKLV&RQWUDFW 6KRXOGDQ\GLVSXWHDULVHUHVSHFWLQJWKHWUXHYDOXHRIDQ\ZRUNRPLWWHGRURIDQ\H[WUD ZRUNZKLFKWKH&RQWUDFWRUPD\EHUHTXLUHGWRGRRUUHVSHFWLQJWKHVL]HRIDQ\SD\PHQW WRWKH&RQWUDFWRUGXULQJWKHSHUIRUPDQFHRIWKLV&RQWUDFWVDLGGLVSXWHVKDOOEHGHFLGHG E\WKH2ZQHUDQGLWVGHFLVLRQVKDOOEHILQDODQGFRQFOXVLYH Page 285 of 802 $33(1',; $33(1',; $57,&/(,,,&20321(173$5762)7+,6&2175$&77KH&RQWUDFWFRQVLVWVRIWKH IROORZLQJGRFXPHQWVDOORIZKLFKDUHDVIXOO\DSDUWWKHUHRIDVLIKHUHLQVHWRXWLQIXOODQG LIQRWDWWDFKHGDVLIKHUHWRDWWDFKHG 1RWLFHWR%LGGHUVDQG,QIRUPDWLRQIRU%LGGHUV 6WDQGDUG6SHFLILFDWLRQVDQG(QJLQHHULQJ6WDQGDUGV 6SHFLDO3URYLVLRQVDQ\$GGHQGD3ODQVDQG&RQWUDFW&KDQJH2UGHUV &DOWUDQV6WDQGDUG6SHFLILFDWLRQVDQG6WDQGDUG3ODQV $FFHSWHG%LGDQG%LG%RQG /LVWRI6XEFRQWUDFWRUV 3XEOLF&RQWUDFW&RGH6HFWLRQV6WDWHPHQW 3XEOLF&RQWUDFW&RGH6HFWLRQ4XHVWLRQQDLUH 3XEOLF&RQWUDFW&RGH6HFWLRQ6WDWHPHQW /DERU&RGH6HFWLRQ6WDWHPHQWV %LGGHU$FNQRZOHGJHPHQWV 4XDOLILFDWLRQV 1RQFROOXVLRQ'HFODUDWLRQ $JUHHPHQWDQG%RQGV ,QVXUDQFH5HTXLUHPHQWVDQG)RUPV $57,&/(,9,1'(01,),&$7,217KH&RQWUDFWRUVKDOOLQGHPQLI\GHIHQGZLWKOHJDO FRXQVHODSSURYHGE\&LW\DQGKROGKDUPOHVV&LW\LWVRIILFHUVRIILFLDOVHPSOR\HHVDQG YROXQWHHUVIURPDQGDJDLQVWDOOOLDELOLW\ORVVGDPDJHH[SHQVHFRVWLQFOXGLQJZLWKRXW OLPLWDWLRQUHDVRQDEOHOHJDOFRXQVHOIHHVH[SHUWIHHVDQGDOORWKHUFRVWVDQGIHHVRI OLWLJDWLRQRIHYHU\QDWXUHDULVLQJRXWRIRULQFRQQHFWLRQZLWKWKH&RQWUDFWRU¶VQHJOLJHQFH UHFNOHVVQHVVRUZLOOIXOPLVFRQGXFWLQWKHSHUIRUPDQFHRIZRUNKHUHXQGHURULWVIDLOXUHWR FRPSO\ZLWKDQ\RILWVREOLJDWLRQVFRQWDLQHGLQWKLV$JUHHPHQWH[FHSWVXFKORVVRU GDPDJHZKLFKLVFDXVHGE\WKHVROHRUDFWLYHQHJOLJHQFHRUZLOOIXOPLVFRQGXFWRIWKH&LW\ 6KRXOGFRQIOLFWRILQWHUHVWSULQFLSOHVSUHFOXGHDVLQJOHOHJDOFRXQVHOIURPUHSUHVHQWLQJ ERWKWKH&LW\DQGWKH&RQWUDFWRURUVKRXOGWKH&LW\RWKHUZLVHILQGWKH&RQWUDFWRU¶VOHJDO FRXQVHOXQDFFHSWDEOHWKHQWKH&RQWUDFWRUVKDOOUHLPEXUVHWKH&LW\LWVFRVWVRIGHIHQVH LQFOXGLQJZLWKRXWOLPLWDWLRQUHDVRQDEOHOHJDOFRXQVHOIHHVH[SHUWIHHVDQGDOORWKHUFRVWV DQGIHHVRIOLWLJDWLRQ7KH&RQWUDFWRUVKDOOSURPSWO\SD\DQ\ILQDOMXGJPHQWUHQGHUHG DJDLQVWWKH&LW\DQGLWVRIILFHUVRIILFLDOVHPSOR\HHVDQGYROXQWHHUVZLWKUHVSHFWWR FODLPVGHWHUPLQHGE\DWULHURIIDFWWRKDYHEHHQWKHUHVXOWRIWKH&RQWUDFWRU¶VQHJOLJHQW UHFNOHVVRUZURQJIXOSHUIRUPDQFH,WLVH[SUHVVO\XQGHUVWRRGDQGDJUHHGWKDWWKH IRUHJRLQJSURYLVLRQVDUHLQWHQGHGWREHDVEURDGDQGLQFOXVLYHDVLVSHUPLWWHGE\WKHODZ RIWKH6WDWHRI&DOLIRUQLDDQGZLOOVXUYLYHWHUPLQDWLRQRIWKLV$JUHHPHQW 7KH&RQWUDFWRUREOLJDWLRQVXQGHUWKLVVHFWLRQDSSO\UHJDUGOHVVRIZKHWKHUVXFKFODLP FKDUJHGDPDJHGHPDQGDFWLRQSURFHHGLQJORVVVWRSQRWLFHFRVWH[SHQVHMXGJPHQW FLYLOILQHRUSHQDOW\RUOLDELOLW\ZDVFDXVHGLQSDUWRUFRQWULEXWHGWRE\DQ,QGHPQLWHH +RZHYHUZLWKRXWDIIHFWLQJWKHULJKWVRIWKH&LW\XQGHUDQ\SURYLVLRQRIWKLVDJUHHPHQW WKH&RQWUDFWRUVKDOOQRWEHUHTXLUHGWRLQGHPQLI\DQGKROGKDUPOHVVWKH&LW\IRUOLDELOLW\ DWWULEXWDEOHWRWKHDFWLYHQHJOLJHQFHRI&LW\SURYLGHGVXFKDFWLYHQHJOLJHQFHLV GHWHUPLQHGE\DJUHHPHQWEHWZHHQWKHSDUWLHVRUE\WKHILQGLQJVRIDFRXUWRIFRPSHWHQW Page 286 of 802 $33(1',; $33(1',; MXULVGLFWLRQ,QLQVWDQFHVZKHUHWKH&LW\LVVKRZQWRKDYHEHHQDFWLYHO\QHJOLJHQWDQG ZKHUHWKH&LW\¶VDFWLYHQHJOLJHQFHDFFRXQWVIRURQO\DSHUFHQWDJHRIWKHOLDELOLW\LQYROYHG WKHREOLJDWLRQRIWKH&RQWUDFWRUZLOOEHIRUWKDWHQWLUHSRUWLRQRUSHUFHQWDJHRIOLDELOLW\QRW DWWULEXWDEOHWRWKHDFWLYHQHJOLJHQFHRIWKH&LW\ $57,&/(9,WLVIXUWKHUH[SUHVVO\DJUHHGE\DQGEHWZHHQWKHSDUWLHVKHUHWRWKDWVKRXOG WKHUHEHDQ\FRQIOLFWEHWZHHQWKHWHUPVRIWKLVLQVWUXPHQWDQGWKHELGRIVDLG&RQWUDFWRU WKHQWKLVLQVWUXPHQWVKDOOFRQWURODQGQRWKLQJKHUHLQVKDOOEHFRQVLGHUHGDVDQ DFFHSWDQFHRIWKHVDLGWHUPVRIVDLGELGFRQIOLFWLQJKHUHZLWK ,1:,71(66:+(5(2)WKHSDUWLHVWRWKHVHSUHVHQWVKDYHKHUHXQWRVHWWKHLUKDQGV WKLV\HDUDQGGDWHILUVWDERYHZULWWHQ &,7<2)6$1/8,62%,632 $0XQLFLSDO&RUSRUDWLRQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'HUHN-RKQVRQ&LW\0DQDJHU $33529('$672)250&2175$&725 1DPHRI&RPSDQ\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB -&KULVWLQH'LHWULFN &LW\$WWRUQH\ 1DPHRI&$23UHVLGHQW ,WV&$235(6,'(17 QGVLJQDWXUHUHTXLUHGLI&RUSRUDWLRQ %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1DPHRI&RUSRUDWH2IILFHU ,WVBBBBBBBBBBBBBBBBBBBB Page 287 of 802 $33(1',; $33(1',; $33(1',;%±7(&+1,&$/63(&,),&$7,216 Page 288 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 APPENDIX B - TECHNICAL SPECIFICATIONS Page 289 of 802 This page intentionally left blank Page 290 of 802 Mission Plaza Improvements TABLE OF CONTENTS 05-11-2023 Table of Contents DIVISION 03 - CONCRETE 03 0516 Underslab Vapor Barrier 03 1000 Concrete Forming and Accessories 03 2000 Concrete Reinforcing 03 3000 Cast-in-Place Concrete 03 3511 Concrete Floor Finishes DIVISION 04 - MASONRY 04 2000 Unit Masonry 04 2613 Masonry Veneer DIVISION 05 - METALS 05 1200 Structural Steel Framing 05 4000 Cold-Formed Metal Framing 05 5000 Metal Fabrications DIVISION 07 - THERMAL AND MOISTURE PROTECTION 07 1300 Sheet Waterproofing 07 2500 Weather Barriers 07 4113 Metal Roof Panels 07 4213 Metal Wall Panels 07 6200 Sheet Metal Flashing and Trim 07 7123 Manufactured Gutters and Downspouts 07 9200 Joint Sealants DIVISION 08 - OPENINGS Page 291 of 802 Mission Plaza Improvements TABLE OF CONTENTS 05-11-2023 08 1113 Hollow Metal Doors and Frames 08 3313 Coiling Counter Doors 08 4313 Aluminum-Framed Storefronts 08 6200 Unit Skylights 08 7100 Door Hardware 08 8000 Glazing DIVISION 09 - FINISHES 09 2116 Gypsum Board Assemblies 09 2236 Lath 09 2400 Cement Plastering 09 2523 Lime Based Plastering 09 3000 Tiling 09 9113 Exterior Painting DIVISION 10 - SPECIALTIES 10 1313 Electronic Directories 10 1400 Signage 10 2113.17 Phenolic Toilet Compartments 10 2800 Toilet, Bath, and Laundry Accessories DIVISION 22 - PLUMBING 22 0000 Plumbing DIVISION 23 - HEATING, VENTILATING, AND AIR-CONDITIONING (HVAC) 23 0013 General Mechanical Requirements DIVISION 26 - ELECTRICAL Page 292 of 802 Mission Plaza Improvements TABLE OF CONTENTS 05-11-2023 26 0500 Common Work Results for Electrical 26 0519 Low Voltage Electrical Power Conductors and Cables 26 0526 Grounding and Bonding for Electrical Systems 26 0533 Raceways and Boxes for Electrical Systems 26 0534 Cabinets 26 0546.13 Electric Utility Systems 26 0900 Controls and Instrumentation 26 2416 Panelboards 26 2726 Wiring Devices 26 5100 Interior Lighting 26 5600 Exterior Lighting 26 5670 Lighting Acceptance Testing DIVISION 32 - EXTERIOR IMPROVEMENTS 32 0190 Operation and Maintenance of Planting 32 1416 Brick Unit Paving 32 1600 Decomposed Granite Paving 32 3300 Site Furnishings 32 9219 Seeding 32 9300 Plants Page 293 of 802 This page intentionally left blank Page 294 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 0516 05-11-2023 03 0516 - Underslab Vapor Barrier Page 1 of 4 Section 03 0516 Underslab Vapor Barrier PART 1 GENERAL 1.01 SECTION INCLUDES A. Sheet vapor barrier under new concrete slabs on grade. 1.02 RELATED REQUIREMENTS A. Section 02 4119 - Selective Structure Demolition B. Section 03 1000 - Concrete Forming and Accessories: Forms and accessories for formwork. C. Section 03 2000 - Concrete Reinforcing. D. Section 03 3000 - Cast-in-Place Concrete: Preparation of subgrade, granular fill, placement of concrete. 1.03 REFERENCE STANDARDS A. ASTM E1643 - Standard Practice for Selection, Design, Installation and Inspection of Water Vapor Retarders Used in Contact with Earth or Granular Fill Under Concrete Slabs 2011. B. ASTM E1745 - Standard Specification for Plastic Water Vapor Retarders Used in Contact with Soil or Granular Fill under Concrete Slabs 2011. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data: Submit manufacturers' data on manufactured products. 1. Manufacturer¶s samples and literature. 2. Manufacturer¶s installation instructions for placement, seaming, penetration prevention and repair, and perimeter seal per ASTM E1643. 3. Summary of test results per paragraph 9.3 of ASTM E1745. 4. Provide third party documentation that all testing was performed on a single production roll per ASTM E1745 Section 8.1 C. Test Data: Submit report of tests showing compliance with specified requirements. D. Manufacturer's Installation Instructions: Indicate installation procedures and interface required with adjacent construction. PART 2 PRODUCTS 2.01 MATERIALS Page 295 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 0516 05-11-2023 03 0516 - Underslab Vapor Barrier Page 2 of 4 A. Underslab Vapor Barrier: 1. Water Vapor Permeance: Not more than 0.010 perms, maximum [grains/(ft2 ? hr ? inHg)] as tested in accordance with mandatory conditioning tests per ASTM E1745 Section 7.1 (7.1.1-7.1.5). 2. Complying with ASTM E1745 Class A. 3. Thickness: 15 mils. 4. Manfacturers: a. Stego Industries LLC; Stego Wrap Vapor Barrier (15-mil) Basis of Design: www.stegoindustries.com. b. Perminator 15 mils, polyolefin by W.R. Meadows. c. Moistop Ultra 15 mils, polyolefin by Fortifiber d. VaporBlock 15 mils, polyethylene by Raven Industries. B. Accessory Products: Vapor barrier manufacturer's recommended tapes, adhesive, mastic, etc., for sealing seams and penetrations in vapor barrier and forming/screeding accessories to prevent undue penetrations of the membrane. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that surface over which vapor barrier is to be installed is complete and ready before proceeding with installation of vapor barrier. 3.02 INSTALLATION A. Install vapor barrier in accordance with manufacturer's instructions and ASTM E1643. 1. Unroll vapor barrier with the longest dimension parallel with the direction of the concrete placement and face laps away from the expected direction of the placement whenever possible. 2. Extend vapor barrier to the perimeter of the slab. If practicable, terminate it at the top of the slab, otherwise (a) at a point acceptable to the structural engineer or (b) where obstructed by impediments, such as dowels, water stops, or any other site condition requiring early termination of the vapor barrier. At the point of termination, seal vapor barrier to the foundation wall, grade beam or slab itself. 3. Apply seam tape/textured tape/double-sided tape to a clean and dry vapor barrier. 4. Seal all penetrations (including pipes) per manufacturer¶s instructions. 5. Avoid the use of stakes driven through vapor barrier by utilizing screed and forming systems that will not leave punctures in the vapor barrier. 6. Repair damaged areas with vapor barrier material of similar (or better) permeance, puncture and tensile. B. Lap joints minimum 6 inches and seal with manufacturer's tape. C. Seal joints, seams and penetrations watertight with manufacturer's recommended products and follow manufacturer's written instructions. D. No penetration of vapor barrier is allowed except for reinforcing steel and permanent utilities. Page 296 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 0516 05-11-2023 03 0516 - Underslab Vapor Barrier Page 3 of 4 E. Repair damaged vapor retarder before covering with other materials. F. Where installing in existing building tie into existing vapor barrier if possible. END OF SECTION Page 297 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 0516 05-11-2023 03 0516 - Underslab Vapor Barrier Page 4 of 4 This page intentionally left blank Page 298 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 1 of 6 Section 03 1000 Concrete Forming and Accessories PART 1 GENERAL 1.01 SECTION INCLUDES A. Formwork for cast-in-place concrete, with shoring, bracing and anchorage. B. Installation of items to be embedded in concrete, such as anchor bolts, inserts, embeds, and sleeves. C. Openings for other work. D. Form accessories. E. Form stripping. 1.02 RELATED REQUIREMENTS A. Drawings and general provisions of the Contract, Including General and Supplementary Conditions Division 01 Specification Sections, apply to this Section B. Section 03 2000 - Concrete Reinforcing. C. Section 03 3000 - Cast-in-Place Concrete. D. Section 04 2000 - Unit Masonry: Reinforcement for masonry. E. Section 05 1200 - Structural Steel Framing: Placement of embedded steel anchors and plates in cast-in-place concrete. 1.03 REFERENCE STANDARDS A. ACI 117 - Specification for Tolerances for Concrete Construction and Materials 2010 (Reapproved 2015). B. ACI 301 - Specifications for Concrete Construction 2020. C. ACI 318 - Building Code Requirements for Structural Concrete 2019 (Reapproved 2022). D. ACI 347R - Guide to Formwork for Concrete 2014 (Reapproved 2021). E. PS 1 - Structural Plywood 2019. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. Page 299 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 2 of 6 B. Product Data: Provide data on void form materials and installation requirements. C. Shop Drawings: Indicate pertinent dimensions, materials, bracing, and arrangement of joints and ties. Review and approval will not include form strength and adequacy. D. Keep an accurate record of the dates of removal of forms, form shores and reshores, and furnish copies to the SEOR. 1.05 QUALITY ASSURANCE A. Comply with the pertinent provisions of 01 40 00 "Quality Requirements." B. Construct forms according to ACI 347, "Guide to Formwork for Concrete," and conforming to tolerances of ACI 117, "Standard Specifications for Tolerances for Concrete Construction and Materials" 1.06 DELIVERY, STORAGE, AND HANDLING A. Comply with pertinent provisions of Division 01 Section 01 60 00 "Product Requirements," delivering materials in a timely manner to ensure uninterrupted progress. B. Store prefabricated forms off ground in ventilated and protected manner to prevent deterioration from moisture. PART 2 PRODUCTS 2.01 FORMWORK - GENERAL A. Provide concrete forms, accessories, shoring, and bracing as required to accomplish cast-in- place concrete work. B. Design and construct concrete that complies with design with respect to shape, lines, and dimensions. C. Comply with applicable state and local codes with respect to design, fabrication, erection, and removal of formwork. D. Comply with relevant portions of ACI 347R, ACI 301, and ACI 318. 2.02 WOOD FORM MATERIALS A. Softwood Plywood: PS 1, B-B Medium or High Density Concrete Form Overlay, Class I, grade marked, not mill oiled. B. Lumber: DF species; WCLIB Construction grade or better, WWPA No. 1 grade or better; with grade stamp clearly visible. 2.03 REMOVABLE PREFABRICATED FORMS Page 300 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 3 of 6 A. Void Forms: Moisture resistant treated paper faces, biodegradable, structurally sufficient to support weight of wet concrete mix until initial set; 2 inches thick. 2.04 FORMWORK ACCESSORIES A. Form ties: Prefabricated rod, flat band, wire, internally threaded disconnecting ty pe, or equal, not leaving meatl within 1-1/2" of concrete surface. B. Form Release Agent: Capable of releasing forms from hardened concrete without staining or discoloring concrete or forming bugholes and other surface defects, compatible with concrete and form materials, and not requiring removal for satisfactory bonding of coatings to be applied. 1. Do not use materials containing diesel oil or petroleum-based compounds. C. Embedded Anchor Shapes, Plates, Angles and Bars: As specified in Section 05 1200. PART 3 EXECUTION 3.01 EXAMINATION A. Verify lines, levels and centers before proceeding with formwork. Ensure that dimensions agree with drawings. 3.02 EARTH FORMS A. Hand trim sides and bottom of earth forms. Remove loose soil prior to placing concrete. Sides of all footings and grade beams shall be formed, unless the member detail provies at least 3" clear cover to reinforcement and indicates the member is cast against earth. Remove formwork prior to backfilling operations. 3.03 ERECTION - FORMWORK A. Erect formwork, shoring and bracing to achieve design requirements, in accordance with requirements of ACI 301. B. Rigidly construct forms to prevent mortar leekage, sagging, displacement or bulging between studs. Use clean, sound, approved form material, coated with specified materials only, not oil. Provide backing on all plywood joints. C. Coat forms with the specified resin coating, not form oil. Construct forms to exact shapes, sizes, lines and dimensions required to obtain level, plumb, and straight surfaces. Provide openings, offsets, keys, reglets, anchorages, recesses, moldings, chamfers, blocking, screeds, drips, bulkheads, and all other required features. Make forms easily removable without hammering or prying against concrete. Space forms apart with metal spreaders. Construct forms to accurate alignment, locations and grades, and provide against sagging, leakage of concrete mortar, or displacement occuring during and after placing of concrete. Coordinate installation of inserts and anchors in forms according to shop drawings and requirements for work of other sections. Page 301 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 4 of 6 D. Provide bracing to ensure stability of formwork. Shore or strengthen formwork subject to overstressing by construction loads. E. Corners and angles: Provide 3/4" x 3/4" beveled chamfer strips for all exposed concrete corners and angles square unless indicated otherwise. F. Reglets and Rebates: Form required reglets and rebates to receive frames, flashing and other equipment. Obtain required dimnesions, details, and precise positions for work to be installed under other sections and form concrete accordingly. G. Form Joints: Align joints and make watertight. Keep form joints to a minimum. Fill joints to produce smooth surfaces, intersections, and arises. Use polymer foam or equivalent fillers at joints and where forms abut or overlap existing concrete to prevent leakage of mortar. H. Recesses, Drips, and Profiles: Provide smooth milled wood or pre-formed rubber or plastic shapes of types shown and required. I. Cleanouts and Cleaning: Provide Temorary openings in all wall forms and other vertical forms for cleaning and inspection. Clean forms and surfaces to receive concrete prior to placing. J. Re-Use: Clean and Recondition form material before re-use. 3.04 APPLICATION - FORM RELEASE AGENT A. Apply form release agent on formwork in accordance with manufacturer's recommendations. B. Apply prior to placement of reinforcing steel, anchoring devices, and embedded items. C. Do not apply form release agent where concrete surfaces will receive special finishes or applied coverings that are affected by agent. Soak inside surfaces of untreated forms with clean water. Keep surfaces coated prior to placement of concrete. 3.05 INSERTS, EMBEDDED PARTS, AND OPENINGS A. All necessary pipe sleeves, anchors, or other required inserts shall be accurately installed as part of the work of other sections, according to Specification Section 03 30 00, Section 1.3.B for sumittal requirements related to this scope. B. Obtain approval before framing openings in structural members that are not indicated on drawings. C. Provide formed openings where required for items to be embedded in passing through concrete work. D. Locate and set in place items that will be cast directly into concrete. E. Conduits or pipes: 1. Locate so as not to reduce strength of the concrete 2. Do not place pipes, other than conduits, in a slab 4-1/2" thick or less in any case. Conduit buried in a concrete slab shall not have an outside dimension greater than 1/3 the slab Page 302 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 5 of 6 thickness nor be placed below the bottom reinforcing or over the top reinf. 3. Sleeves: Pipe sleeves may pass through the slab or walls if not exposed to rusting or other deterioration and are of uncouted or galvanized iron or steel. Provide sleeves of diameter large enough to pass any hub or coupling on pipe, including any insulation. 4. Conduits may be embedded in walls only if the outside diameter does not exceed 1/3 the wall thickness, are spaced no closer than 3 diameters on centers and not impair the strength of the structure. F. Coordinate with work of other sections in forming and placing openings, slots, reglets, recesses, sleeves, bolts, anchors, other inserts, and components of other work. G. Install accessories in accordance with manufacturer's instructions, so they are straight, level, and plumb. Ensure items are not disturbed during concrete placement. H. Install waterstops in accordance with manufacturer's instructions, so they are continuous without displacing reinforcement. Heat seal joints so they are watertight. I. Provide temporary ports or openings in formwork where required to facilitate cleaning and inspection. Locate openings at bottom of forms to allow flushing water to drain. J. Close temporary openings with tight fitting panels, flush with inside face of forms, and neatly fitted so joints will not be apparent in exposed concrete surfaces. 3.06 FORM CLEANING A. Clean forms as erection proceeds, to remove foreign matter within forms. B. Clean formed cavities of debris prior to placing concrete. 3.07 FORMWORK TOLERANCES A. Construct formwork to maintain tolerances required by ACI 117, unless otherwise indicated. B. Deflection: Limit Deflection of forming surfaces from concrete pressure to L/240. C. Finish Lines: Position formwork to maintain hardened concrete finish lines within following permissible deviations. 1. Variation from Plumb: In 10'-0" 1/4 inch In any story or 20'-0" 3/8 inch In 40'-0" or more 3/4 inch 2. Variation from Level or Grades Indicated In 10'-0" 1/4 inch In any story or 20'-0" 3/8 inch In 40'-0" or more 3/4 inch 3. Cross-Sectional Dimensions a. Minus 1/4 inch b. Plus 1/2 inch 3.08 FIELD QUALITY CONTROL Page 303 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 1000 05-11-2023 03 1000 - Concrete Forming and Accessories Page 6 of 6 A. An independent testing agency will perform field quality control tests, as specified in Section 01 4000 - Quality Requirements. B. Inspect erected formwork, shoring, and bracing to ensure that work is in accordance with formwork design, and to verify that supports, fastenings, wedges, ties, and items are secure. 3.09 FORM REMOVAL A. Do not remove forms or bracing until concrete has gained sufficient strength to carry its own weight and all superimposed loads as determined by testing field cured cylinders, but not sooner than specified in ACI 347 Section 3.6.2.3. Load supporting forms may be removed when concrete has attained 75 percent of required 28 day compressive strength, but no sooner than 3 days, provided construction is reshored. 1. Reshore structural members as specified per ACI 347. 2. Avoid damage to concrete surfaces during removal. 3. Remove formwork in same sequence as concrete placement to achieve similar concrete surface coloration. END OF SECTION Page 304 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 1 of 6 Section 03 2000 Concrete Reinforcing PART 1 GENERAL 1.01 SECTION INCLUDES A. Reinforcing Steel for Cast-in-Place Concrete Foundations B. Reinforcing Steel for Cast-in-Place Concrete Slabs-on-Grade C. Supports and accessories for steel reinforcement. 1.02 RELATED REQUIREMENTS A. Comply with pertinent provisions of Division 01, "General Requirements". B. Section 03 1000 - Concrete Forming and Accessories. C. Section 03 3000 - Cast-in-Place Concrete. D. Section 04 2000 - Unit Masonry: Reinforcement for masonry. E. Section 05 1200 - Structural Metal Framing 1.03 REFERENCE STANDARDS A. ACI 301 - Specifications for Concrete Construction 2020. B. ACI 315 - Manual of Standard practice for Detailing Reinforced Concrete Structures; 2011. C. ACI 318 - Building Code Requirements for Structural Concrete 2019 (Reapproved 2022). D. ACI SP-66 - ACI Detailing Manual 2004. E. ASTM A615/A615M - Standard Specification for Deformed and Plain Carbon-Steel Bars for Concrete Reinforcement 2022. F. ASTM A706/A706M - Standard Specification for Deformed and Plain Low-Alloy Steel Bars for Concrete Reinforcement 2022a. G. ASTM A775/A775M - Standard Specification for Epoxy-Coated Steel Reinforcing Bars 2022. H. ASTM D3963/D3963M - Standard Specification for Fabrication and Jobsite Handling of Epoxy-Coated Steel Reinforcing Bars 2021. I. AWS D1.4/D1.4M - Structural Welding Code - Steel Reinforcing Bars 2018, with Amendment (2020). Page 305 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 2 of 6 J. CRSI (DA4) - Manual of Standard Practice 2018, with Errata (2019). K. CRSI (P1) - Placing Reinforcing Bars, 10th Edition 2019. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Shop Drawings:Comply with requirements of ACI SP-66.Include the following: 1. complete bar layout 2. representative sections 3. details for congested conditions 4. proposed layout where vertical and horizontal bars intersect 5. bar schedules 6. typical bending diagrams and offsets 7. shapes of bent bars 8. spacing of bars 9. splice lengths and locations C. Where welding is proposed: 1. Detail welding to conform to AWS D1.4 2. Submit Copies of welding operator's certificate 3. Where reinforcement complying with ASTM A615 is to be welded, chemical tests shall be performed to determine the weldability in accordance with Section 3.5.2 of ACI 318-11. 4. Weld Procedure Specifications: a. All WPS's shall be submitted to the Structural Engineer of Record (SEOR) for review and approval prior to use. b. For WPS's that have been qualified by test, the supporting Procedure Qualification Record (PQR) shall be submitted to teh SEOR for review and approval. c. Included shall be WPS for repair welds D. Reports: Submit certified copies of mill test report of reinforcement materials analysis. 1.05 QUALITY ASSURANCE A. Comply with the pertinent provisions of 01 40 00 "Quality Requirements." B. Perform work of this section in accordance with ACI 301. C. Welder Qualifications: Welding processes and welding operators qualified in accordance with AWS D1.4/D1.4M and no more than 12 months before start of scheduled welding work. 1.06 DELIVERY STORAGE AND HANDLING A. Comply with pertinent provisions of Division 01 Section 01 60 00 "Product Requirements," delivering materials in a timely manner to ensure uninterrupted progress. B. Bundle bars, tag with identification, and transport and store so as not to damage any material. Use metal tags inicating size, length and other marking shown on placement drawings. Maintain tags after bundles are broken Page 306 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 3 of 6 C. Avoid exposure to dirt, moisture or conditions harmful to reinf. 1.07 EXTRA MATERIAL A. Provide an allowance of an additional 10% of the total reinf. steel tonnage in addition to the quantities shown on the drawings. This additional steel shall be installed in sizes and locations as directed by the structural engineer. PART 2 PRODUCTS 2.01 REINFORCEMENT A. Reinforcing Steel: ASTM A615/A615M, Grade 60 (60,000 psi). 1. Deformed billet-steel bars. 2. Unfinished. 3. Only to be used for conditions where bars will not be welded. B. Reinforcing Steel: ASTM A706/A706M, Grade 60 (60,000 psi) deformed low-alloy steel bars. 1. Unfinished. 2. Used in all cases where welding of bars is required. C. Reinforcement Accessories: 1. Tie Wire: ASTM A82, Annealed copper bearing steel, minimum 16 gage, 0.0508 inch. 2. Chairs, Bolsters, Bar Supports, Spacers: Sized and shaped for adequate support of reinforcement during concrete placement. Standard manufactured products shall conform to the Concrete Reinforcing Institute, "Manual of Stand Practice," latest edition. 3. Use dense precast concrete supports with embedded wire ties for reinforcement placed on grade. Elsewhere, use wire bar supports. D. Welding electrodes: AWS D1.4, Table 5.1 and 5.3, low hydrogen electrodes, E8018 for Grade 60 Steel. 2.02 Re-bar Splicing: A. Coupler Systems: Mechanical devices for splicing reinforcing bars conforming to the requirements of ACI 318-11 Section 12.14.3; capable of developing 1.25fy of the steel reinforcing yield strength in tension and compression. For reinf. All mechanical splices in Special Structural Walls, Special Moment Frames and Concrete Diaphragms shall be Type 2 conforming to the requirements of ACI 318-11 Section 21.1.6 & 21.11.7.4, capable of developing 1.25fy of the steel reinforcing yield strength in tension and compression and develop the specified tensil strength of the spliced bar. 1. Products: a. Dayton Superior Corporation; Bar Lock Coupler System: www.daytonsuperior.com (UES-ER 319). b. Lenton Lock Couplers (IAPMO-ES 129. B. Dowel Bar Splicer with Dowel-Ins: Mechanical devices for connecting dowels; capable of developing full steel reinforcing design strength in tension and compression. Page 307 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 4 of 6 1. Products: a. Dayton Superior Corporation; UES-ER 319: www.daytonsuperior.com/#sle. b. Lenton Form Savers (IAPMO-ES 129). 2.03 FABRICATION A. Fabricate concrete reinforcing in accordance with CRSI (DA4) - Manual of Standard Practice. B. Bending and Forming 1. Fabricate bars of the indicated sizes and bend and form to required shapes and lengths by methods not injurous to materials 2. Do not heat reinforcement for bending 3. Bend bars No. 6 size and larger in the shop only. 4. Bars with unscheduled kinks or bends are subject to rejection. 5. Use only tested and approved bar materials C. Welding: Use only ASTM A706 steel where welding is proposed. Perform welding where shown or approved, by the direct electric arc process in accordance with AWS D1.4 using specified low hydrogen electrodes. Preheat 6" each side of joint. Protect joints from drafts during the cooling process; accelerated cooling is prohibited. Do not tack weld bars. Welding shall not be done on or within two bar diameters of any bent portion of a bar that has been bent cold. Welding of crossing bars shall not be permitted for assembly reinforcement unless authorized by the SEOR. Clean metal surfaces to be welded of all loose scale and foreign material. C 1. Use only ASTM A706 steel where welding is proposed. a. Perform welding where shown or approved, by the direct electric arc process in accordance with AWS D1.4 using specified low hydrogen electrodes. b. Preheat 6" each side of joint. c. Protect joints from drafts during the cooling process; accelerated cooling is prohibited. d. Do not tack weld bars. e. Welding shall not be done on or within two bar diameters of any bent portion of a bar that has been bent cold. f. Welding of crossing bars shall not be permitted for assembly reinforcement unless authorized by the SEOR. g. Clean metal surfaces to be welded of all loose scale and foreign material. h. Clean welds each time electrode is changed and chip burned edges before placing welds i. When wire brushed, the completed welds must exhibit uniform section, smooth welded metal, feather edges without undercuts or overlays, freedom from porosity and clinkers, and good fusion and penetration to the base metal. j. Cut out welds or parts of welds found defective with chisel and replace with proper welding k. Fillet welds may be considered prequalified per AWS D1.4, section 6.1.2. l. Other welds are to be qualified per AWS D1.4 Section 6.1.2. 2. Where ASTM A615 steel is to be used or occurs in existing elements and is to be welded a. Complete chemical analyses shall be performed to determine chemical composition and, for a new bar, provided in the mill certifications to determine weldability in accordance with ACI 318 Section 3.5.2 with modifications per AWS D1.4. b. The carbon equivalency (CE) shall be clearly defined and bars with a CE above 0.75 shall not be welded. Page 308 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 5 of 6 c. Welding Procedure Specifications and supporting Procedure Qualification Records with required testing per AWS D1.4, shall be provided for review and approval prior to welding. d. These WPS's and PQR's shall be specific to the CE as determined above, and shall, in addition to the other AWS requirement, include minimum and maximum preheat and interpass temperatures that are specified to the CE. This preheat and interpass temperature shall be strictly enforced in the field. e. If separate shipments of bars vary the weldability, the process listed in the above requirements shall be repeated for these new bars. D. Locate reinforcing splices not indicated on drawings at point of minimum stress. Review locations of splices with SEOR. PART 3 EXECUTION 3.01 PLACEMENT A. Before placing bars, and again before concrete is placed, clean bars of loose rust and/or mill scale, dirt, oil, or any other coating that may be deleterious or could reduce bond with the concrete. B. Securing in place: 1. Accurately place bars and wire tie in precise position where bars cross. 2. Bend ends of wire ties away from the forms. 3. Wire tie bars to the corners of ties and stirrups. 4. Support bars according to the Concrete Reinforcing Steel Institute (CRSI) "Placing Reinforcing Bars," using approved accessories and chairs. 5. Place precast concrete cubes with embedded wire ties to supporting reinforcing steel bars in concrete placed on grade and in footings. 6. Take adequate precautions to ensure that reinforcing bar position and spacing is maintained during concrete placement. C. Do not displace or damage vapor barrier. D. Maintain concrete cover around reinforcing as follows: 1. Refer to Drawings for cover requirements E. Splices: 1. Do not splice reinforcing bars at the points of maximum stress except where indicated. 2. Lap splices as shown or required to develop the full strength or stress of the bars. 3. Stagger splices in horizontal wall bars at least 48" longitudinally in alternate bars and opposite faces. F. Field Welding: As specified for fabrication. 3.02 FIELD QUALITY CONTROL A. Comply with all pertinent provisions of Division 01 Section 01 40 00 "Quality Requirements". B. Supervision: Perform Work to this Section under supervision of a capable superintendent. Page 309 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 2000 05-11-2023 03 2000 - Concrete Reinforcing Page 6 of 6 C. An independent testing agency, as specified in Section 01 40 00, shall inspect installed reinforcement for conformance to contract documents before concrete placement. D. Where welding is done in the shop or at the site, perform welding of reinforcing bars under inspection of the Testing Laboratory Welding Inspector in accordance with Chapter 17 of the CBC. The welding inspector shall make a systematic record of all welds: 1. Identification marks of welders; 2. List of defective welds; 3. Manner of correction of defects. The welding inspector shall check the material, equipment details of construction and procedures as well as the welds. The inspector shall check the ability of the welder. The welding inspector shall furnish the structural eingeer and the enforcement agency with a verified report that the welding which is required to be inspected is proper and has been done in confromity with the approved plans and specifications. The welding inspector shall use all means necessary to determine the quality of the weld. The inspector may use gamma ray, magnaflux, trepanning, sonics or any other aid to visual inspection, which the inspector may deem necessary to assure the adequacy of the welding. END OF SECTION Page 310 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 1 of 18 Section 03 3000 Cast-in-Place Concrete PART 1 - GENERAL 1.01 SECTION INCLUDES A. Section Includes cast-in-place concrete, concrete materials, mixture design, placement procedures and finishes for the following: B. Floors and slabs on grade. C. Joint devices associated with concrete work. D. Concrete curing. E. Concrete foundations F. Concrete footings G. Concrete walls 1.02 RELATED REQUIREMENTS A. Drawings and general provisions of the Contract, Including General and Supplementary Conditions Division 01 Specification Sections, apply to this Section B. Section 03 1000 - Concrete Forming and Accessories: Forms and accessories for formwork. C. Section 03 2000 - Concrete Reinforcing. D. Section 07 9200 - Joint Sealants: Products and installation for sealants and joint fillers for saw cut joints and isolation joints in slabs. 1.03 REFERENCE STANDARDS A. ACI 117 - Specification for Tolerances for Concrete Construction and Materials 2010 (Reapproved 2015). B. ACI 211.1 - Selecting Proportions for Normal-Density and High Density-Concrete - Guide 2022. C. ACI 301 - Specifications for Concrete Construction 2020. D. ACI 302.1R - Guide to Concrete Floor and Slab Construction 2015. E. ACI 304R - Guide for Measuring, Mixing, Transporting, and Placing Concrete 2000 (Reapproved 2009). Page 311 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 2 of 18 F. ACI 305R - Guide to Hot Weather Concreting 2020. G. ACI 306R - Guide to Cold Weather Concreting 2016. H. ACI 308R - Guide to External Curing of Concrete 2016. I. ACI 309R - Guide for Consolidation of Concrete J. ACI 318 - Building Code Requirements for Structural Concrete 2019 (Reapproved 2022). K. ASTM A615/A615M - Standard Specification for Deformed and Plain Carbon-Steel Bars for Concrete Reinforcement 2022. L. ASTM A706/A706M - Standard Specification for Deformed and Plain Low-Alloy Steel Bars for Concrete Reinforcement; 2015. M. ASTM C33/C33M - Standard Specification for Concrete Aggregates 2018. N. ASTM C39/C39M - Standard Test Method for Compressive Strength of Cylindrical Concrete Specimens 2021. O. ASTM C94/C94M - Standard Specification for Ready-Mixed Concrete 2022a. P. ASTM C109/C109M - Standard Test Method for Compressive Strength of Hydraulic Cement Mortars (Using 2-in. or [50 mm] Cube Specimens) 2021. Q. ASTM C143/C143M - Standard Test Method for Slump of Hydraulic-Cement Concrete 2020. R. ASTM C171 - Standard Specification for Sheet Materials for Curing Concrete 2020. S. ASTM C260/C260M - Standard Specification for Air-Entraining Admixtures for Concrete 2010a (Reapproved 2016). T. ASTM C494/C494M - Standard Specification for Chemical Admixtures for Concrete 2019, with Editorial Revision (2022). U. ASTM C618 - Standard Specification for Coal Ash and Raw or Calcined Natural Pozzolan for Use in Concrete 2023, with Editorial Revision. V. ASTM C685/C685M - Standard Specification for Concrete Made by Volumetric Batching and Continuous Mixing 2017. W. ASTM C1602/C1602M - Standard Specification for Mixing Water Used in the Production of Hydraulic Cement Concrete; 2012 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. Page 312 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 3 of 18 B. Product Data: Comply with the pertinent provisions of Section 01 60 00 " Product Requirements." Submit manufacturers' data on manufactured products showing compliance with specified requirements and installation instructions. 1. Material Certificates: For Each of the following, signed by the manufacturer(s) a. Cementitious materials b. Admixtures c. Curing compounds d. Non-shrink grout 2. Material Test Reports: For the following, from a qualified testing agency, indicating compliance with the requirements: a. Aggregates C. Mix Design: Submit proposed concrete mix design(s). For each concrete mixture: 1. Inidcate Intended Locations for use 2. Indicate proposed mix design complies with requirements of ACI 301, Section 4 - Concrete Mixtures. 3. Indicate proposed mix design complies with requirements of ACI 318, Chapter 5 - Concrete Quality, Mixing and Placing. a. Mixes shall be based on existing approved compressive strength test data for concrete mixes in accordance with ACI 318 Section 5.3.1.1 and requirements below: 1) Strength Requirements: Design mixes for structural concrete for minimum 28- day compressive strengths required by Drawings and Specifications. The trial batch strength for each mix shall exceed indicated or specified strength by 750 psi or a lesser amount based on the standard deviations of strength test records according to ACI 318. 2) Normal Weight Concrete Mix Design: Design all mixes for workability and durability of concrete. Control the mixes in accordance with the CBC, ACI 318 Section 5.2, ACI 211.1, Standard Practice for Selecting Proportions for Normal, Heavyweight, and Mass Concrete, and Chapter 4, ACI 318, Building Code Requirements for Reinforced Concrete. Make adjustments in cement content required for concrete strengths at Contractor's expense and do not exceed 0.50 (or as indicated on concrete general notes of approved plans) absolute water- cement or cement plus fly ash ratio by weight. Do not use calcium chloride or any admix containing such material. Admixtures containing a material releasing nitrates in solution are limited to 0.06 percent by weight for the chloride ion. 3) Maximum Aggregate Sizes: Not exceeding 3/4 of minimum clear space between bars and between bars and forms, nor larger than 1/5 of least dimensions between the forms. Design the mixes with 1" maximum size, except maximum 1-1/2" size for foundations as submitted by the contractor and approved by the Architect and Structural Engineer of Record. 4) Pumped Concrete: Design Concrete mixes specifically for pump placing with dry loose volume of fine aggregates not more than 47 percent of total aggregates. 5) ACI 318 Section 5.3.1.1 with test records. Where a testing laboratory acceptable to the enforcement agency has records of compressive strength tests, a standard deviation shall be established. Test records from which a standard deviation is calculated shall: Page 313 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 4 of 18 (a) Represent materials, quality control procedures and conditions similar to those expected, and changes in materials and proportions within the test records shall not have been more restricted than those for proposed work. (b) Represent concrete produced to meet a specified strength or strengths f¶c within 1,000 psi of that specified for proposed work. (c) Must consist of at least 30 consecutive tests or two groups of consecutive tests totaling at least 30 tests as defined in ACI 318 Section 5.3.1.1, except as provided in ACI 318 Section 5.3.1.2. 4. Include alternate mix designs when characteristics of materials, project conditions, weather, test results, or other circumstances warrant adjustments. D. Samples for Pigment Color Selection: Submit manufacturer's complete sample chip set, including pigment number and required dosage rate for each color. E. Verification Samples: Submit sample chips of specified colors indicating pigment numbers and required dosage rates, for subsequent comparison to installed concrete. F. Test Reports: Submit report for each test or series of tests specified. G. Manufacturer's Installation Instructions: For concrete accessories, indicate installation procedures and interface required with adjacent construction. H. Delivery Tickets: With each transit truck provide delivery ticket, signed by an authorized representative from the batch plan, containing all information required by ASTM C94, as well as time batched, type of brand of cement, cement content, maximum size of aggregate and total water content. 1.05 QUALITY ASSURANCE A. Comply with the pertinent provisions of 01 40 00 "Quality Requirements." B. Qualifications 1. Installer Qualifications: And experienced installer who has completed concrete work similar in material, design, and extendt to that indicated for this project and whose work has resulted in construction with a record of successful in-service performance. Adequate numbers of trained and experienced personnell shall be used. 2. Manufacturer Qualifications: The production facility supplying hydraulic cement concrete shall have a current Certification of Ready Mixed Concrete Production Facilities from the National Ready Mixed Concrete Association, or equivalent. 3. Concrete Testing and Inspection Services: The owner shall engage a qualified Independent Testing Agency to perform evaluation test and special inspections per Structural Notes on Drawings and as required per the code. Personnel conducting test shallbe qualified as ACI Concrete Field Testing Technician, Grade 1 according to ACI CP-1 or an equivalent program. C. Perform work of this section in accordance with ACI 301 and ACI 318. 1. Maintain one copy of each document on site. D. Source Quality Control: Refer to the following paragraphs for specific procedures. Concrete materials which, by previous tests or actual service, have shown conformance may be used without testing when so approved by SEOR. Testing laboratory shall perform the following Page 314 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 5 of 18 conformance testing 1. Cementitious Material Test: The concrete supplier shall furnish to the enforcement agency certification from the cement manufacturer that the cement proposed for use on the project has been manufactured and tested in compliance with the requirements of ACI 318-11 Section 3.2.1 and the ASTM standards listed in the materials section of this Specification. 2. Aggregates for Normal Weight Concrete: Test the aggregate before and after concrete mix is designed and whenever character of aggregate varies or source of material is changed in accordance with ASTM C33 and CBC. Include a sieve analysis. Obtain samples of aggregates at the dry batching or ready-mix concrete plant in accordance with ASTM D75 and perform tests for the properties listed in the following table: Physical Properties Physical Properties, units Test Method Minimum Values Sieve analysis ASTM C136 Loss after 5 cycles not more than 8 percent of coarse aggregate, nor more than 10 percent of fine aggregate Organic impurities ASTM C40 Fine aggregate not darker than reference standard color Soundness ASTM C88 Abrasion ASTM C131 Weight loss not more than 10.5 percent after 100 revolutions, 42 percent after 500 revolutions Deleterious materials ASTM C33, C330 Materials finer than No. 200 sieve ASTM C117 Not over 1 percent for gravel, 1.5 percent for crushed aggregate Reactivity potential ASTM C227, C289, C342 Ratio of silica released to reduction in alkalinity not to exceed 1.0. Sand equivalent ASTM D2419 California sand equivalent values operating range not below 71 percent 3. Concrete Batch Plant Inspections: Conform to CBC and ACI. Continuous batch plant inspection is required for structural concrete, performed by a specially qualified inspector. E. Compliance with Regulations: All materials shall comply with the current rules and regulations of the local air quality management district, with the rules regarding volatile organic compounds, and with FDA rules and regulations for dangerous substances in construction products. F. Allowable Tolerances: Construct concrete conforming to the tolerances specified in ACI 117 "Recommended Tolerances for Concrete Construction and Materials", as applicable, unless exceeded by the requirements of regulatory agenciesor otherwise indicated or specified. Page 315 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 6 of 18 1.06 DELIVERY, STORAGE, AND HANDLING A. Comply with pertinent provisions of Section 01 60 00, "Product Requirements." B. Ready-mix concrete shall be mixed and delivered in accordance with ASTM C 94. Each batch of concrete delivered to the Project site shall be accompanied by a time slip bearing departure time and signature of batch plant supervisor. Concrete shall be placed within 90 minutes after start of mixing. Concrete which has developed initial set shall not be used. Concrete which has partially hardened shall not be used. Deliver all materials in timely manner to ensure uninterrupted progress of the work. C. Deliver, store and handle all cement and aggregate materials so as to prevent their deterioration or intrusion by foreign matter. Deteriorated or contaminated materials shall not be furnished. 1.07 JOB CONDITIONS A. Cold Weather Requirements: 1. Follow recommendations of ACI 306R when concreting during cold weather. 2. Adequate equipment shall be provided for heating concrete materials and protecting concrete during freezing or near-freezing weather. Surfaces, in which concrete is to come in contact with, shall be free from frost or ice. No frozen materials or materials containing ice shall be furnished. 3. When placing concrete during freezing or near-freezing weather the mix shall have a temperature of at least 50 degrees F., but not more than 90 degrees F. when cement is added. Concrete shall be maintained at a temperature of at least 50 degrees F. for at least 72 hours after placing or until it has thoroughly hydrated. When necessary, concrete materials shall be heated before mixing. Special precautions shall be provided for protection of transit-mixed concrete. B. Hot Weather Requirements: 1. Follow recommendations of ACI 305R when concreting during hot weather. 2. During hot weather, proper attention shall be provided for ingredients, production methods, handling, placing, protection and curing, to prevent excessive concrete temperatures or water evaporation which could impair required strength or durability. PART 2 PRODUCTS 2.01 FORMWORK A. Comply with requirements of Section 03 1000. 2.02 REINFORCEMENT MATERIALS A. Comply with requirements of Section 03 2000. 2.03 CONCRETE MATERIALS A. Cement: ASTM C150/C150M, Type II - Moderate Portland type, low alkali. Provide Type V where concrete is in contact with soil corrosive to concrete. Use Type III from one batch by a Page 316 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 7 of 18 single source for all architecturally exposed concrete. B. Fine and Coarse Aggregates:ASTM C 33, C330, and C 227, from approved pits, free from vegetable matter and of opaline, feldspar, or siliceous magnesium substances; all washed, clean, hard, fine-grained sound crushed rock or gravel; not over 5 percent by weight of flat, thin, elongated, friable, or laminated pieces (pieces having major dimension over 5 times average dimension) or more than 2 percent by weight of shale or cherty material. Any suitable individual grading of coarse aggregate may be furnished, provided Grading of Combined Aggregate indicated in following table is obtained. GRADING OF COMBINED AGGREGATE Sieve Number or Size in Inches 1-1/2" Maximum (Percent) 1" Maximum (Percent) 3/4" Maximum (Percent) Passing a 2"--- Passing a 1-1/2"95-100 -- Passing a 1"70-90 90-100 - Passing a 3/4"50-80 70-95 90-100 Passing a 3/8"40-60 45-70 55-75 Passing a No. 4 35-55 35-55 40-60 Passing a No. 8 25-40 27-45 30-46 Passing a No. 16 16-34 20-38 23-40 Passing a No. 30 12-25 12-27 13-28 Passing a No. 50 2-12 5-15 5-15 Passing a No. 100 0-3 0-5 0-5 C. Water: Water shall be potable and free from deleterious matter or shall otherwise satisfy the requirements of ASTM C1602. D. Pozzolan: ASTM C618, Class F or N Fly Ash (Class C Not permitted) subject to the conditions of the CBC, containing two percent or less carbon. Fly ash shall not be used in excess of 15 percent by weight of total cement quantity for structural concrete. Where fly ash replacement is 25% or higher, maximum water-cement ratio shall be 0.45. Fly ash need not be included in lightweight concrete mix designs. E. Water: Clean, potable and not detrimental to concrete, complying with ASTM C94 and ASTM C1602 2.04 ADMIXTURES A. Admixtures to be used in concrete shall be subject to prior approval by the Structural Engineer. Where more than one admixture is used, they shall be compatible. Use of admixtures shall be consistent throughout Work. B. Do not use chemicals that will result in soluble chloride ions in excess of 0.1 percent by weight of cement. C. Air Entrainment Admixture: ASTM C260/C260M. D. High Range Water Reducing Admixture: ASTM C494/C494M Type F. Page 317 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 8 of 18 1. Super-Plasticizers (High Range Water Reducers): ASTM C494, Type F. Capable of producing concrete which can be placed at 8 11 inch slump without segregation, capable of maintaining slump within 2" of that initially mixed for 2 hours, and of maintaining concrete temperature within 2 degrees F. from time of batching for 2 hours minimum. E. Water Reducing and Retarding Admixture: ASTM C494/C494M Type D. 1. Only one brand. When used, are subject to approval of Structural Engineer of Record, and must reduce the mixing water at least 10 percent without entraining air in excess of 2 percent by volume. If the water reducing agent entrains more than 2 percent air, the water reduction shall be at least 12 percent, but in no case shall the water reducing agent entrain air in excess of 4 percent. F. Water Reducing Admixture: ASTM C494/C494M Type A. 1. Only one brand. When used, are subject to approval of Structural Engineer of Record, and must reduce the mixing water at least 10 percent without entraining air in excess of 2 percent by volume. If the water reducing agent entrains more than 2 percent air, the water reduction shall be at least 12 percent, but in no case shall the water reducing agent entrain air in excess of 4 percent. G. Waterproofing Admixture: Admixture formulated to reduce permeability to liquid water, with no adverse effect on concrete properties. 1. A crystalline permeability reducing admixture (PRAH) may be used in accordance with ACI 212.3R-10, where reduced concrete permeability is desired. Trial batches should be performed to ensure that the plastic and hardened properties of concrete meet expectations. 2. Admixture Composition: Crystalline, functioning by growth of crystals in capillary pores. 2.05 ACCESSORY MATERIALS A. Non-Shrink Cementitious Grout: Premixed compound consisting of non-metallic aggregate, cement, water reducing and plasticizing agents. 1. Minimum Compressive Strength at 48 Hours: 2,000 pounds per square inch. 2. Minimum Compressive Strength at 28 Days, ASTM C109/C109M: 7,000 pounds per square inch. 3. non-gas-forming and free of oxidizing catalysts and inorganic accelerators, used as dry or damp pack, or mixed to a 20-second flow (CRC-C 611), without segregation or bleeding at any temperature between 45 degrees F and 100 degrees F. 4. Low-Slump, Dry Pack Products: a. Drypack: Field mixture of I part Portland cement to 2 parts fine aggregate mixed to a damp consistency such that a ball molded in the hands will stick together and hold its shape. In lieu of field mixing, Contractor may use factory mixed drypack material, such as Master Builders "Set Grout." f'c shall be equal to 5,000 psi. B. Non-Shrink Epoxy Grout: Moisture-insensitive, two-part; consisting of epoxy resin, non- metallic aggregate, and activator. 2.06 BONDING AND JOINTING PRODUCTS A. Bonding Agent: "Weld-Crete," manufactured by Larsen Products Co., P.O. Box 2127, Rockville, MD 20852, Master Builders "Concresive," or equal. Page 318 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 9 of 18 B. Construction Joint Materials: "Key-Kold" or "Kwik-Joint," of profiles indicated. C. Slab Isolation Joint Filler: 1/2 inch thick, height equal to slab thickness, with removable top section that will form 1/2 inch deep sealant pocket after removal. D. Expansion Joint Fillers: Preformed strips, non-extruding and resilient bituminous type, of thickness indicated, conforming to ASTM D 1751 and ASTM D1752. 2.07 CURING MATERIALS A. Curing Compound, Naturally Dissipating: Clear, water-based, liquid membrane-forming compound; complying with ASTM C309. B. Moisture-Retaining Sheet: ASTM C171. 1. Curing paper, regular. 2. White-burlap-polyethylene sheet, weighing not less than 3.8 ounces per square yard. 2.08 CONCRETE MIXING A. Furnish ready-mixed concrete from an approved commercial off-site plant. Conform to ASTM C 94, except materials, testing, and mix designs as specified herein. Use transit mixer trucks equipped with automatic devices for recording number of revolutions of drum. Comply with CBC Section, 1905. B. Admixtures: All approved admixtures shall be introduced into the concrete at the batch plant. Field additions are not acceptable. C. Slump: Adjust quantity of water so concrete at point and time of placing does not exceed the slumps per plans when tested according to ASTM C143. Use the minimum water necessary for workability required by part of structure being cast. D. For compressive strength, density, fly ash content, slump, and water-cement ratio, refer to the general notes in the plans. PART 3 EXECUTION 3.01 EXAMINATION A. Verify lines, levels, and dimensions before proceeding with work of this section. 3.02 GENERAL A. Time of Placing: Do not place concrete until reinforcement, conduits, outlet boxes, anchors, hangers, sleeves, bolts, and other embedded materials are securely fastened in place. Contact the inspector at least 24 hours before placing concrete; do not place concrete until inspected by the inspector. B. Pouring Record: A record shall be kept on the Project site of time and date of placing concrete in each portion of structure. Such record shall be maintained on the Project site until Substantial Page 319 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 10 of 18 Completion and shall be available for examination by the SEOR. 3.03 PREPARATION A. Earth Subgrade: Dampen 24 hours before placing concrete, but do not muddy. Re-roll where necessary for smoothness and remove loose material. B. Verify that forms are clean and free of rust before applying release agent. C. Reglets and Rebates: 1. Form reglets and rebates in concrete to receive flashing, frames and other equipment as detailed and required. Coordinate dimensions and locations required with other related Work. 2. If concrete slabs on grade adjoin a wall or other perpendicular concrete surface, form a reglet in wall to receive and carry horizontal concrete Work. Reglet shall be full thickness of the slab and shall be 3/4 inch wide, unless otherwise indicated. Requirement does not apply to exterior walks, unless specifically indicated. D. Screeds: Install screeds accurately and maintain at required grade or slab elevations after steel reinforcement has been installed , but before starting to place concrete. Install screeds adjacent to walls and in parallel rows not to exceed 8 feet on centers. E. Screeds Over Vapor Barrier: Use weighted pad or cradle type screeds and do not drive stakes through the vapor barrier. Check with an instrument level, transit, or laser. F. Coordinate placement of embedded items with erection of concrete formwork and placement of form accessories. G. Remove all free water from forms before concrete is deposited. Remove hardened concrete, debris, and foreign materials from interior surfaces of forms, exposed reinforcing, and from surfaces of mixing and conveying equipment. H. Wetting: Wet wood forms sufficiently to tighten up cracks. Wet other materials sufficiently to reduce absorption and to help maintain concrete workability. I. Gravel Fill: Recompact disturbed gravel and bring to correct elevation. J. Sand Beds or Subslab Drainage Fill: Recompact disturbed material and bring to correct elevation. K. All concrete shall be thoroughly consolidated by suitable means during placement and shall be thoroughly worked around reinforcement and embedded fixtures and into corners of forms. L. Interior Slabs on Grade: Install vapor retarder under interior slabs on grade. Comply with ASTM E1643. Lap joints minimum 6 inches. Seal joints, seams and penetrations watertight with manufacturer's recommended products and follow manufacturer's written instructions. Repair damaged vapor retarder before covering. 3.04 PLACING CONCRETE A. Sheet Vapor Retarders: Page 320 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 11 of 18 1. Place, protect, and repair sheet vapor retarder according to ASTM E 1643 and manufacturer¶s written instructions. 2. Lap joints 6 inches and seal with manufacturer¶s recommended adhesive or tape. B. Conveying and Placing: 1. Place concrete in accordance with ACI 304R. 2. Do not place concrete until reinforcing steel and forms or decks have been approved by the Inspector and other authorities having jurisdiction. Concrete shall be placed only under direct observation of the inspector. Do not place concrete outside of regular working hours, unless the inspector has been notified at least 48 hours in advance. 3. Comply with CBC Sections 1905.9 and 1905.10. 4. Concrete shall be conveyed from mixer to location of final placement by methods, which will prevent separation or loss of materials. Place concrete in horizontal layers not more than 18" thick within 90 minutes after water is first added to the batch. 5. In placing concrete in columns, walls or thin sections, provide openings in forms, elephant trunks, tremies or other recognized devices, to prevent segregation and accumulation of partially hydrated concrete on forms or metal reinforcement above level of concrete being placed. Such devices shall be installed so that concrete will be dropped vertically. Unconfined vertical drop of concrete from end of such devices to final placement surface shall not exceed 5-feet for concealed concrete or over 3-feet for exposed concrete. 6. Concrete shall be placed as a continuous operation until placing of panel or section is completed. Top surfaces of vertically formed lifts shall be level. 7. Concrete shall be thoroughly consolidated during placement, and shall be worked around reinforcement and embedded fixtures with mechanical vibrators. 8. Where new concrete is placed against or on old or existing concrete, apply bonding agent to surface of old concrete prior to placement of new concrete. C. Compaction and Screeding: 1. Compacting: Compact each layer of the concrete as placed with mechanical vibrators or equivalent equipment. Transmit vibration directly to concrete and in no case through the forms unless approved. Accomplish thorough compaction. Supplement by rodding or spading by hand adjacent to forms. Compact concrete into corners and angles of forms and around reinforcement and embedded fixtures. Recompact deep sections with congestion due to reinforcing steel as required. 2. Operation of Vibrators: Do not horizontally transport concrete in forms with vibrators nor allow vibrators to contact forms or reinforcing. Push vibrators vertically into the preceding layers that are still plastic and slowly withdraw, producing maximum obtainable density in concrete without creating voids or segregation. In no case disturb concrete that has partially set. Vibrate at intervals not exceeding two-thirds the effective visible vibration diameter of the submerged vibrator. Avoid excessive vibration that causes segregation. 3. Tamp freshly placed concrete with a heavy tamper until at least 3/8 inch of mortar is brought to surface. Concrete shall then be tamped with a light tamper and screeded with a heavy straightedge until depressions and irregularities are eliminated, and surface is true to finish grades or elevations. Remove excess water and debris. 4. Where slabs are to receive separate cement finish or mortar setting bed, continued tamping to raise mortar to surface is not performed. Laitance shall be removed by brushing with a stiff brush or by light sandblasting to expose clean top surface of coarse aggregate. D. Floating and Troweling: Page 321 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 12 of 18 1. After concrete has been placed, struck off, consolidated, and restraightened, concrete shall not be worked further until ready for floating. Restraightening operation is best accomplished by use of 8 foot to 10 foot wide bull float. Power floating operations shall begin when the water sheen has disappeared, and when the mix has stiffened sufficiently to permit proper operation of power-driven float. 2. Consolidate surface with power-driven floats. Hand floating with wood or cork faced floats shall be used in locations inaccessible to power driven machine. Surface shall be restraightened at this stage with ten foot highway straightedge applied at not less than two different angles. 3. High spots shall be cut down and low spots filled during this procedure to produce planes checking true under straightedge in any direction. Uniformly slope surfaces to drains where occurs. 4. Restraightening operation shall be followed by final float pass to uniform, smooth, granular texture. E. Joints: Comply with CBC Section 1906.4. Locate joints in concrete only where shown or approved and obtain prior approval for points of stoppage of any pour. Clean and roughen surface of construction joints by removing entire surface and exposing 1/4" of clean coarse aggregate solidly embedded in mortar matrix by chipping, use of an approved retarder agent, or equal. Water and keep hardened concrete wet for not less than 24 hours before placing the next lift or abutting concrete. Cover the horizontal surfaces of existing or previously placed and hardened concrete with a 2" thick layer of fresh concrete of required mix less 50 percent of coarse aggregate just before balance of concrete is placed. F. Vertical Elements: Stop placement of concrete in walls and columns 1 1/2" below bottom of beams or supported slabs. Stop placement at sills and heads of wall openings in the same manner. Allow concrete in vertical elements to be in place at least 2 hours and until vertical settlement has ceased before placing concrete for floor framing. G. Correction of Segregation: Before placing next layer of concrete, and at the top of each placement for vertical elements, remove all concrete containing excess water or fine aggregate, or showing deficiency of coarse aggregate, and fill the space with compacted concrete of correct proportions. Comply with CBC Section, 1906.4. H. Filling, Leveling and Patching: 1. Concrete slabs exhibiting high or low spots and indicated to receive resilient floor covering or soft floor covering, shall have surfaces repaired. High spots shall be honed, or ground with power-driven machines to required tolerances. Low spots shall be filled with latex underlayment, installed in strict accordance with manufacturer's written recommendations. 2. Holes resulting from form ties or sleeve nuts shall be solidly packed, through exterior walls, by pressure grouting with cement grout, as specified. Grouted holes on exposed surfaces shall be screeded flush and finished to match adjoining surfaces. I. Cement Base: Cement base shall be of the height, thickness, and shape detailed. Base shall be reinforced with one inch mesh, 18 gage, zinc-coated wire fabric. Base finish mixture shall be one part Portland cement, 2 parts of fine aggregate and one part pea gravel. Colored cement base shall include a chemically inert mineral oxide pigment in the mix. J. Place concrete for floor slabs in accordance with ACI 302.1R. Page 322 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 13 of 18 K. Finish floors level and flat, unless otherwise indicated, within the tolerances specified below. 3.05 EXPANSION AND CONSTRUCTION JOINTS A. EXPANSION AND CONSTRUCTION JOINTS 1. Construction Joints: Details and proposed location of construction joints shall be as indicated on the Drawings, located to least impair strength of structure, in accordance with the following: a. Thoroughly clean contact surface by sand blasting entire surface not earlier than 5 days after initial placement. b. A mix containing same proportion of sand and cement provided in concrete plus a maximum of 50 percent of coarse aggregate shall be placed to a depth of at least one inch on horizontal joints. Vertical joints shall be wetted and coated with a neat cement grout immediately before placing of new concrete. c. Should contact surface become coated with earth, sawdust, or deleterious material of any kind after being cleaned, entire surface shall be re-cleaned before applying mix. 2. Expansion Joints: Provide expansion joints where indicated in walks and exterior slabs. Space approximately 20 feet apart, unless otherwise indicated. Joints shall extend entirely through slab with joint filler in one piece for width of walk or slab. 3. Tooled Joints: Slabs, walks and paving shall be marked into areas as indicated with markings made with a V-grooving tool. Marks shall be round-edged, free from burrs or obstructions, with clean cut angles and shall be straight and true. Walks, if not indicated, shall be marked off into rectangles of not more than 12 square feet and shall have a center marking where more than 5 feet wide. 3.06 SLAB JOINTING A. Locate joints as indicated on drawings. B. Anchor joint fillers and devices to prevent movement during concrete placement. C. Isolation Joints: Use preformed joint filler with removable top section for joint sealant, total height equal to thickness of slab, set flush with top of slab. D. Saw Cut Contraction Joints: Saw cut joints before concrete begins to cool, within 4 to 12 hours after placing; use 3/16 inch thick blade and cut at least 1 inch deep but not less than one quarter (1/4) the depth of the slab. 3.07 FLOOR FLATNESS AND LEVELNESS TOLERANCES A. Maximum Variation of Surface Flatness: 1. Under Seamless Resilient Flooring:1/8 inch in 10 feet. 2. Under Carpeting: 1/4 inch in 10 feet. 3. Under Wood Sports Flooring: 1/8" in 10 feet. B. Correct the slab surface if tolerances are less than specified. C. Correct defects by grinding or by removal and replacement of the defective work. Areas requiring corrective work will be identified. Re-measure corrected areas by the same process. Page 323 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 14 of 18 3.08 CONCRETE FINISHING A. Soda and Acid Wash: Concrete surfaces to receive plaster, paint or other finish, and which have been formed by oil coated forms, shall be scrubbed with a solution of 1-1/2 pounds of caustic soda to one gallon of water. Surfaces where smooth wood or waste molds have been furnished shall be scrubbed with a solution of 20 percent muriatic acid. Wash with clean water after scrubbing. B. Sacking: Exposed concrete curbs, and other similar surfaces shall be sacked by an application of Portland cement grout, floated, and rubbed. Sacking shall not be performed until patching and filling of holes has been completed. Entire sacking operation for any continuous area shall be started and completed within the same day. 1. Mix one part portland cement and 1-1/2 parts fine sand with sufficient water to produce a grout having consistency of thick paint. Wet surface of concrete sufficiently to prevent absorption of water from grout. Apply grout uniformly with a brush or spray gun, then immediately float surface with a cork or other suitable float, scouring wall vigorously. 2. While grout is still plastic, finish surface with a sponge-rubber float, removing excess grout. Allow surface to dry thoroughly, then rub vigorously with dry burlap to completely remove dried grout. No visible film or grout shall remain after rubbing with burlap. C. Exposed Formed Concrete: Rub surfaces with a carborundum brick or equal until smooth and free of form marks, offsets, and other defects, and in uniform planes. Wet rubbed surface and then brush coat with cement grout consisting of 1 part light-colored Portland cement to 2 parts fine aggregate and mixed with water to the consistency of thick paint. Cork or wood float grout to fill all pits, air bubbles, and surface holes. Scrape off excess grout and rub surface with burlap or equal to remove all grout film. After grout sets, again coat with same grout, cure, then brick and burlap rub as necessary to eliminate remaining defects and blemishes, and damp cure surfaces for not less than 3 days or longer if required for complete curing of concrete. Finish, clean, and cure each surface as a continuous operation. Produce uniformly plane smooth surfaces free of grout film, grout or rubbing marks, defects, or blemishes after painting or covering with a flexible type finish material. Unless otherwise indicated or specified, apply this finish on exposed formed concrete, exposed concrete at the building foundation, and where indicated or scheduled. D. Sandblasting: Exterior concrete surfaces to receive stucco dash coat finish, where plywood or other smooth forms have been furnished, shall be uniformly sand-blasted with sharp quartz sand under sufficient air pressure to remove dirt, form oil and other foreign materials, and roughen surface to provide a proper bond. Such surfaces shall be thoroughly washed with clean water after sandblasting. E. Concrete Slabs: Finish to requirements of ACI 302.1R, and as follows: 1. Other Surfaces to Be Left Exposed: Trowel as described in ACI 302.1R, minimizing burnish marks and other appearance defects. 3.09 CURING AND PROTECTION A. Comply with requirements of ACI 308R. Immediately after placement, protect concrete from premature drying, excessively hot or cold temperatures, and mechanical injury. Page 324 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 15 of 18 B. Maintain concrete with minimal moisture loss at relatively constant temperature for period necessary for hydration of cement and hardening of concrete. C. All curing shall be per CBC Section 1905.11. Keep forms containing concrete in a wet condition until removed. Keep concrete continuously moist for not less than 7 days after placement. Keep concrete above 50ºF and moist with a fine fog water spray until protected by curing media. D. Forms containing concrete, top of concrete between forms, and exposed concrete surfaces after removal of forms shall be maintained in a thoroughly wet condition for at least 7 consecutive days after placing. Use the water curing method, curing sheet material, or a clear liquid membrane-forming curing compound except as otherwise specified. E. During times of dry or excessive winds, high ambient temperature, low humidity, or other ambient conditions causing rapid drying, use specified evaporation retardant and finishing aid material according to the manufacturers instructions and cure concrete with a fine fog spray of water, or equal, applied both during and after finishing and continued until final curing operations are started. F. Within 24 hours after finishing, exterior slabs and paving, and interior slabs to receive cement topping or mortar setting beds, shall be covered with sand to a depth of 2 inches and kept thoroughly wet for 7 days. 1. Instead of sand covering, exterior walks and paving where no other surface treatment is specified, may be cured with clear liquid curing compound immediately installed in accordance with manufacturer's directions. G. Where fly ash replacement is 20% or higher, floor slabs shall receive a 3 day moist cure and then 1 coat of approved curing compound. All other surfaces, with the exception of foundations, shall receive a coat of approved curing compound immediately after removal of formwork. H. Surfaces Not in Contact with Forms: 1. Initial Curing: Start as soon as free water has disappeared and before surface is dry. Keep continuously moist for not less than three days by water ponding, water-saturated sand, water-fog spray, or saturated burlap. 2. Final Curing: Begin after initial curing but before surface is dry. 3.10 GROUTING AND DRYPACKING A. Install as indicated or required. Where grouting and drypacking is part of the work of other sections, it shall conform to the following requirements, as applicable. B. Drypacking: Mix materials thoroughly with minimum amount of water. Install drypack by forcing and rodding to fill voids and provide complete bearing under plates. Finish exposed surfaces smooth and cure with damp burlap or liquid curing compound. C. Non-Shrink Grouting: 1. Mixing: Mix the approved non-shrink grout material with sufficient water per manufacturers recommendations. Page 325 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 16 of 18 2. Application: Surfaces to receive the non-shrink grout shall be clean, and shall be moistened thoroughly immediately before placing the mortar. Before grouting, surfaces to be in contact shall be roughened and cleaned thoroughly, all loose particles shall be removed and the surface flushed thoroughly with neat cement grout immediately before the grouting mortar is placed. Place fluid grout from one side only and puddle, chain, or pump for complete filling of voids; do not remove the dams or forms until grout attains initial set. Finish exposed surfaces smooth, and cure as recommended by grout manufacturer. 3.11 FIELD QUALITY CONTROL A. Comply with pertinent provisions of Section 014000: Quality Requirements. B. Provide free access to concrete operations at project site and cooperate with appointed firm. C. Testing/Evaluation of Concrete: Conform to CBC and ACI. Testing Laboratory shall perform following tests. Samples for testing shall be obtained in accordance with ASTM C 172, and shall be taken from as close to point of placement as possible. 1. Compressive Strength Tests: Cast one set of three or more cylinders from each days placing and each 50 cubic yards, or fraction thereof, or not less than once for each 2,000 square feet of surface area for slabs and walls, of each strength of structural concrete. Date cylinders, assign record number, and tag showing the location from which sample was taken. Also record slump test result of sample. Do not make more than two series of tests from any one location or batch of concrete. 2. Test Cylinders: Samples will be made in accordance with ASTM C172. Cast cylinders according to ASTM C31; 24 hours later, store cylinders under moist curing conditions at about 70 F. Test according to ASTM C39 at 7 and 28 day ages. The remaining cylinder shall be kept in reserve in case tests are unsatisfactory. D. Core Tests: Comply with CBC and ACI. If tests show that compressive strength of any concrete falls below required minimum at 28 day age, additional curing and testing of concrete which unsatisfactory test reports represent may be directed. Testing Laboratory shall take and test drilled cores as directed in accordance with ASTM C42. Contractor shall refill core holes with drypack concrete of the same compressive strength required for cored concrete. If core tests results are unsatisfactory, Contractor shall furnish required labor, equipment, and weights, and the Testing Laboratory shall conduct load testing on involved parts of building or structure as directed. Contractor shall bear additional curing and test costs, including Testing Laboratory costs, for concrete not meeting required compressive strength at 28 day age even if testing demonstrates that concrete has eventually attained required minimum compressive strength, and all costs for required corrections or removals and replacements as directed and required for approved construction. E. Take one additional test cylinder during cold weather concreting, cured on job site under same conditions as concrete it represents. F. Perform one slump test for each set of test cylinders taken, following procedures of ASTM C143/C143M. G. Slab Testing: Cooperate with manufacturer of specified moisture vapor reducing admixture (MVRA) to allow access for sampling and testing concrete for compliance with warranty requirements. Page 326 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 17 of 18 3.12 CLEAN UP A. Remove rubbish, debris and waste materials and legally dispose of off the Project site. 3.13 PROTECTION A. Do not permit traffic over unprotected concrete floor surface until fully cured. END OF SECTION Page 327 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3000 05-11-2023 03 3000 - Cast-in-Place Concrete Page 18 of 18 This page intentionally left blank Page 328 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 1 of 6 Section 03 3511 Concrete Floor Finishes PART 1 GENERAL 1.01 SECTION INCLUDES A. Surface treatments for concrete floors and slabs. B. Liquid densifiers and hardeners. C. Dry shake hardeners. D. Concrete stains and dyes. E. Clear coatings. F. Clear penetrating sealers. 1.02 RELATED REQUIREMENTS A. Section 03 3000 - Cast-in-Place Concrete: Finishing of concrete surface to tolerance; floating, troweling, and similar operations; curing. 1.03 REFERENCE STANDARDS A. ACI 301 - Specifications for Concrete Construction 2020. B. ACI 302.1R - Guide to Concrete Floor and Slab Construction 2015. C. ANSI A326.3 - American National Standard Test Method for Measuring Dynamic Coefficient of Friction of Hard Surface Flooring Materials 2021. D. ASME B46.1 - Surface Texture (Surface Roughness, Waviness, and Lay) 2009. E. ASTM F2508 - Standard Practice for Validation, Calibration, and Certification of Walkway Tribometers Using Reference Surfaces 2016. F. ASTM E1155 - Standard Test Method for Determining FF Floor Flatness and FL Floor Levelness Numbers 2020. 1.04 ADMINISTRATIVE REQUIREMENTS A. Coordinate the work with concrete floor placement and concrete floor curing. B. Preinstallation Meeting: Convene a pre-installation meeting with relevant parties. 1.05 SUBMITTALS Page 329 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 2 of 6 A. Product Data: Manufacturer's published data on each finishing product, including information on compatibility of different products and limitations. B. Concrete Floor Protection Plan: Contractor shall provide a concrete floor protection plan. C. Maintenance Data: Provide data on maintenance and renewal of applied finishes. D. Specimen Warranty: Manufacturer warranty. E. Provide letter of certification from concrete floor finish manufacturer for polished concrete system stating that the installer is a certified applicator of the polished concrete system and is familiar with proper procedures and installation requirements required by the manufacturer. F. Provide copy of tribometer testing and validation reports per ASTM F2508 1.06 QUALITY ASSURANCE A. Perform work in accordance with ACI 302.1R. B. Installer Qualifications: 1. Use an experienced installer and adequate number of skilled workmen who are thoroughly trained and experienced in the necessary craft. 2. The special concrete finish manufacturer shall certify applicator. 3. Applicator shall be familiar with the specified requirements and the methods needed for proper performance of work of this section. C. Concrete floor finishing sub-contractor to attend pre-installation meeting with concrete placement sub-contractor at least 1 week prior to placement of concrete. Architect and manufacturer's representative to attend pre-installation meeting with sub-contractors. 1. Finishing sub-contractor to review installation techniques for mock up and final floor slab with manufacturer. 2. Sub-contractors to review concrete mix design for compatibility with approved floor finish materials. 1.07 MOCK-UP A. For coatings, construct mock-up area under conditions similar to those that will exist during application, with coatings applied. B. Mock-Up Size: Minimum 15 feet square for each specified finish and color. C. Locate where directed by Owner and Architect. D. If the Architect or Owner Representative determines that mock-ups do not meet requirements, demolish and remove them from the siteand cast other until mock-ups are approved. E. Apprroved mock up to remain onsite until placement concrete slab. 1.08 DELIVERY, STORAGE, AND HANDLING Page 330 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 3 of 6 A. Deliver materials in manufacturer's sealed packaging, including application instructions. 1.09 PROTECTION A. No satisfactory chemical or cleaning procedure is available to remove petroleum stains from the concrete surface. Prevention is therefore essential. 1. All hydraulic powered equipment must be diapered to avoid staining of the concrete. 2. No trade will park vehicles on the inside slab. If necessary to complete their scope of work, drop cloths will be placed under vehicles at all times. 3. No pipe cutting machine will be used on the inside floor slab. 4. Steel will not be placed on interior slab to avoid rust staining. 5. Acids and acidic detergents will not come into contact with slab. 6. All trades are to be informed that the slab must be protected at all times. B. Concrete Floor Protection Plan: Concrete floor finish Subcontractor shall assist Contractor in development of Concrete Floor Protection Plan (CFPP). Plan to include 1. Signage to communicate with subcontractors protection requirements. (Available from ASCC as free download) 2. Concrete floor protection materials and placement 3. Plans for maintenance of protection materials 1.10 FIELD CONDITIONS A. Comply with manufacturers written instructions for cure time, substrate temperature and moisture content, ambietn temperature and humidity, ventilation adn other conditions affecting topping performance. B. Maintain light level equivalent to a minimum 200 W light source at 8 feet above the floor surface over each 20 foot square area of floor being finished. C. Maintain ambient temperature of 50 degrees F minimum or as recommended by the manufacturer. 1.11 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Finish Warranty: Provide 10-year manufacturer warranty against excessive degradation of finish and that it will remained hardened, dustproof, and water repellent. PART 2 PRODUCTS 2.01 CONCRETE FLOOR FINISH APPLICATIONS A. Liquid Densifier and Hardener: 1. Use at following locations: Plumbing Chase and Kiosk. B. Dry Shake Hardener: 1. Use at following locations:Restrooms. Page 331 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 4 of 6 C. Clear Coating: 2.02 DENSIFIERS AND HARDENERS AND SEALERS A. Liquid Densifier and Hardener: Penetrating chemical compound that reacts with concrete, filling the pores, hardening, and dustproofing. 1. Products: a. Ashford Formula; Curecrete Distribution, Inc.: www.ashfordformula.com b. Substitutions: See Section 01 6000 - Product Requirements. B. Dry Shake Hardener: Premixed dry powder for spreading on and working into concrete surface prior to set. 1. Color(s): As selected by Architect from manufacturer's custom range. 2. Color(s): a. Base Color: 100% Coverage: Arizona Tan A-53 b. Accent Color: 33% Coverage. broadcasted deep blend: Terra Cotta A-26 3. Composition: Non-metallic aggregate. a. Products: 1) L.M. Scofield Company; LITHOCHROME Color Hardener: www.scofield.com/#sle. 2) Substitutions: See Section 01 6000 - Product Requirements. 2.03 COATINGS A. High Gloss Clear Coating: Transparent, nonyellowing, acrylic polymer-based coating. 1. Composition: Solvent-based. B. Penetrating Sealer: Transparent, nonyellowing, water- or solvent-based coating. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that floor surfaces are acceptable to receive the work of this section. B. Verify that flaws in concrete have been patched and joints filled with methods and materials suitable for further finishes. C. Concrete must be in place a minimum of 45 days or as directed by the manufacturer before application can begin. D. Meeting with concrete installer. E. Letter to contractor and owner idenitfying areas formed not meeting required tolerances for installation. 3.02 TOLERANCES Page 332 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 5 of 6 A. Measure for F(F) and F(L) tolerances for floors in accordance with ASTM E1155, within 48 hours after slab installation. B. Finish concrete to achieve the following tolerances. Where sloping to a drain, omit level criteria. 1. Exposed to view without additional finishing: Ff 30 and Fl 20. 2. Exposed to view with concrete polishing system applied: Ff 40 and Fl 30. C. Correct the slab surface if tolerances are less than specificed. D. Correct defects by grinding or by removal and replacement of the defectivve work. Areas requiring corrective work will be identified. Re-measure corrected areas by the same process. 3.03 GENERAL A. Apply materials in accordance with manufacturer's instructions. 3.04 FLOOR FINISHING A. Finish concrete floor surfaces in accordance with ACI 301 and ACI 302.1R. B. In areas with floor drains, maintain design floor elevation at walls; slope surfaces uniformly to drains at 1/8 inch per foot nominal. No slope shall exceed 1/4 per foot. C. Dry Shake Hardener Applicaiton 1. Apply base color and work into concrete surface. 2. Allow adequate time for base color to cure to ensure no over-bleed of accent color. 3. Broadcast accent color for "flashed" finish along with additional base color if required and work into concrete surface. 4. Accent color may be sprinkeled ontop of trowled surface to achieve slip resistance. D. Slip Resistance: 1. Minimum wet dynamic coeficient of friction: 0.42 when measured per ANSI A326.3 2. Minimum floor roughness of 0.41 micrometers (16 micro inches) when measured per ASME B46.1 3.05 COATING APPLICATION A. Verify that surface is free of previous coatings, sealers, curing compounds, water repellents, laitance, efflorescence, fats, oils, grease, wax, soluble salts, residues from cleaning agents, and other impediments to adhesion. B. Protect adjacent non-coated areas from drips, overflow, and overspray; immediately remove excess material. 3.06 PROTECTION A. Protect finished work until fully cured in accordance with manufacturers recommendations. B. Protect finished work for the duration of construction. Page 333 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 03 3511 05-11-2023 03 3511 - Concrete Floor Finishes Page 6 of 6 END OF SECTION Page 334 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 1 of 14 Section 04 2000 Unit Masonry PART 1 GENERAL 1.01 SECTION INCLUDES A. Concrete block. B. Concrete facing brick. C. Mortar and grout. D. Installation of Reinforcement E. Placement of anchor bolts, assemblies and embeds F. Grouting of plates and embeds G. Accessories. 1.02 RELATED REQUIREMENTS A. Section 03 2000 - Concrete Reinforcing: Reinforcing steel for grouted masonry. B. Section 03 3000 - Cast-in-Place Concrete: Installation of dovetail slots for masonry anchors. C. Section 04 0511 - Masonry Mortaring and Grouting. D. Section 05 5000 - Metal Fabrications: Loose steel lintels. E. Section 07 6200 - Sheet Metal Flashing and Trim: Through-wall masonry flashings. F. Section 07 9200 - Joint Sealants: Sealing control and expansion joints. 1.03 REFERENCE STANDARDS A. ASTM C90 - Standard Specification for Loadbearing Concrete Masonry Units 2022. B. ASTM C140/C140M - Standard Test Methods for Sampling and Testing Concrete Masonry Units and Related Units 2022c. C. ASTM C144 - Standard Specification for Aggregate for Masonry Mortar 2018. D. ASTM C150/C150M - Standard Specification for Portland Cement 2022. E. ASTM C207 - Standard Specification for Hydrated Lime for Masonry Purposes 2018. Page 335 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 2 of 14 F. ASTM C270 - Standard Specification for Mortar for Unit Masonry 2019a, with Editorial Revision. G. ASTM C404 - Standard Specification for Aggregates for Masonry Grout 2018. H. ASTM C476 - Standard Specification for Grout for Masonry 2023. I. ASTM C979/C979M - Standard Specification for Pigments for Integrally Colored Concrete 2016. J. ASTN C1019 - Standard Test Method for Sampling and Testing Grout, 2016 K. ASTM C1314 - Standard Test Method for Compressive Strength of Masonry Prisms 2023. L. TMS 402/602 - Building Code Requirements and Specification for Masonry Structures 2022. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Mix Designs and test results: 1. One of the following for each mortar mix a. Mix designs indicating type and proportions of ingredients in compliance with the proportion specification of ASTM C270, or b. Mix designs and mortar tests performed in accordance with the property specification of ASTM C270 2. One of the following for each grout mix a. Mix designs indicating type and proportions of ingredients in compliance with the proportion specification of ASTM C476, or b. Mix designs and grout strength tests performed in accordance with the property specification of ASTM C476, or c. Compressive strength tests performed in accordance with ASTM C1019, and slump flow and Visual Stability Index (VSI) as determined by ASTM C1611/C1611M. C. Material Certificates- Material certificates for the following, certifying that each material is in compliance. 1. Reinforcement a. Refer to Section 03 2000 Concrete Reinforcement 2. Anchors, ties, fasteners, and metal accessories 3. Masonry Units 4. Mortar and grout materials 5. Self-Consolidating grout D. Construction Procedures 1. Cold weather construction procedures 2. Hot weather construction procedures E. Samples: Submit two samples of decorative block units to illustrate color, texture, and extremes of color range. Page 336 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 3 of 14 F. Samples of cured dry mortar showing finish color. G. Cured sealant colors for control joints. H. Control Joint Filler, 12" pieces of each size and type. 1.05 QUALITY ASSURANCE A. Comply with the pertinent provisions of 01 4000 "Quality Requirements." B. Comply with provisions of the following codes and standards except where exceeded by requirements of the contract documents. 1. California Building Code (CBC), 2016 2. ACI 530/530.1/ERTA, Building Code Requirements for Masonry Structures, 2013 C. Inspections: 1. General: Structural verifications inspections and test shall be performed in accordance with the following codes and standards: a. California Building Code (CBC), 2016 b. ACI 530/530.1/ERTA, Building Code Requirements for Masonry Structures, 2013 2. Owner Requirements: a. The owner or owner's agent shall employ one or more approved agencies to perform inspections during construction as required by code and shown in the contract documents and specifications 3. Special Inspection a. Qualifications: The special inspector(s) shall provide written documentation to the building official demonstrating his or her competence and relevant experience or training. The experience or training shall be considered relevant when the documented experience or training is related in complexity to the same type of special inspection activities for projects of similar complexity and material quantities. b. Special Inspection Report Requirements 1) The special inspector shall keep record of inspections 2) The special inspector shall furnish inspection reports to the building official and to the Architect and Engineer of Record. 3) Reports shall indicate that work inspected was or was not completed in conformance to approved construction documents. 4) Discrepancies shall be brought to the immediate attention of the contractor for correction 5) If not corrected discrepancies shall be brought to the attention of the building official, and the Architect and Engineer of Record prior to completion of that phase of work. 6) A final report documenting the special inspections and correction of any discrepancies noted shall be submitted to the building official. 4. Contractor Requirements a. Special inspection is in addition to the contractor's quality control inspections and testing. The contractor's quality control inspections and testing shall occur prior to special inspection and reports shall be available to the special inspector. b. The contractor will notify, in writing, the owner or owner's agent at least 48 hours in advance of special inspection required. Page 337 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 4 of 14 c. The contractor shall ensure that the work for which special inspection is required remains accessible and exposed for special inspection purposes until completion of the required special inspection. d. Any contractor responsible for the construction of the main wind and/or seismic force resisting system shall submit a written statement of responsibility to the building official and owner prior to commencement of work on the system or component. The statement of responsibility shall contain acknowledgement and awareness of the special inspection requirements. 5. Inspections Required per TMS 602-13/ACI 530.1/ASCE 6-13: Level C Quality Assurance MINIMUM TESTS Verification of f', and f'AAC in accordance with Article 1.4B prior to construction and for every 5,000 sq. ft. during construction.(see Section a below) Verification of proportions of materials in premixed or preblended mortar and grout other than self-consolidating grout as delivered to the project site. Verification of slump flow and visual stability Index (VSI) as delivered to the project site in accordance with Article 1.5 B.1.b.3 for self-consolidating grout MINIMUM SPECIAL INSPECTION Inspection Task Frequency Reference for Criteria Cont.Periodic TMS402/ ACI 530/ ASCE 5 TMS402/ ACI 530.1/ ASCE 6 1. Verify Compliance with the approved submittals X Art. 1.5 2. Verify that the following are in compliance: a. Proportions of site-mixed mortar, grout X Art. 2.1, 2.6A, 2.6B, 2.6C, 2.4G.1.b b. Grade, type and size of reinforcement and anchor bolts X Sec. 6.1 Art. 2.4, 3.4 c. Placement of masonry units and construction of mortar joints X Art. 3.3B d. Placement of reinforcement, connectors X Sec. 6.1, 6.2.1, 6.2.6, 6.2.7 Art. 3.2E, 3.4, 3.6A e. Grout space prior to grouting X Art. 3.2D, 3.2F f. Placement of grout X Art. 3.5, 3.6C Page 338 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 5 of 14 g. Size and location of structural elements X Art. 3.3F h. Type, size, and location of anchors including other details of anchorage of masonry to structural members, frames and other construction X Sec. 1.2.1(e), 6.1.4.3, 6.2.1 i. Welding of reinforcement X Sec. 8.1.6.7.2, 9.3.3.4(c), 11.3.3.4(b) j. Preparation, construction, and protection of masonry during cold weather (temperature below 40 degrees F) or hot weather (temperature above 90 degrees F) X Art. 1.8C, 1.8D 3. Observe Preparation of grout specimens, and/or prisms X Art. 1.4, B.2.a.3, 1.4 B.2.b.3, 1.4 B.2.c.3, 1.4 B.3, 1.4 B.4 a. Masonry compressive strength shall be determined for each wythe by the unit strength method or by the prism method (Reference the Specification for Masonry Structures (TMS 602-13/ACI 530.1-13/ASCE 6-13 Art. 1.4) 1) Unit Strength Method (Reference the Specification for Masonry Structures (TMS 602-13/ACI 530.1-13/ASCE 6-13 Art. 1.4B.2) (a) Units are to be sampled and tested to very conformance with ASTM C90. (b) Thickness of the bed joint shall not exceed 5/8". (c) For grouted masonry the grout shall conform to TMS 602-13/ACI 530.1-13/ASCE 6-13 Art. 2.2. 2) Prism Test Method: Determine the compressive strength of concrete masonry by the prism test method in accordance with ASTM C1314. 1.06 MOCK-UPs A. Sample panels 1. Construct sample panels of masonry walls. a. Use materials and procedures accepted for the work b. The minimum sample panel dimensions are 4 feet by 4 feet. c. The acceptable standard for the work is established by the accepted panel d. Retain sample panels at the project site until work has been accepted. 1.07 DELIVERY, STORAGE, AND HANDLING Page 339 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 6 of 14 A. Deliver, handle, and store masonry units by means that will prevent mechanical damage and contamination by other materials. B. Do not use damaged masonry units, damaged components of structure, damaged packaged materials, C. Protect cementitious materials for mortar and grout from precipitation and groundwater D. Do not use masonry materials that are contaminated E. Store different aggregates separately F. Protect reinforcement, ties and metal accessories from permanent distortions and store them off the ground. 1.08 PROJECT CONDITIONS A. Construction Loads - Do not apply construction loads that exceed the safe superimposed load capacity of the masonry and shores, if used. B. Masonry Protection - Cover top of unfinished masonry work to protect it from moisture intrusion C. Hot Weather Construction - Implement approved hot weather procedures and comply with the following: 1. Preparation When the ambient air temperature exceeds 100 degrees F, or exceeds 90 degrees F with a wind velocity greater than 8 mph: a. Preparation When the ambient air temperature exceeds 100 degrees F, or exceeds 90 degrees F with a wind velocity greater than 8 mph: 1) Maintain sand piles in a damp, loose condition 2) Provide necessary conditions and equipment to produce mortar having a temperature below 120°F 2. Construction ²While masonry work is in progress a. When the ambient air temperature exceeds 100°F, or exceeds 90°F with a wind velocity greater than 8 mph: 1) Maintain temperature of mortar and grout below 120°F. 2) Flush mixer, mortar transport container, and mortar boards with cool water before they come into contact with mortar ingredients or mortar. 3) Maintain mortar consistency by retempering with cool water. 4) Use mortar within 2 hr of initial mixing. 3. Protection ²When the mean daily temperature exceeds 100°F or exceeds 90°F with a wind velocity greater than 8 mph, fog spray all newly constructed masonry until damp, at least three times a day until the masonry is three days old. PART 2 PRODUCTS 2.01 CONCRETE MASONRY UNITS A. Concrete Block: Comply with referenced standards and as follows: Page 340 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 7 of 14 1. Size: Standard units with nominal face dimensions of 16 by 8 inches and nominal depth of 8 inches. 2. Load-Bearing Units: ASTM C90, medium weight. a. Hollow block, as indicated. 2.02 MORTAR AND GROUT MATERIALS A. Mortar 1. Provide mortar conforming to the following parameters a. Conform to ASTM C270 b. Comply with Section 2103.2 of the 2016 CBC c. Type S Mortar d. 1,800 psi minimum 28 day compressive strength B. Grout 1. Provide grout conforming to the following parameters a. Conform to ASTM C476 b. Comply with Section 2103.3 of the 2016 CBC c. 2,000 psi minimum 28 day compressive strength. Determine compressive strength of grout in accordance with ASTM C1019. d. Do not use admixtures unless accepted by the Engineer of Record. Field addition of admixtures is not permitted in self-consolidating grout. C. Portland Cement: ASTM C150/C150M, Type I; color as required to produce approved color sample. 1. Hydrated Lime: ASTM C207, Type S. 2. Grout Aggregate: ASTM C404. D. Pigments for Colored Mortar: Pure, concentrated mineral pigments specifically intended for mixing into mortar and complying with ASTM C979/C979M. 2.03 REINFORCEMENT AND ANCHORAGE A. Reinforcing Steel: Type specified in Section 03 2000; size as indicated on drawings; uncoated finish. 2.04 ACCESSORIES A. Preformed Control Joints: Rubber material. Provide with corner and tee accessories, fused joints. See Project Plans for additional control joint requirements. B. Joint Filler: Closed cell polyvinyl chloride; oversized 50 percent to joint width; self expanding; in maximum lengths available. C. Cleaning Solution: Non-acidic, not harmful to masonry work or adjacent materials. 2.05 MORTAR AND GROUT MIXING A. Mortar 1. Mix cementitious materials and aggregates between 3 and 5 minutes in a mechanical batch mixer with a sufficient amount of water to produce a workable consistency. Do not hand Page 341 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 8 of 14 mix mortar. Maintain workability of mortar by remixing or retempering. Discard mortar which has begun to stiffen or is not used within 2-1/2 hours after initial mixing. 2. Limit the weight of mineral oxide or carbon black pigments added to project-site prepared mortar to the following maximum percentages by weight of cement: a. Pigmented portland cement-lime mortar 1) Mineral oxide pigment = 10 percent 2) Carbon black pigment = 2 percent b. Pigmented mortar cement mortar 1) Mineral oxide pigment = 5 percent 2) Carbon black pigment = 1 percent c. Pigmented masonry cement mortar 1) Mineral oxide pigment = 5 percent 2) Carbon black pigment = 1 percent Do not add mineral oxide or carbon black pigment to preblended colored mortar or colored cement. 3. Do not use admixtures containing more than 0.2 percent chloride ions B. Grout 1. Except for self-consolidating grout, mix grout in accordance with the requirements of ASTM C476. 2. Unless otherwise required, mix grout other than self-consolidating grout to a consistency that has a slump between 8 and 11 inches. 3. Proportioning of self-consolidating grout at the project site is not permitted. Do not add water at the project site except in accordance with the self-consolidating grout manufacturer's recommendations. C. Grout: ASTM C476; consistency required to fill completely volumes indicated for grouting; fine grout for spaces with smallest horizontal dimension of 2 inches or less; coarse grout for spaces with smallest horizontal dimension greater than 2 inches. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that field conditions are acceptable and are ready to receive masonry. 1. Include verification that foundations are constructed within a level alignment tolerance of +/- 1/2 inch. B. Verify that related items provided under other sections are properly sized and located. 1. Include verification that reinforcing dowels are positioned in accordance with the project drawings. C. If stated conditions are not met notify the Architect and Engineer of Record. 3.02 PREPARATION A. Clean reinforcement and shanks of anchor bolts by removing mud, oil, or other materials that will adversely affect or reduce bond at the time mortar or grout is placed. Reinforcement with rust, mill scale, or both are acceptable without cleaning or brushing provided that the dimensions, of a cleaned sample are not less than required by the ASTM specification Page 342 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 9 of 14 governing the reinforcement. B. Prior to placing masonry, remove laitance, loose aggregate, and anything else that would prevent mortar from bonding to the foundation. C. Wetting Masonry units 1. Concrete Masonry - Unless otherwise required, do not wet concrete masonry before laying. Wet cutting is permitted. D. Debris - Construct grout spaces free of mortar dropping, debris, loose aggregates, and any material deleterious to masonry grout. E. Reinforcement - Place reinforcement and ties in grout spaces prior to grouting F. Cleanouts - Provide cleanouts in the bottom course of masonry for each grout pour when grout pour exceeds 5 ft 4 in. 1. Construct cleanouts so that the space to be grouted can be cleaned and inspected. In solid grouted masonry, space cleanout horizontally a maximum of 32 inches on center. 2. Construct cleanouts with an opening of sufficient size to permit removal of debris. The minimum opening dimension shall be 3 in. 3. After cleaning, close cleanouts with closures braced to resist grout pressure. 3.03 COLD AND HOT WEATHER REQUIREMENTS A. Comply with requirements of TMS 402/602 or applicable building code, whichever is more stringent. 3.04 COURSING A. Establish lines, levels, and coursing indicated. Protect from displacement. B. Maintain masonry courses to uniform dimension. Form vertical and horizontal joints of uniform thickness. C. Concrete Masonry Units: 1. Bond: Running. Unless Otherwise required on the drawings 2. Coursing: One unit and one mortar joint to equal 8 inches. 3.05 PLACING AND BONDING A. Placing mortar units 1. Mortar joints at foundations - In the starting course on the foundations and other supporting members, construct bed joints so that the bed joint thickness is a least /1/4 inch and not more than: a. 1-1/4" when the first course of masonry is solid grouted and supported by a concrete foundation. 2. Bed and head joints - Unless otherwise required construct 3/8 in thick bed and head joints except at foundation. Construct joints that also conform to the following a. Fill holes not specified in exposed and below grade masonry with mortar. b. Unless otherwise required, tool joint with a round jointer when the mortar is thumbprint hard. Page 343 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 10 of 14 c. Remove masonry protrusions extending 1/2 inch or more into cells or cavities to be grouted. 3. Hollow units - Place hollow units so: a. Face shells of bed joints are fully mortared b. Webs are fully mortared in: 1) all courses of piers, columns and pilasters; 2) when necessary to confine grout or insulation. c. Head joints are mortared, a minimum distance from each face equal to the face shell thickness of the unit. d. Vertical cells to be grouted are aligned and unobstructed openings for grout are provided in accordance with the project drawings. 4. Open units with beveled ends - Fully grout open-end units with beveled ends. Head joints of open-end units with beveled ends need not be mortared. At the beveled ends, form a grout key that permits grout within 5/8 inch of the face of the unit to prevent leakage of grout. 5. All Units a. Place clean units while the mortar is soft and plastic. Remove and re-lay in fresh mortar any unit disturbed to the extent that the initial bond is broken after initial positioning. b. Cut exposed edges or faces of masonry units smooth, or position so that exposed faces or edges are unaltered manufactured surfaces. c. When the bearing of a masonry wythe on its support is less than two-thirds of the wythe thickness, notify the Architect and Engineer of Record. B. Embedded items an accessories - Install embedded items and accessories as follows: 1. Construct chases as masonry units are laid 2. Install pipes and conduits passing horizontally through masonry partitions. 3. Place pipes and conduits passing horizontally through piers, pilasters, or columns 4. Place horizontal pipes and conduits in and parallel to plane of walls 5. Install secure connectors, flashing, weep holes, weep vents, nailing blocks, and other accessories. 6. Install movement joints. 7. Aluminum - Do not embed aluminum conduits pipes and accessories in masonry, grout or mortar unless they are effectively coated or isolated to prevent chemical reaction between aluminum and cement or electrolytic action between aluminum and steel. C. Bracing of masonry - Design, provide and install bracing that will assure stability of masonry during construction. D. Site tolerances - Erect masonry within the following tolerances from the specified dimensions. 1. Dimension of elements a. In cross section or elevation (-1/4 in., +1/2 in.) b. Mortar joint thickness bed joints between masonry courses (+ 1/8 in) bed joint between flashing and masonry (-1/2 in., +1/8 in.) head (-1/4 in., +3/8 in.) c. Grout space or cavity width, except for masonry walls passing framed construction (-1/4 in., +3/8 in.) 2. Elements a. Variation from level bed joints (+/- 1/4 in. in 10 ft, +/- 1/2 in. maximum) Page 344 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 11 of 14 top surface of load bearing walls (+/- 1/4 in. in 10 ft, +/- 1/2 in. maximum) b. Variation from plumb (+/- 1/4 in. in 10 ft, +/- 3/8 in. in 20 ft,+/- 1/2 in. maximum) c. True to a line (+/- 1/4 in. in 10 ft, +/- 3/8 in. in 20 ft,+/- 1/2 in. maximum) d. Alignment of columns and walls (bottom versus top) (+/- 1/2 in. for load bearing walls and columns., +/- 3/4 in. for non-load bearing walls) 3. Location of elements a. Indicated in plan (+/- 1/2 in. in 20 ft, +/- 3/4 in. maximum) b. Indicated in elevation (+/- 1/4 in. in story height +/- 3/4 in. maximum) c. If the above conditions cannot be met due to previous construction, notify the Architect and Engineer of Record. d. Reinforcement, tie, and anchor installation 3.06 REINFORCEMENT, TIE AND ANCHOR INSTALLATION A. Basic requirements - Place reinforcement, wall ties and anchors in accordance with the sizes, types, and locations indicated on the Project Drawings and as specified. Do not place dissimilar metals in contact with each other. B. Reinforcement 1. Support reinforcement to prevent displacement caused by construction loads or by placement of grout or mortar, beyond the allowable tolerances. 2. Completely embed reinforcing bars in grout in accordance with the Section entititled grout placement. 3. Maintain clear distance between reinforcing bards and the interior of masonry unity or formed surface of at least 1/4 inch for fine grout and 1/2 inch for coarse grout, except where cross webs of hollow units are used as supports for horizontal reinforcement. 4. Place reinforcing bars maintining the following minimum cover: a. Masonry face exposed to earth or weather 2 in for bars larger than No. 5, 1-12/ in. for No. 5 bars or smaller. b. Masonry not exposed to earth or weather 1-1/2 in. 5. Maintain minimum clear distance between parallel bars of the nominal bar size or 1 in., whichever is greater. 6. In columns and pilasters, maintain minimum clear distance between vertical bars of one and one-half times the nominal bar size or 1-1/2 in., whichever is greater. 7. Splice only where indicated on the Project Drawings, unless otherwise acceptable. When splicing by welding, provide welds in conformance with the provisions of AWS D1.4. 8. Do not bend reinforcement after it is embedded in grout or mortar without approval from the Engineer of Record. 9. Noncontact lap splices - Postion bars spliced by noncontact lap splices no farther apart transversely than one-fift the specified length of lap nor more than 8 in. 10. Joint reinforcement a. Place joint reinforcement so that longitudinal wires are embedded in mortar with a minimum cover of 1/2 in. when not exposed to weather or earth; or 5/8 in. when exposed to weather or earth. b. Provide minimum 6 in. lap splice for joint reinforcement. c. Ensure that all ends of longitudinal wires of joint reinforcement at laps are embedded in mortar or grout. 11. Placement tolerances a. Place reinforcing bars in walls and flexural elements within a tolerance of +/- 1/2 in. when the distance from the centerline of reinforcing bars to the opposite face of masonry, d, is equal to 8 in. or less, +/- 1in. for d equal to 24 in. or less but greater Page 345 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 12 of 14 than 8 in., and 1-1/4 in. for d greater than 24 in. b. Place vertical bars within: 1) 2 in. of the required location along the length of the wall when the wall segment length exceeds 24 in. 2) 1 in. of the required location along the length of the wall when the wall segment length does not exceed 24 in 3) If it is necessary to move bars more than one bar diameter or a distance exceeding the tolerance stated above to avoid interference with other reinforcing steel, conduits, or embedded items notify the Engineer of Record. 4) Foundation dowels that interfere with unit webs are permitted to be be bent to a maximum of 1 in. horizontally for every 6 in. of vertical height. C. Anchor bolts 1. Embed headed and bent-bar anchor bolts larger than 1/4 in. diameter in grout that is placed in accordance with Section 3.06A and Section 3.06B. Anchor bolts of 1/4 in.diameter or less are permitted to be placed in grout or mortar bed joints that have a specified thickness of at least 1/2 in. thickness. 2. For anchor bolts placed in the top of grouted cells and bond beams, maintain a clear distance between the bolt and the face of masonry unit of at least 1/4 in. when using fine grout and 1/2 in. when using coarse grout. 3. For anchor bolts placed throught the face shell of a hollow masonry unit, drill a hole that is tight-fitting to the bolt or provide minimum clear distance that conforms to Section 3.05D.2 around the bolt and through the face of the shell. For the portion of the bolt that is within the grouted cell, maintain a clear distance between the bolt and the face of masonry unit and between the head or bent leg of the bolt and the formed surface of grout of at least 1/4 in. when using fine grout and at least 1/2 in when using coarse grout. 4. Place anchor bolt with a clear distance between parallel anchor bolts not less than the nominal diameter of the anchor bolt, nor less than 1 in. 3.07 GROUT PLACEMENT A. Placing time - Place grout wihin 1-1/2 hr from introducing water in the mixture and prior to initial set. 1. Discard site-mixed grout that does not meet the specified slump without adding water after initial mixing. 2. For ready-mixed grout: a. Addition of water is permitted at the time of discharge to adjust slump. b. Discard ready mixed grout that does not meet the specified slump without adding water, other than the water that was added at the time of discharge. The time limit is waived as long as the ready mixed grout meets the specified slump. B. Confinement - Confine grout to the areas indicated on the project drawings. Use material to confine grout that permits bond between masonry units and mortar. C. Grout pour height - Do not exceed the maximum grout pour height given in the Table below Grout Type (1) Maximum grout pour height, ft Minimum clear width of grout space, in (2,3) Minimum clear grout space dimensions for grouting cells of hollow units, in x in (3,4,5) Fine 1 3/4 1-1/2x2 Fine 5.33 2 2x3 Page 346 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 13 of 14 Fine 12.67 2-1/2 2-1/2x3 Fine 24 3 3x3 Coarse 1 3/4 1-1/2x3 Coarse 5.33 2 2-1/2x3 Coarse 12.67 2-1/2 3x3 Coarse 24 3 3x4 1. Fine and course grouts are defined by ASTM C476. 2. For grouting between masonry wythes. 3. Minimum clear width of grout space and minimum clear grout space dimension are the net dimension of the space determined by subtracting masonry protrusions and the diameters of horizontal bars from the as-built cross section of the grout space. Select grout type and maximum grout pour height based on minimum clear space. 4. Area of vertical reinforcement shall not exceed 6 percent of the area of the grout space. D. Grout lift height 1. For grout conforming to Section 2.02B a. Where the following conditions are met, place grout in lifts not exceeding 12 ft 8 in. 1) The masonry has cured at least 4 hours 2) The grout slump is maintained between 10 and 11 in. 3) No intermediate reinforced bond beams are placed between the top and the bottom of the pour height b. When conditions 1 and 2 are met but there are intermediate bond beams within the grout pour, limit the grout lift height to the bottom of the lowest bond beam that is more than 5 ft. 4 in. above the bottom of the lift, but do not exceed a grout lift height of 12 ft. 8 in. c. When the conditions of 1 or 2 are not met, place grout in lifts not excedding 5 ft. 4 in. 2. For self-consolidating grout conforming to Section 2.02B: a. When placed in masonry that has cured for at least 4 hours, place in lifts not exceeding the grout pour height. b. When placed in masonry that has not cured for at least 4 hours, place in lifts not exceeding 5 ft. 4 in. or the grout pour height, whichever is less. E. Consolidation 1. Consolidate grout at the time of placement. a. Consolidate grout pours 12 in. or less in height by mechanical vibration or by puddling. b. Consolidate pours exceeding 12 in in height by mechanical vibration, and reconsolidate by mechanical vibration after initial water loss and settlement has occurred. 2. Consolidation or reconsolidation is note required for self-consolidating grout. F. Grout key - When grouting, form grout keys between grout pours. Form grout keys between grout lifts when the first lift is permitted to set prior to placement of the subsequent lift. 1. Form a grout key by terminating the grout a minimum of 1-1/2 in. below a mortar joint. 2. Do not form grout keys within beams. 3. At beams or lintels laid with closed bottom units, terminate the grout pour at the bottom of the beam or lintel without forming a grout key. 4. Alternate grout placement - Place masonry units and grout using construction procedures emploiyed in the accepted grout demonstration panel. Page 347 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2000 05-11-2023 04 2000 - Unit Masonry Page 14 of 14 G. Lap splices minimum 24 bar diameters. H. Support and secure reinforcing bars from displacement. Maintain position within 1/2 inch of dimensioned position. I. Place and consolidate grout fill without displacing reinforcing. 3.08 CONTROL AND EXPANSION JOINTS A. Do not continue horizontal joint reinforcement through control or expansion joints. B. Install preformed control joint device in continuous lengths. Seal butt and corner joints in accordance with manufacturer's instructions. 3.09 FIELD QUALITY CONTROL A. An independent testing agency will perform field quality control tests, as specified in Section 01 4000 - Quality Requirements. B. Verify f'm and f'AAC in accordance with Section 1.05 C. Sample and test grout as required in Section 1.04 and 1.05. 3.10 CLEANING A. Remove excess mortar and mortar droppings. B. Replace defective mortar. Match adjacent work. C. Clean soiled surfaces with cleaning solution. D. Use non-metallic tools in cleaning operations. E. Remove debris F. Do not damage the masonry 3.11 PROTECTION A. Protect adjacent construction and in place masonry against damage. B. Without damaging completed work, provide protective boards at exposed external corners that are subject to damage by construction activities. END OF SECTION Page 348 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 1 of 8 Section 04 2613 Masonry Veneer PART 1 GENERAL 1.01 SECTION INCLUDES A. Clay facing brick. B. Mortar and grout. C. Reinforcement and anchorage. D. Flashings. E. Accessories. 1.02 RELATED REQUIREMENTS A. Section 07 6200 - Sheet Metal Flashing and Trim: Through-wall masonry flashings. B. Section 07 9200 - Joint Sealants: Sealing control and expansion joints. 1.03 REFERENCE STANDARDS A. ASTM A153/A153M - Standard Specification for Zinc Coating (Hot-Dip) on Iron and Steel Hardware 2016a. B. ASTM A615/A615M - Standard Specification for Deformed and Plain Carbon-Steel Bars for Concrete Reinforcement 2022. C. ASTM C91/C91M - Standard Specification for Masonry Cement 2023. D. ASTM C207 - Standard Specification for Hydrated Lime for Masonry Purposes 2018. E. ASTM C216 - Standard Specification for Facing Brick (Solid Masonry Units Made from Clay or Shale) 2022. F. ASTM C270 - Standard Specification for Mortar for Unit Masonry 2019a, with Editorial Revision. G. ASTM C476 - Standard Specification for Grout for Masonry 2023. H. ASTM D226/D226M - Standard Specification for Asphalt-Saturated Organic Felt Used in Roofing and Waterproofing 2017 (Reapproved 2023). I. BIA Technical Notes No. 7 - Water Penetration Resistance ±Design and Detailing 2017. J. BIA Technical Notes No. 28B - Brick Veneer/Steel Stud Walls 2005. Page 349 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 2 of 8 K. BIA Technical Notes No. 46 - Maintenance of Brick Masonry 2017. L. TMS 402/602 - Building Code Requirements and Specification for Masonry Structures 2022. 1.04 ADMINISTRATIVE REQUIREMENTS 1.05 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data: Provide data for masonry units, fabricated wire reinforcement, and mortar. C. Samples: Submit four samples of decorative block and facing brick units to illustrate color, texture, and extremes of color range. D. Manufacturer's Certificate: Certify that masonry units meet or exceed specified requirements. E. Maintenance Materials: Furnish the following for City's use in maintenance of project. 1. See Section 01 6000 - Product Requirements, for additional provisions. 1.06 QUALITY ASSURANCE A. Comply with provisions of TMS 402/602, except where exceeded by requirements of Contract Documents. B. Manufacturer Qualifications: Company specializing in manufacturing the type of products specified in this section with minimum three years of documented experience. C. Installer Qualifications: Company specializing in performing work of the type specified and with at least three years of documented experience. 1.07 MOCK-UP A. Construct a masonry wall as a mock-up panel sized 8 feet long by 6 feet high; include mortar and accessories and structural backup in mock-up. B. Locate where directed. C. Mock-up may remain as part of the Work. 1.08 DELIVERY, STORAGE, AND HANDLING A. Deliver, handle, and store masonry units by means that will prevent mechanical damage and contamination by other materials. 1.09 FIELD CONDITIONS A. Cold and Hot Weather Requirements: Comply with requirements of TMS 402/602 or applicable building code, whichever is more stringent. Page 350 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 3 of 8 B. Maintain materials and surrounding air temperature to minimum 40 degrees F prior to, during, and 48 hours after completion of masonry work. C. Maintain materials and surrounding air temperature to maximum 90 degrees F prior to, during, and 48 hours after completion of masonry work. PART 2 PRODUCTS 2.01 UNIT MASONRY - GENERAL 2.02 BRICK UNITS A. Manufacturers: 1. H.C. Muddox;https://www.hcmuddox.com/. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Facing Brick: ASTM C216, Type FBS Smooth, Grade SW. 1. Color and Texture: 95/5 Blend, Old Sacramento Blend and Klinker 2. Nominal Size: Standard - 2-1/2 x 8 inch.. a. 3/4" thin brick veneer b. Approx. 1" thin brick veneer - full brick cut in half at soldier course. c. Full brick veneer wtih anchoage attachment 3. Special Shapes: Molded units as required by conditions indicated, unless standard units can be sawn to produce equivalent effect. 2.03 MORTAR AND GROUT MATERIALS A. Masonry Cement: ASTM C91/C91M Type S. 1. Product: Spec Mix Polymer Modified AVM Mortar. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Hydrated Lime: ASTM C207, Type S. 1. Color: Grey C. Water: Clean and potable. 2.04 REINFORCEMENT AND ANCHORAGE A. Reinforcing Steel: ASTM A615/A615M, Grade 40 (40,000 psi) yield strength, deformed billet bars; galvanized. B. Joint Reinforcement Type: Use ladder type joint reinforcement where vertical reinforcement is involved and truss type elsewhere, unless otherwise indicated. C. Masonry Veneer Anchors: 2-piece anchors that permit differential movement between masonry veneer and structural backup, hot dip galvanized to ASTM A 153/A 153M, Class B. 1. Anchor plates: Not less than 0.075 inch thick, designed for fastening to structural backup through sheathing by two fasteners; provide design with legs that penetrate sheathing and insulation to provide positive anchorage. Page 351 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 4 of 8 2. Wire ties: Manufacturer's standard shape, 0.1875 inch thick. 3. Vertical adjustment: Not less than 3-1/2 inches. 2.05 FLASHINGS A. Metal Flashing Materials: Galvanized Steel or prefinsihed flashing, as specified in Section 07 6200 or as indicated on the drawings. 2.06 ACCESSORIES A. Building Paper: ASTM D226/D226M, Type I ("No. 15") asphalt felt. B. Weeps: 1. Type: Preformed aluminum vents with sloping louvers. 2. Color(s): As selected by Architect from manufacturer's full range to complement brick veneer. C. Cleaning Solution: Non-acidic, not harmful to masonry work or adjacent materials. 2.07 MORTAR AND GROUT MIXING A. Mortar for Unit Masonry: ASTM C270, Proportion Specification. 1. Masonry below grade and in contact with earth; Type S. B. Grout: ASTM C476; consistency as required to fill volumes completely for grouting; fine grout for spaces with smallest horizontal dimension of 2 inches or less; coarse grout for spaces with smallest horizontal dimension greater than 2 inches. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that field conditions are acceptable and are ready to receive masonry. B. Verify that related items provided under other sections are properly sized and located. C. Verify that built-in items are in proper location, and ready for roughing into masonry work. 3.02 COURSING A. Establish lines, levels, and coursing indicated. Protect from displacement. B. Maintain masonry courses to uniform dimension. Form vertical and horizontal joints of uniform thickness. C. Brick Units: 1. Bond:Running. 2. Coursing: Three units and three mortar joints to equal 8 inches. 3. Mortar Joints: Concave. Page 352 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 5 of 8 3.03 PLACING AND BONDING A. Lay solid masonry units in full bed of mortar, with full head joints, uniformly jointed with other work. B. Lay hollow masonry units with face shell bedding on head and bed joints. C. Buttering corners of joints or excessive furrowing of mortar joints is not permitted. D. Remove excess mortar as work progresses. E. Interlock intersections and external corners, except for units laid in stack bond. F. Do not shift or tap masonry units after mortar has achieved initial set. Where adjustment must be made, remove mortar and replace. G. Perform job site cutting of masonry units with proper tools to provide straight, clean, unchipped edges. Prevent broken masonry unit corners or edges. H. Isolate top joint of masonry veneer from horizontal structural framing members or support angles with compressible joint filler. 3.04 WEEPS/CAVITY VENTS A. Install weeps in veneer walls at 24 inches on center horizontally on top of through-wall flashing above shelf angles and lintels and at bottom of walls. 3.05 REINFORCEMENT AND ANCHORAGE - MASONRY VENEER A. Install horizontal joint reinforcement 12 inches on center. B. Place continuous joint reinforcement in first and second joint below top of walls. C. Embed longitudinal wires of joint reinforcement in mortar joint with at least 5/8 inch mortar cover on each side. D. Lap joint reinforcement ends minimum 6 inches. E. Reinforce joint corners and intersections with strap anchors 16 inches on center. 3.06 MASONRY FLASHINGS A. Whether or not specifically indicated, install masonry flashing to divert water to exterior at all locations where downward flow of water will be interrupted. 1. Extend flashings full width at such interruptions and at least 6 inches, minimum, into adjacent masonry or turn up at least 1 inch, minimum, to form watertight pan at non- masonry construction. 2. Remove or cover protrusions or sharp edges that could puncture flashings. 3. Seal lapped ends and penetrations of flashing before covering with mortar. Page 353 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 6 of 8 B. Terminate flashing up 8 inches minimum on vertical surface of backing: C. Lap end joints of flashings at least 6 inches, minimum, and seal watertight with flashing sealant/adhesive. 3.07 CONTROL AND EXPANSION JOINTS A. Do not continue horizontal joint reinforcement through control or expansion joints. B. Form control joint with a sheet building paper bond breaker fitted to one side of the hollow contour end of the block unit. Fill the resultant core with grout fill. Rake joint at exposed unit faces for placement of backer rod and sealant. C. Size control joints as indicated on drawings; if not indicated, 3/4 inch wide and deep. D. Locate control joints at intervals recommended by manufacturer. Verify location with architecte prior to installation. 3.08 TOLERANCES A. Install masonry within the site tolerances found in TMS 402/602. B. Maximum Variation From Unit to Adjacent Unit: 1/16 inch. C. Maximum Variation from Plane of Wall: 1/4 inch in 10 ft and 1/2 inch in 20 ft or more. D. Maximum Variation from Plumb: 1/4 inch per story non-cumulative; 1/2 inch in two stories or more. E. Maximum Variation from Level Coursing: 1/8 inch in 3 ft and 1/4 inch in 10 ft; 1/2 inch in 30 ft. F. Maximum Variation of Mortar Joint Thickness: Head joint, minus 1/4 inch, plus 3/8 inch. 3.09 CUTTING AND FITTING A. Cut and fit for pipes and conduit. Coordinate with other sections of work to provide correct size, shape, and location. B. Obtain approval prior to cutting or fitting masonry work not indicated or where appearance or strength of masonry work may be impaired. 3.10 CLEANING A. Remove excess mortar and mortar smears as work progresses. B. Replace defective mortar. Match adjacent work. C. Clean soiled surfaces with cleaning solution. Page 354 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 7 of 8 D. Use non-metallic tools in cleaning operations. 3.11 PROTECTION A. Without damaging completed work, provide protective boards at exposed external corners that are subject to damage by construction activities. END OF SECTION Page 355 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 04 2613 05-11-2023 04 2613 - Masonry Veneer Page 8 of 8 This page intentionally left blank Page 356 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 1 of 6 Section 05 1200 Structural Steel Framing PART 1 GENERAL 1.01 SECTION INCLUDES A. Structural steel framing members. B. Structural steel support members and struts. C. Base plates, shear stud connectors and expansion joint plates. D. Grouting under base plates. 1.02 RELATED REQUIREMENTS A. Section 05 2100 - Steel Joist Framing. B. Section 05 5000 - Metal Fabrications: Steel fabrications affecting structural steel work. 1.03 REFERENCE STANDARDS A. AISC (MAN) - Steel Construction Manual 2017. B. AISC 303 - Code of Standard Practice for Steel Buildings and Bridges 2022. C. ASTM A36/A36M - Standard Specification for Carbon Structural Steel 2019. D. ASTM A53/A53M - Standard Specification for Pipe, Steel, Black and Hot-Dipped, Zinc- Coated, Welded and Seamless 2022. E. ASTM A108 - Standard Specification for Steel Bar, Carbon and Alloy, Cold-Finished 2018. F. ASTM A153/A153M - Standard Specification for Zinc Coating (Hot-Dip) on Iron and Steel Hardware 2016a. G. ASTM A242/A242M - Standard Specification for High-Strength Low-Alloy Structural Steel 2013 (Reapproved 2018). H. ASTM A307 - Standard Specification for Carbon Steel Bolts, Studs, and Threaded Rod 60 000 PSI Tensile Strength 2021. I. ASTM A500/A500M - Standard Specification for Cold-Formed Welded and Seamless Carbon Steel Structural Tubing in Rounds and Shapes 2021a. J. ASTM A572/A572M - Standard Specification for High-Strength Low-Alloy Columbium- Vanadium Structural Steel 2021, with Editorial Revision. Page 357 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 2 of 6 K. ASTM A992/A992M - Standard Specification for Structural Steel Shapes 2022. L. ASTM E94/E94M - Standard Guide for Radiographic Examination Using Industrial Radiographic Film 2017. M. ASTM E164 - Standard Practice for Contact Ultrasonic Testing of Weldments 2019. N. ASTM E165/E165M - Standard Practice for Liquid Penetrant Testing for General Industry 2018. O. ASTM E709 - Standard Guide for Magnetic Particle Testing 2021. P. ASTM F436/F436M - Standard Specification for Hardened Steel Washers Inch and Metric Dimensions 2019. Q. ASTM F1554 - Standard Specification for Anchor Bolts, Steel, 36, 55, and 105-ksi Yield Strength 2020. R. AWS A2.4 - Standard Symbols for Welding, Brazing, and Nondestructive Examination 2020. S. AWS B2.1/B2.1M - Specification for Welding Procedure and Performance Qualification 2021. T. AWS D1.1/D1.1M - Structural Welding Code - Steel 2020, with Errata (2022). U. IAS AC172 - Accreditation Criteria for Fabricator Inspection Programs for Structural Steel AC172 2019. V. SSPC-Paint 15 - Steel Joist Shop Primer/Metal Building Primer 2004. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Shop Drawings: 1. Indicate profiles, sizes, spacing, locations of structural members, openings, attachments, and fasteners. 2. Connections not detailed. 3. Indicate welded connections with AWS A2.4 welding symbols. Indicate net weld lengths. C. Manufacturer's Mill Certificate: Certify that products meet or exceed specified requirements. D. Mill Test Reports: Indicate structural strength, destructive test analysis and non-destructive test analysis. E. Materials Test Reports: Submit independent test results or engineered performance analysis of structural thermal-break pad performance in bearing or slip-critical connections where shear and moment loads are applied. F. Welders' Qualification Statement: Welders' certificates in accordance with AWS B2.1/B2.1M and dated no more than 12 months before start of scheduled welding work. Page 358 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 3 of 6 G. Fabricator's Qualification Statement. H. Fabricator's Qualification Statement: Provide documentation showing steel fabricator is accredited under IAS AC172. 1.05 QUALITY ASSURANCE A. Fabricate structural steel members in accordance with AISC (MAN) "Steel Construction Manual." B. Structural steel members designated as architecturally-exposed structural steel (AESS) to also comply with Section 05 1213. C. Maintain one copy of each document on site. D. Fabricator: Company specializing in performing the work of this section with minimum two years of documented experience. E. Welder Qualifications: Welding processes and welding operators qualified in accordance with AWS D1.1/D1.1M and no more than 12 months before start of scheduled welding work. F. Fabricator Qualifications: A qualified steel fabricator that is accredited by the International Accreditation Service (IAS) Fabricator Inspection Program for Structural Steel in accordance with IAS AC172. G. Erector: Company specializing in performing the work of this section with minimum two years of documented experience. PART 2 PRODUCTS 2.01 MATERIALS A. Steel Angles and Plates: ASTM A36/A36M. B. Steel W Shapes and Tees: ASTM A992/A992M. C. Rolled Steel Structural Shapes: ASTM A992/A992M. D. Steel Plates and Bars: ASTM A572/A572M, Grade 50 (345) high-strength, columbium- vanadium steel. E. Cold-Formed Structural Tubing: ASTM A500/A500M, Grade B. F. Pipe: ASTM A53/A53M, Grade B, Finish black. G. Structural Bolts and Nuts: Carbon steel, ASTM A307, Grade A and galvanized in compliance with ASTM A153/A153M Class C. H. Headed Anchor Rods: ASTM F1554 Grade 36, plain. Page 359 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 4 of 6 I. Welding Materials: AWS D1.1/D1.1M; type required for materials being welded. J. Grout: ASTM C1107/C1107M; Non-shrink; premixed compound consisting of non-metallic aggregate, cement, water reducing and plasticizing agents. 1. Minimum Compressive Strength at 48 Hours: 2,000 pounds per square inch. 2. Minimum Compressive Strength at 28 Days: 7,000 pounds per square inch. 2.02 FABRICATION A. Shop fabricate to greatest extent possible. 2.03 FINISH A. Shop prime structural steel members. Do not prime surfaces that will be fireproofed, field welded, in contact with concrete, or high strength bolted. 2.04 SOURCE QUALITY CONTROL A. Welded Connections: Visually inspect all shop-welded connections and test all complete penetration welds and at least ten percent of fillet welds using one of the following: 1. Radiographic testing performed in accordance with ASTM E94/E94M. 2. Ultrasonic testing performed in accordance with ASTM E164. 3. Liquid penetrant inspection performed in accordance with ASTM E165/E165M. 4. Magnetic particle inspection performed in accordance with ASTM E709. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that conditions are appropriate for erection of structural steel and that the work may properly proceed. 3.02 ERECTION A. Erect structural steel in compliance with AISC 303. 3.03 TOLERANCES A. Maximum Variation From Plumb: 1/4 inch per story, non-cumulative. B. Maximum Offset From True Alignment: 1/4 inch. 3.04 FIELD QUALITY CONTROL A. An independent testing agency will perform field quality control tests, as specified in Section 01 4000 - Quality Requirements. B. Welded Connections: Visually inspect all field-welded connections and test all complete penetration welds and at least ten percent of welds using one of the following: Page 360 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 5 of 6 1. Radiographic testing performed in accordance with ASTM E94/E94M. 2. Ultrasonic testing performed in accordance with ASTM E164. 3. Liquid penetrant inspection performed in accordance with ASTM E165/E165M. 4. Magnetic particle inspection performed in accordance with ASTM E709. END OF SECTION Page 361 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 1200 05-11-2023 05 1200 - Structural Steel Framing Page 6 of 6 This page intentionally left blank Page 362 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 4000 05-11-2023 05 4000 - Cold-Formed Metal Framing Page 1 of 4 Section 05 4000 Cold-Formed Metal Framing PART 1 GENERAL 1.01 SECTION INCLUDES A. Formed steel stud exterior wall and interior wall framing. B. Exterior wall sheathing. C. Formed steel joist and purlin framing and bridging. 1.02 RELATED REQUIREMENTS A. Section 051200: Structural building framing. 1.03 REFERENCE STANDARDS A. AISI S100 - North American Specification for the Design of Cold-Formed Steel Structural Members 2016, with Supplement (2020). B. AISI SG02-1 - North American Specification for the Design of Cold-Formed Steel Structural Members; American Iron and Steel Institute; 2001 with 2004 supplement. (replaced SG-971) C. ASTM A153/A153M - Standard Specification for Zinc Coating (Hot-Dip) on Iron and Steel Hardware 2016a. D. ASTM A653/A653M - Standard Specification for Steel Sheet, Zinc-Coated (Galvanized) or Zinc-Iron Alloy-Coated (Galvannealed) by the Hot-Dip Process 2022. E. ASTM A1008/A1008M - Standard Specification for Steel, Sheet, Cold-Rolled, Carbon, Structural, High-Strength Low-Alloy, High-Strength Low-Alloy with Improved Formability, Required Hardness, Solution Hardened, and Bake Hardenable 2021a. F. ASTM C1007 - Standard Specification for Installation of Load Bearing (Transverse and Axial) Steel Studs and Related Accessories 2020. G. AWS D1.1/D1.1M - Structural Welding Code - Steel 2020, with Errata (2022). H. SSPC-Paint 15 - Steel Joist Shop Primer/Metal Building Primer 2004. 1.04 ADMINISTRATIVE REQUIREMENTS A. Coordinate with work of other sections that is to be installed in or adjacent to the metal framing system, including but not limited to structural anchors, cladding anchors, utilities, insulation, and firestopping. Page 363 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 4000 05-11-2023 05 4000 - Cold-Formed Metal Framing Page 2 of 4 1.05 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Provide data on standard framing members; describe materials and finish, location in project, product criteria, limitation. C. Manufacturer's Installation Instructions: Indicate special procedures, conditions requiring special attention , and ________. 1.06 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing the types of products specified in this section, and with minimum three years of documented experience. B. Manufacturer Qualifications: Member of Steel Stud Manufacturers Association (SSMA): www.ssma.com/#sle. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Metal Framing: 1. CEMCO: www.cemcosteel.com/#sle. 2. ClarkDietrich: www.clarkdietrich.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. B. Framing Connectors and Accessories: 1. Same manufacturer as metal framing. 2.02 FRAMING SYSTEM A. Provide primary and secondary framing members, bridging, bracing, plates, gussets, clips, fittings, reinforcement, and fastenings as required to provide a complete framing system. 2.03 FRAMING MATERIALS A. Studs and Track: ASTM C955; studs formed to channel, C- or Sigma-shaped with punched web; U-shaped track in matching nominal width and compatible height. 1. Gauge and Depth: As indicated on drawings. 2. Products: a. CEMCO; ProX Header: www.cemcosteel.com/#sle. B. Joists and Purlins: Fabricated from ASTM A1008/A1008M Designation SS (structural steel) sheet, shop painted. 1. Gauge and Depth: As indicated on drawings. 2. Finish: Manufacturer's standard, rust-inhibitive paint. C. Framing Connectors: Factory-made, formed steel sheet. Page 364 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 4000 05-11-2023 05 4000 - Cold-Formed Metal Framing Page 3 of 4 1. Material: ASTM A653/A653M SS Grade 33 and 40 (minimum), with G90/Z275 hot dipped galvanized coating for base metal thickness less than 10 gauge, 0.1345 inch, and factory punched holes and slots. 2. Structural Performance: Maintain load and movement capacity required by applicable code, when evaluated in accordance with AISI S100. 3. Fixed Connections: Provide non-movement connections for tie-down to foundation, floor- to-floor tie-down, roof-to-wall tie-down, joist hangers, gusset plates, and stiffeners. 2.04 FASTENERS A. Self-Drilling, Self-Tapping Screws, Bolts, Nuts and Washers: Hot dip galvanized per ASTM A153/A153M. B. Anchorage Devices: Powder actuated. C. Welding: Comply with AWS D1.1/D1.1M. 2.05 ACCESSORIES A. Bracing, Furring, Bridging: Formed sheet steel, thickness determined for conditions encountered; finish to match framing components. B. Shop and Touch-Up Primer: SSPC-Paint 15, complying with VOC limitations of authorities having jurisdiction. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that substrate surfaces are ready to receive work. 3.02 INSTALLATION OF STUDS A. Install components in accordance with ASTM C1007 requirements and ASTM C1007 requirements. 3.03 INSTALLATION OF JOISTS AND PURLINS A. Install framing components in accordance with manufacturer's instructions. B. Make provisions for erection stresses. Provide temporary alignment and bracing. END OF SECTION Page 365 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 4000 05-11-2023 05 4000 - Cold-Formed Metal Framing Page 4 of 4 This page intentionally left blank Page 366 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 1 of 6 Section 05 5000 Metal Fabrications PART 1 GENERAL 1.01 SECTION INCLUDES A. Shop fabricated steel and aluminum items. B. Ventilation Screens C. Metal Roof Accessories - Fineals, Fasica Brackets, Overhand Support Brackets etc. 1.02 RELATED REQUIREMENTS A. Section 05 1200 - Structural Steel Framing: Structural steel B. Section 09 9113 - Exterior Painting: Paint finish. 1.03 REFERENCE STANDARDS A. ASTM A36/A36M - Standard Specification for Carbon Structural Steel 2019. B. ASTM A48/A48M - Standard Specification for Gray Iron Castings 2022. C. ASTM A53/A53M - Standard Specification for Pipe, Steel, Black and Hot-Dipped, Zinc- Coated, Welded and Seamless 2022. D. ASTM A123/A123M - Standard Specification for Zinc (Hot-Dip Galvanized) Coatings on Iron and Steel Products 2017. E. ASTM A283/A283M - Standard Specification for Low and Intermediate Tensile Strength Carbon Steel Plates 2018. F. ASTM A307 - Standard Specification for Carbon Steel Bolts, Studs, and Threaded Rod 60 000 PSI Tensile Strength 2021. G. ASTM A501/A501M - Standard Specification for Hot-Formed Welded and Seamless Carbon Steel Structural Tubing 2021. H. ASTM B221 - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes 2021. I. ASTM B221M - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes (Metric) 2021. J. ASTM F3125/F3125M - Standard Specification for High Strength Structural Bolts and Assemblies, Steel and Alloy Steel, Heat Treated, Inch Dimensions 120 ksi and 150 ksi Minimum Tensile Strength, and Metric Dimensions 830 MPa and 1040 MPa Minimum Tensile Page 367 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 2 of 6 Strength 2022. K. AWS D1.1/D1.1M - Structural Welding Code - Steel 2020, with Errata (2022). L. SSPC-Paint 15 - Steel Joist Shop Primer/Metal Building Primer 2004. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Shop Drawings: Indicate profiles, sizes, connection attachments, reinforcing, anchorage, size and type of fasteners, and accessories. Include erection drawings, elevations, and details where applicable. C. Designer's Qualification Statement. PART 2 PRODUCTS 2.01 MATERIALS - STEEL A. Steel Sections: ASTM A36/A36M. B. Steel Tubing: ASTM A501/A501M hot-formed structural tubing. C. Plates: ASTM A283/A283M. D. Pipe: ASTM A53/A53M, Grade B Schedule 40, black finish. E. Mechanical Fasteners: Same material as or compatible with materials being fastened; type consistent with design and specified quality level. F. Bolts, Nuts, and Washers: ASTM A307, Grade A, plain. G. Bolts, Nuts, and Washers: ASTM F3125/F3125M, Type 1, plain. H. Welding Materials: AWS D1.1/D1.1M; type required for materials being welded. I. Shop and Touch-Up Primer: SSPC-Paint 15, complying with VOC limitations of authorities having jurisdiction. 2.02 MATERIALS - ALUMINUM A. Extruded Aluminum: ASTM B 221 (ASTM B 221M), 6063 alloy, T6 temper. B. Bolts, Nuts, and Washers: Stainless steel. 2.03 FABRICATION A. Fit and shop assemble items in largest practical sections, for delivery to site. Page 368 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 3 of 6 B. Fabricate items with joints tightly fitted and secured. C. Grind exposed joints flush and smooth with adjacent finish surface. Make exposed joints butt tight, flush, and hairline. Ease exposed edges to small uniform radius. D. Furnish components required for anchorage of fabrications. Fabricate anchors and related components of same material and finish as fabrication, except where specifically noted otherwise. 2.04 FABRICATED ITEMS A. Ventilation Screens: 1. Size: As indicated on the drawings 2. Thickness: As indicated on the drawings 3. Pattern: Custom cut pattern as designed by architect and fabricator 4. Finish: To match decorative steel light fixtures as manufactured by Steven Handelman Studios B. Steel roof overhang bracket: Steel pipe, angle, and plate as detailed on drawings 1. Size: As indicated on the drawings 2. Thickness: As indicated on the drawings 3. Pattern: Custom cut pattern as designed by architect and fabricator 4. Finish: To match decorative steel light fixtures as manufactured by Steven Handelman Studios C. Roof and fasia finials: Steel pipe, angle, and plate as detailed on drawings 1. Size: As indicated on the drawings 2. Thickness: As indicated on the drawings 3. Pattern: Custom cut pattern as designed by architect and fabricator 4. Finish: To match decorative steel light fixtures as manufactured by Steven Handelman Studios 2.05 DECORATIVE METAL HANDRAILS, FENCE AND BAR COUNTER A. Handrails 1. Material: Steel and bronze 2. Manufacturer: Julius Blum, www.juliusblum.com 3. Product Numbers: a. 4428 - Steel Handrail Moulding b. 4428SL & SR - Left and Right Junior Lateral Scroll c. 340 - Steel with Bronze Center Post d. 3/8"x1 1/4" flat bar per detail e. 481 - Round Hole Post Base f. 4428S-StraightLamb'sTounge 4. Finish: Shop primed and painted matte black with epoxy paint, Pro Insustrial Water Based Catalyzed Epoxy or approved equal. 5. Fabricator: Jeff Thies, Thiessen Design 805-547-1947 www.thiessendesign.com B. Fence and Planter Fence 1. Material: Steel and Bronze Page 369 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 4 of 6 2. Manufacturer: Julius Blum, www.juliusblum.com 3. Product Numbers: a. 340 - Steel with Bronze Center Post b. 337 - Steel and Bronze Spindle c. 481 - Round Hole Post Base d. 971 - Ornamental Valance e. 4428 - Steel Handrail Moulding including terminal, center and corner pieces with urn bases at posts f. 3/8"x1 1/4" flat bar per detail g. 3/4" steel bar h. 1/2" picket i. 1" O.D. x 1/4" steel post 4. Fabricator: Jeff Thies, Thiessen Design 805-547-1947 C. Bar Counter 1. Material: Steel 2. Components: As specified in the detail 3. Finish: Hot Dip Galvanized and painted matte black with epoxy paint. 4. Fabricator: Jeff Thies, Thiessen Design 805-547-1947 PART 3 EXECUTION 4.01 EXAMINATION A. Verify that field conditions are acceptable and are ready to receive work. 4.02 PREPARATION A. Clean and strip primed steel items to bare metal where site welding is required. 4.03 INSTALLATION A. Install items plumb and level, accurately fitted, free from distortion or defects. B. Provide for erection loads, and for sufficient temporary bracing to maintain true alignment until completion of erection and installation of permanent attachments. C. Perform field welding in accordance with AWS D1.1/D1.1M. D. Obtain approval prior to site cutting or making adjustments not scheduled. E. After erection, prime welds, abrasionsand surfaces not shop primed or galvanized , except surfaces to be in contact with concrete. F. Immediately after erection, clean field welds, bolted connections, and abraded areas of shop paint, and paint exposed areas with same material as used for shop painting. Apply or brush or spray to provide minimum dry film thickness of 0.051 mm (2.0 mils). Page 370 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 5 of 6 G. At all galvanized products, clean all damaged areas and re-coat using specified galvanizing coating per manufacturer's criteria. 4.04 TOLERANCES A. Maximum Variation From Plumb: 1/4 inch per story, non-cumulative. B. Maximum Offset From True Alignment: 1/4 inch. C. Maximum Out-of-Position: 1/4 inch. Page 371 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 05 5000 05-11-2023 05 5000 - Metal Fabrications Page 6 of 6 This page intentionally left blank Page 372 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 1300 05-11-2023 07 1300 - Sheet Waterproofing Page 1 of 4 Section 07 1300 Sheet Waterproofing PART 1 GENERAL 1.01 SECTION INCLUDES A. Self-adhered modified bituminous sheet membrane. 1.02 RELATED REQUIREMENTS A. Section 03 3000 - Cast-in-Place Concrete: Concrete substrate. 1.03 REFERENCE STANDARDS A. ASTM D412 - Standard Test Methods for Vulcanized Rubber and Thermoplastic Elastomers-- Tension 2016 (Reapproved 2021). B. ASTM D882 - Standard Test Method for Tensile Properties of Thin Plastic Sheeting 2018. C. ASTM D5385/D5385M - Standard Test Method for Hydrostatic Pressure Resistance of Waterproofing Membranes 2020. D. ASTM E96/E96M - Standard Test Methods for Gravimetric Determination of Water Vapor Transmission Rate of Materials 2022a, with Editorial Revision (2023). E. NRCA (WM) - The NRCA Waterproofing Manual 2021. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Provide data for membrane. C. Manufacturer's Installation Instructions: Indicate special procedures. D. Warranty: Submit manufacturer warranty and ensure forms have been completed in City's name and registered with manufacturer. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing products specified in this section, with not less than three years of documented experience. B. Installer Qualifications: Company specializing in performing work of the type specified and with at least three years of documented experience. 1.06 FIELD CONDITIONS Page 373 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 1300 05-11-2023 07 1300 - Sheet Waterproofing Page 2 of 4 A. Maintain ambient temperatures above 40 degrees F for 24 hours before and during application and until liquid or mastic accessories have cured. 1.07 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Contractor to correct defective Work within period of five years after Date of Substantial Completion; remove and replace materials concealing waterproofing at no extra cost to City. C. Provide five year manufacturer warranty for waterproofing failing to resist penetration of water, except where such failures are the result of structural failures of building. Hairline cracking of concrete due to temperature change or shrinkage is not considered a structural failure. PART 2 PRODUCTS 2.01 SHEET WATERPROOFING APPLICATIONS A. Self-Adhered Modified Bituminous Sheet Membrane: 1. Location: Back of site retaining walls. 2.02 SHEET WATERPROOFING MATERIALS A. Self-Adhered Modified Bituminous Sheet Membrane: 1. Thickness: 60 mil, 0.060 inch, minimum. 2. Sheet Width: 36 inches, minimum. 3. Tensile Strength: a. Film:5900 psi , minimum, measured in accordance with ASTM D882 and at grip- separation rate of 2 inches per minute. b. Membrane:460 psi, minimum, measured in accordance with ASTM D412 Method A, using die C and at spindle-separation rate of 2 inches per minute. 4. Elongation at Break: 300 percent, minimum, measured in accordance with ASTM D412. 5. Water Vapor Permeance:.036 perm, maximum, measured in accordance with ASTM E96/E96M. 6. Hydrostatic Pressure Resistance: Membrane resists leakage for at least one hour from pressure equivalent to 200 feet head of water applied in accordance with test method ASTM D5385/D5385M. 7. Adhesives, Sealants, Tapes, and Accessories: As recommended by membrane manufacturer. 8. Products: a. W.R. Meadows, Inc; MEL-ROL: www.wrmeadows.com/#sle. b. Substitutions: See Section 01 6000 - Product Requirements. 2.03 ACCESSORIES A. Waterproofing accessories for retaining walls shall be a complete system from the manufacturer of the membrane. B. Seaming Materials: As recommended by membrane manufacturer. Page 374 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 1300 05-11-2023 07 1300 - Sheet Waterproofing Page 3 of 4 C. Membrane Sealant: As recommended by membrane manufacturer. D. Sealant for Cracks and Joints In Substrates: Resilient elastomeric joint sealant compatible with substrates and waterproofing materials. E. Protection Board: Provide type capable of preventing damage to waterproofing due to backfilling and construction traffic. F. Drainage Panel: Drainage layer with geotextile filter fabric on earth side. 1. Composition: Dimpled polystyrene, polyethylene, or polypropylene core; polypropylene filter fabric. 2. Thickness:1/4 inch. a. Products: 1) W.R. Meadows, Inc; Mel-Drain 5012: www.wrmeadows.com/#sle. 2) Substitutions: See Section 01 6000 - Product Requirements. G. Flexible Flashings: Type recommended by membrane manufacturer. H. Adhesives: As recommended by membrane manufacturer. I. Additional sealnts and accessories as required by the manufacturer for a complete and watertight installation. PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions are acceptable prior to starting work. B. Verify substrate surfaces are durable; free of matter detrimental to adhesion or application of waterproofing system. C. Verify that items penetrating surfaces to receive waterproofing are securely installed. D. Do not proceed with work until unsatisfactory conditions have been corrected. 3.02 PREPARATION A. Protect adjacent surfaces from damage not designated to receive waterproofing. B. Clean and prepare surfaces to receive waterproofing in accordance with manufacturer's instructions; vacuum substrate clean. C. Do not apply waterproofing to surfaces unacceptable to membrane manufacturer. D. Surfaces for Adhesive Bonding: Apply surface conditioner at a rate recommended by manufacturer, and protect conditioner from rain or frost until dry. 3.03 INSTALLATION - MEMBRANE Page 375 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 1300 05-11-2023 07 1300 - Sheet Waterproofing Page 4 of 4 A. Install membrane waterproofing in accordance with manufacturer's instructions and NRCA (WM) applicable requirements. B. Roll out membrane, and minimize wrinkles and bubbles. C. Self-Adhering Membrane: Remove release paper layer, and roll out onto substrate with a mechanical roller to provide full contact bond. D. Overlap edges and ends, minimum 3 inches, seal permanently waterproof by method recommended by manufacturer, and apply uniform bead of sealant to joint edge. E. Reinforce membrane with multiple thickness of membrane material over joints, whether joints are static or dynamic. F. Weather lap joints on sloped substrate in direction of drainage, and seal joints and seams. G. Flexible Flashings: Seal items watertight that penetrate through waterproofing membrane with flexible flashings. H. Seal membrane and flashings to adjoining surfaces. 3.04 INSTALLATION - DRAINAGE PANEL and PROTECTION BOARD A. Place drainage panel directly against membrane, butt joints, place to encourage drainage downward; scribe and cut boards around projections, penetrations, and interruptions. B. Place protection board directly against drainage panel; butt joints, and scribe and cut boards around projections, penetrations, and interruptions. C. Adhere protection board to substrate with compatible adhesive. 3.05 PROTECTION A. Do not permit traffic over unprotected or uncovered membrane. END OF SECTION Page 376 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 2500 05-11-2023 07 2500 - Weather Barriers Page 1 of 4 Section 07 2500 Weather Barriers PART 1 GENERAL 1.01 SECTION INCLUDES A. Water-resistive barriers. 1.02 RELATED REQUIREMENTS A. Section 07 6200 - Sheet Metal Flashing and Trim: Metal flashings installed in conjunction with weather barriers. B. Section 09 2236 - Lath: Second layer weather barrier installed as part of lath 1.03 DEFINITIONS A. Weather Barriers: Assemblies that form either water-resistive barriers, air barriers, or vapor retarders. B. Water-Resistive Barrier: A material behind an exterior wall covering that is intended to resist liquid water that has penetrated behind the exterior covering from further intruding into the exterior wall assembly. 1.04 REFERENCE STANDARDS A. ASTM D779 - Standard Test Method for Water Resistance of Paper, Paperboard, and Other Sheet Materials by the Dry Indicator Method; 2003. B. ASTM D1970/D1970M - Standard Specification for Self-Adhering Polymer Modified Bituminous Sheet Materials Used as Steep Roofing Underlayment for Ice Dam Protection 2021. C. ASTM E84 - Standard Test Method for Surface Burning Characteristics of Building Materials 2023. D. ASTM E96/E96M - Standard Test Methods for Gravimetric Determination of Water Vapor Transmission Rate of Materials 2022a, with Editorial Revision (2023). E. ASTM E2178 - Standard Test Method for Determining Air Leakage Rate and Calculation of Air Permeance of Building Materials 2021a. F. ASTM E2273 - Standard Test Method for Determining the Drainage Efficiency of Exterior Insulation and Finish Systems (EIFS) Clad Wall Assemblies 2018. G. ICC-ES AC38 - Acceptance Criteria for Water-Resistive Barriers 2016, with Editorial Revision (2019). Page 377 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 2500 05-11-2023 07 2500 - Weather Barriers Page 2 of 4 1.05 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Provide data on material characteristics. C. Manufacturer's Installation Instructions: Indicate preparation, installation methods, and storage and handling criteria. 1.06 MOCK-UPS A. Construct weather barrier mock-up, 10 feet long by 10 feet wide, indicating instalation at penetrations, top of wall, and base of wall.. B. Locate where directed. C. Mock-up may remain as part of work. 1.07 FIELD CONDITIONS A. Maintain temperature and humidity recommended by materials manufacturers before, during, and after installation. PART 2 PRODUCTS 2.01 WATER-RESISTIVE BARRIER MATERIALS A. Drainable Barrier Sheet: Multi-layer nonwoven and nonperforated polpropylene with rain screen matrix bonded on back side. 1. Width: 4.4 feet, minimum. 2. Water Vapor Permeance: 19 perms, minimum, when tested in accordance with ASTM E96/E96M using Procedure A - Desiccant Method, at 73.4 degrees F. 3. Ultraviolet (UV) and Weathering Resistance: Approved by manufacturer for up to 180 days of weather exposure. 4. Drainage gap: 3 mm minumum passing ASTM E2273 5. Products: a. VaproShield: WrapShield RS: vaproshield.com - Basis of Design b. Tamlyn; TamlynWrap Rain Screen 6.3: www.tamlyn.com c. Substitutions: See Section 01 6000 - Product Requirements. 2.02 ACCESSORIES A. Sealants, Tapes, and Accessories Used for Sealing Water-Resistive Barrier and Adjacent Substrates: As indicated or complying with water-resistive barrier manufacturer's installation instructions. B. Flexible Flashing: Self-adhesive sheet flashing complying with ASTM D1970/D1970M, except slip resistance requirement is waived if not installed on a roof. 1. Width: 4 inches. Page 378 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 2500 05-11-2023 07 2500 - Weather Barriers Page 3 of 4 C. Thinners and Cleaners: As recommended by water-resistive barrier manufacturer. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that surfaces and conditions comply with requirements of this section. 3.02 PREPARATION A. Remove projections, protruding fasteners, and loose or foreign matter that might interfere with proper installation. B. Clean and prime substrate surfaces to receive adhesives and sealants in accordance with manufacturer's installation instructions. 3.03 INSTALLATION A. Install materials in accordance with manufacturer's installation instructions. B. Water-Resistive Barriers: Install continuous water-resistive barrier over surfaces indicated, with sheets lapped to shed water but with seams not sealed. C. Air Barriers: Install continuous air tight barrier over surfaces indicated, with sealed seams and with sealed joints to adjacent surfaces. 1. Seal joint between slab or curb and wall above. D. Mechanically Fastened Exterior Sheets: 1. Install sheets shingle-fashion to shed water, with seams aligned horizontal. 2. Overlap seams as recommended by manufacturer, 6 inches, minimum. 3. Overlap at outside and inside corners as recommended by manufacturer, 12 inches, minimum. 4. Attach to framed construction with fasteners extending through sheathing into framing, and space fasteners at 12 to 18 inches on center along each framing member supporting sheathing. 5. For applications indicated to be airtight, seal seams, laps, penetrations, tears, and cuts with self-adhesive tape; use only large-headed, gasketed fasteners as recommended by manufacturer. 6. Install water-resistive barrier over jamb flashings. 7. Install head flashings under water-resistive barrier. 8. At framed openings with frames having nailing flanges, extend sheet into opening and over flanges; at head of opening, seal sheet over flange and flashing. E. Openings and Penetrations in Exterior Water-Resistive Barriers: 1. Install flashing over sills, covering entire sill framing member, and extend at least 5 inches onto water-resistive barrier and at least 6 inches up jambs; mechanically fasten stretched edges. 2. At openings filled with frames having nailing flanges, seal head and jamb flanges using a continuous bead of sealant compressed by flange and cover flanges with sealing tape at Page 379 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 2500 05-11-2023 07 2500 - Weather Barriers Page 4 of 4 least 4 inches wide; do not seal sill flange. 3. At openings filled with nonflanged frames, seal water-resistive barrier to each side of framing at opening using flashing at least 9 inches wide, and covering entire depth of framing. 4. At head of openings, install flashing under water-resistive barrier extending at least 2 inches beyond face of jambs; seal water-resistive barrier to flashing. 5. At interior face of openings, seal gaps between window and door frames and rough framing using appropriate joint sealant over backer rod. 6. Service and Other Penetrations: Form flashing around penetrating items and seal to surface of water-resistive barrier. 3.04 FIELD QUALITY CONTROL A. See Section 01 4000 - Quality Requirements for additional requirements. B. City¶s Inspection and Testing: Cooperate with City¶s testing agency. 1. Allow access to work areas and staging. 2. Notify City¶s testing agency in writing of schedule for work of this section to allow sufficient time for testing and inspection. 3. Do not cover work of this section until testing and inspection is accepted. C. Do not cover installed water-resistive barriers until required inspections have been completed. D. Take digital photographs of each portion of installation prior to covering up weather barriers. 3.05 PROTECTION A. Do not leave materials exposed to weather longer than recommended by manufacturer. END OF SECTION Page 380 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 1 of 6 Section 07 4113 Metal Roof Panels PART 1 GENERAL 1.01 SECTION INCLUDES A. Metal roof panel system of preformed steel panels. 1.02 RELATED REQUIREMENTS A. Section 05 1200 - Structural Steel Framing: Roof framing and purlins. B. Section 05 4000 - Cold-Formed Metal Framing: Roof Framing C. Section 06 1000 - Rough Carpentry: Roof sheathing. D. Section 07 9200 - Joint Sealants: Sealing joints between metal roof panel system and adjacent construction. 1.03 REFERENCE STANDARDS A. AAMA 2605 - Voluntary Specification, Performance Requirements and Test Procedures for Superior Performing Organic Coatings on Aluminum Extrusions and Panels (with Coil Coating Appendix) 2022. B. ASTM A792/A792M - Standard Specification for Steel Sheet, 55% Aluminum-Zinc Alloy- Coated by the Hot-Dip Process 2022. C. ASTM D1970/D1970M - Standard Specification for Self-Adhering Polymer Modified Bituminous Sheet Materials Used as Steep Roofing Underlayment for Ice Dam Protection 2021. D. ASTM D5147/D5147M - Standard Test Methods for Sampling and Testing Modified Bituminous Sheet Material 2018. E. ASTM E96/E96M - Standard Test Methods for Gravimetric Determination of Water Vapor Transmission Rate of Materials 2022a, with Editorial Revision (2023). F. ASTM E1592 - Standard Test Method for Structural Performance of Sheet Metal Roof and Siding Systems by Uniform Static Air Pressure Difference 2005 (Reapproved 2017). 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Manufacturer's data sheets on each product to be used, including: 1. Summary of test results, indicating compliance with specified requirements. 2. Storage and handling requirements and recommendations. 3. Installation methods. Page 381 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 2 of 6 4. Specimen warranty. C. Shop Drawings: Include layouts of roof panels, details of edge and penetration conditions, spacing and type of connections, flashings, underlayments, and special conditions. 1. Show work to be field-fabricated or field-assembled. D. Verification Samples: For each roofing system specified, submit samples of minimum size 12 inches square, representing actual roofing metal, thickness, profile, color, and texture. E. Test Reports: Indicate compliance of metal roofing system to specified requirements. F. Warranty: Submit specified manufacturer's warranty and ensure that forms have been completed in City's name and are registered with manufacturer. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing products specified in this section, with not less than 10 years of documented experience. B. Panel manufacturers without full supporting literature, Flashings & Details Guides, Guide Specifications and Technical Support shall not be considered equal to the specified product. C. Installer Qualifications: Company specializing in performing work of the type specified and with at least 5 years of documented experience or certified by the manufacturer. 1.06 REGULATORY AGENCY REQUIREMENTS A. Comply with CBC and local Building Code requirements if more restrictive than those specified herein. 1.07 DELIVERY, STORAGE, AND HANDLING A. Provide strippable plastic protection on prefinished roofing panels for removal after installation. 1.08 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Finish Warranty: Provide manufacturer's special warranty covering failure of factory-applied exterior finish on metal roof panels and agreeing to repair or replace panels that show evidence of finish degradation, including significant fading, chalking, cracking, or peeling within specified warranty period of ten years from Date of Substantial Completion. C. Waterproofing Warranty: Provide manufacturer's warranty for weathertightness of roofing system, including agreement to repair or replace roofing that fails to keep out water within specified warranty period of 10 years from Date of Substantial Completion. PART 2 PRODUCTS 2.01 MANUFACTURERS Page 382 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 3 of 6 A. Architectural Metal Roof Panel Manufacturers: 1. Metal Sales Manufacturing Corporation: Vertical Seam https://www.metalsales.us.com/. 2. Substitutions: See Section 01 6000 - Product Requirements. 2.02 PERFORMANCE REQUIREMENTS A. Metal Roof Panels: Provide complete roofing assemblies, including roof panels, clips, fasteners, connectors, and miscellaneous accessories, tested for compliance with the following minimum standards: 1. Structural Design Criteria: Provide panel assemblies designed to safely support design loads at support spacing indicated, with deflection not to exceed L/180 of span length(L) when tested in accordance with ASTM E1592. 2. Overall: Complete weathertight system tested and approved in accordance with ASTM E1592. 3. Thermal Movement: Design system to accommodate without deformation anticipated thermal movement over ambient temperature range of 100 degrees F. 2.03 METAL ROOF PANELS A. Metal Roof Panels: Provide complete engineered system complying with specified requirements and capable of remaining weathertight while withstanding anticipated movement of substrate and thermally induced movement of roofing system. B. Metal Panels: Factory-formed panels with factory-applied finish. 1. Steel Panels: a. Aluminum-zinc alloy-coated steel complying with ASTM A792/A792M; minimum AZ50 coating. b. Steel Thickness: Minimum 24 gauge, 0.024 inch. 2. Profile: Standing seam, with minimum 1.75 inch seam height; concealed fastener system for field seaming with special tool. 3. Texture:Striated. 4. Length: Maximum possible length to minimize lapped joints. Where lapped joints are unavoidable, space laps so that each sheet spans over three or more supports. 5. Width: Maximum panel coverage of 12 inches. 6. Color: Weathered Copper W50. 2.04 ATTACHMENT SYSTEM A. Concealed System: Provide manufacturer's standard stainless steel or nylon-coated aluminum concealed anchor clips designed for specific roofing system and engineered to meet performance requirements, including anticipated thermal movement. 2.05 FINISHES A. Fluoropolymer Coil Coating System: Polyvinylidene fluoride (PVDF) multi-coat superior performing organic coatings system complying with AAMA 2605, including at least 70 percent PVDF resin, and at least 80 percent of coil coated metal surfaces having minimum total dry film thickness (DFT) of 0.9 mil, 0.0009 inch; color and gloss as selected by Architect from manufacturer¶s standard line as noted abo Page 383 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 4 of 6 2.06 ACCESSORIES A. Miscellaneous Sheet Metal Items: Provide flashings, gutters, downspouts, trim, moldings, closure strips, preformed crickets, caps, and equipment curbs of the same material, thickness, and finish as used for the roofing panels. Items completely concealed after installation may optionally be made of stainless steel. B. Rib and Ridge Closures: Provide prefabricated, close-fitting components of steel with corrosion resistant finish or combination steel and closed-cell foam. C. Sealants: 1. Exposed Sealant: Elastomeric; silicone, polyurethane, or silyl-terminated polyether/polyurethane. 2. Concealed Sealant: Non-curing butyl sealant or tape sealant. 2.07 SHEET MATERIALS A. Location 1. Field: One layer of ashpaltic underlayment. 2. Crickets, valleys, headwall flashing, sidewall flasing and roof penetraions: Self-adhering rubber modified asphalt B. Underlayment: Self-adhering polymer modified asphalt sheet complying with ASTM D1970/D1970M, with strippable release film and top surface of woven polypropylene sheet. 1. Sheet Thickness:80 mil, 0.080 inch minimum total thickness. 2. Self Sealability: Nail sealability in accordance with ASTM D5147/D5147M 3. Water Vapor Permeance: 0.1 perm, maximum, when tested in accordance with ASTM E96/E96M using Desiccant Method (Method A). 4. UL Class A Rated when tested in accordance with UL 790 5. Products: a. Polyglass USA, Inc; Polystick XFR, Fire Resistant Self-Adhered Roof Underlayment: www.polyglass.us/#sle. b. Substitutions: See Section 01 6000 - Product Requirements. PART 3 EXECUTION 3.01 EXAMINATION A. Do not begin installation of preformed metal roof panels until substrates have been properly prepared. B. If substrate preparation is the responsibility of another installer, notify Architect of unsatisfactory preparation before proceeding. 3.02 PREPARATION A. Broom clean sheathing prior to installation of roofing system. Page 384 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 5 of 6 B. Coordinate roofing work with provisions for roof drainage, flashing, trim, penetrations, and other adjoining work to ensure that completed roof will be free of leaks. C. Coordinate installation of waterproof membrane over roof sheathing with Section 06 1000. D. Remove protective film from surface of roof panels immediately prior to installation; strip film carefully to avoid damage to prefinished surfaces. E. Separate dissimilar metals by applying a bituminous coating, self-adhering rubberized asphalt sheet, or other permanent method approved by metal roof panel manufacturer. F. At locations where metal will be in contact with wood or other absorbent material subject to wetting, seal joints with sealing compound and apply one coat of heavy-bodied bituminous paint. 3.03 INSTALLATION A. Overall: Install roofing system in accordance with approved shop drawings and metal roof panel manufacturer's instructions and recommendations, as applicable to specific project conditions; securely anchor components of roofing system in place allowing for thermal and structural movement. 1. Install roofing system with concealed clips and fasteners, except as otherwise recommended by manufacturer for specific circumstances. 2. Minimize field cutting of panels. Where field cutting is required, use methods that will not distort panel profiles. Use of torches for field cutting is prohibited. B. Accessories: Install necessary components that are required for complete roofing assembly, including flashings, gutters, downspouts, trim, moldings, closure strips, preformed crickets, caps, equipment curbs, rib closures, ridge closures, and similar roof accessory items. C. Roof Panels: Install metal roof panels in accordance with manufacturer's installation instructions, minimizing transverse joints except at junction with penetrations. 3.04 CLEANING A. Clean exposed sheet metal work at completion of installation. Remove grease and oil films, excess joint sealer, handling marks, and debris from installation, leaving the work clean and unmarked, free from dents, creases, waves, scratch marks, or other damage to the finish. 3.05 PROTECTION A. Do not permit storage of materials or roof traffic on installed roof panels. Provide temporary walkways or planks as necessary to avoid damage to completed work. Protect roofing until completion of project. B. Touch-up, repair, or replace damaged roof panels or accessories before Date of Substantial Completion. END OF SECTION Page 385 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4113 05-11-2023 07 4113 - Metal Roof Panels Page 6 of 6 This page intentionally left blank Page 386 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 1 of 6 Section 07 4213 Metal Wall Panels PART 1 GENERAL 1.01 SECTION INCLUDES A. Manufactured metal panels for exterior wall panels, soffit panels, and subgirt framing assembly, with related flashings and accessory components. 1.02 RELATED REQUIREMENTS A. Section 07 2500 - Weather Barriers: Water-resistive barrier under wall panels. B. Section 07 9200 - Joint Sealants: Sealing joints between metal wall panel system and adjacent construction. 1.03 REFERENCE STANDARDS A. AAMA 2605 - Voluntary Specification, Performance Requirements and Test Procedures for Superior Performing Organic Coatings on Aluminum Extrusions and Panels (with Coil Coating Appendix) 2022. B. ASTM B209/B209M - Standard Specification for Aluminum and Aluminum-Alloy Sheet and Plate 2021a. 1.04 SUBMITTALS A. Product Data - Wall System: Manufacturer's data sheets on each product to be used, including: 1. Physical characteristics of components shown on shop drawings. 2. Storage and handling requirements and recommendations. 3. Installation instructions and recommendations. B. Shop Drawings: Indicate dimensions, layout, joints, construction details, support clips, and methods of anchorage. C. Samples: Submit two samples of wall panel and soffit panel, 12 inches by 12 inches in size illustrating finish color, sheen, embossing, and texture. D. Manufacturer's qualification statement. E. Installer's qualification statement. F. Warranty Documentation for Installation of Building Rainscreen Assembly: Submit installer warranty and ensure that forms have been completed in City's name and registered with installer. 1.05 MOCK-UPS Page 387 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 2 of 6 A. Construct mock-up, 4 feet long by 4 feet wide; include panel and soffit system, glazing, attachments to building frame, associated vapor retarder and air seal materials, weep drainage system, sealants and seals, and related insulation in mock-up. B. Locate as directed by Architect. C. Mock-up may remain as part of work. 1.06 DELIVERY, STORAGE, AND HANDLING A. Protect panels from accelerated weathering by removing or venting sheet plastic shipping wrap. B. Store prefinished material off the ground and protected from weather; prevent twisting, bending, or abrasion; provide ventilation; slope metal sheets to ensure proper drainage. C. Prevent contact with materials that may cause discoloration or staining of products. 1.07 FIELD CONDITIONS A. Do not install wall panels when air temperature or relative humidity are outside manufacturer's limits. 1.08 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Finish Warranty: Provide 5-year manufacturer warranty against excessive degradation of exterior finish. Include provision for replacement of units with excessive fading, chalking, or flaking. Complete forms in City's name and register with warrantor. C. Special Warranty: Provide 2-year warranty covering water tightness and integrity of seals of metal wall panels. Complete forms in City's name and register with warrantor. D. Installation Warranty for Building Rainscreen Assembly: Installer of exterior rainscreen assembly (including air/vapor barrier and attachments, framing, and exterior panels) to provide 10-year warranty that includes coverage for defective materials and/or workmanship. This warranty will also clearly include materials, labor, necessary activity to access these areas, and removal of any materials to effect repairs and restore to watertight conditions. www.edacontractors.com/#sle PART 2 PRODUCTS 2.01 MANUFACTURERS A. Metal Wall Panels - Concealed Fasteners: 1. D. Architectural Metal Solutions Incorporated; Aluminum Plate Rainscreen System ± Series CPRS: https://damsinc.com/. 2. Substitutions: See Section 01 6000 - Product Requirements. Page 388 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 3 of 6 B. Metal Soffit Panels: 1. Longboard Architectural Products; Tongue and Groove Soffit V-Groove. 2. Substitutions: See Section 01 6000 - Product Requirements. 2.02 METAL WALL PANEL SYSTEM A. Wall Panel System: Factory fabricated prefinished metal panel system, site assembled. 1. Provide exterior wall panels and subgirt framing assembly. 2. Design and size components to support assembly dead loads, and to withstand live loads caused by positive and negative wind pressure acting normal to plane of wall. 3. Maximum Allowable Deflection of Panel: L/180 for length(L) of span. 4. Movement: Accommodate movement within system without damage to components or deterioration of seals, movement between system and perimeter components when subject to seasonal temperature cycling; dynamic loading and release of loads; and deflection of structural support framing. 5. Drainage: Provide positive drainage to exterior for moisture entering or condensation occurring within panel system. 6. Fabrication: Formed true to shape, accurate in size, square, and free from distortion or defects; pieces of longest practical lengths. 7. Corners: Factory-fabricated in one continuous piece with minimum 4-inch returns. B. Exterior Wall Panels: 1. Profile:Vertical and horizontal, as indicated; style as indicated. 2. Side Seams:Double-interlocked with reveal, rainscreen system. 3. Material: Precoated aluminum sheet, 8 gauge, .125 inch minimum thickness. 4. Panel Width: As indicated on the drawings. 5. Panel Depth: 2 inch , Manufacturer Standard C. Soffit Panels: 1. Profile: 4 inch V-Groove, with venting not provided. 2. Material: Precoated aluminum sheet, 16 gauge, .0625 inch minimum thickness. 3. Color: As selected by Architect from manufacturer's standard line. a. Color: Dark Fir, DFR 4. Accesories: as required by manufacturer for complete installation D. Subgirt Framing Assembly: 1. Manufacturer's standard profile; to attach panel systems to building. E. Internal and External Corners: Same material, thickness, and finish as exterior sheets; profile to suit system; shop cut and factory mitered to required angles. F. Trim: Same material, thickness and finish as exterior sheets; brake formed to required profiles. G. Anchors: Galvanized steel or as recommended by manufacturer for substrate. 2.03 MATERIALS A. Wall Panels: Non-Precoated Aluminum Sheet: ASTM B209/B209M, 3003 alloy, with temper as required, with smooth surface, mill finish, or as otherwise recommended by metal producer for required finish. Page 389 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 4 of 6 1. Thickness: 0.125 inch, minimum. B. Soffit Panels: Non-Precoated Aluminum Sheet: ASTM B209/B209M, 6063 alloy, T5 temper as required, with smooth surface, mill finish, or as otherwise recommended by metal producer for required finish. 2.04 FINISHES A. Wall Panels: Fluoropolymer Coil Coating System: Polyvinylidene fluoride (PVDF) multi-coat superior performing organic coatings system complying with AAMA 2605, including at least 70 percent PVDF resin, and at least 80 percent of coil coated metal surfaces having minimum total dry film thickness (DFT) of 0.9 mil, 0.0009 inch; color and gloss as selected by Architect from manufacturer¶s full line: Basis. 1. Products: a. PPG; Duranar: www.ppgmetalcoatings.com/#sle. 1) Basis of Design: Earthtone UC124848 B. Soffit Panels Fluoroethylene Vinyl Ether (FEVE) Coating: Superior performing resin based organic powder coatings system complying with AAMA 2605; single coat applications when applied to aluminum with dry film thickness (DFT) of 2 to 3 mil, 0.002 to 0.003 inch; color and gloss as scheduled. 1. Apply coating to exposed metal surfaces with proper preparation and pretreatment in accordance with resin manufacturer's instructions. 2.05 ACCESSORIES A. Fasteners: Manufacturer's standard type to suit application; with soft neoprene washers, steel, hot dip galvanized. Fastener cap same color as exterior panel. 1. Metal-to-Metal Fasteners: Self-drilling, self-tapping screws. B. Field Touch-up Paint: As recommended by panel manufacturer. C. Bituminous Paint: Asphalt base. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that building framing members are ready to receive panels. B. Verify that water-resistive barrier, see Section 07 2500, has been properly installed over substrate; see Section 05 4000. 3.02 FABRICATION A. Fabricate and finish aluminum plate wall panels and accessories at the factory to greatest extent possible, by manufacturer's standard procedures and processes, as necessary to fulfill indicated performance requirements demonstrated by laboratory testing. Comply with indicated profiles and with dimensional and structural requirements. Page 390 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 5 of 6 1. Fabricate aluminum plate wall panels in a manner that shall eliminate condensation on interior side of panel and with joints between panels designed to form rain screen type seals. 2. Back routed panel lines, edges to be sharp and true, with surfaces free from warp and buckle. 3. Fabricate panels with sharply cut edges, with no displacement of face sheets. 4. Fabricate panels with panel stiffeners, as required to comply with deflection limits, attached to back of panels with structural adhesive sealant or bond tape. 5. Max radius of Edge = 1/8 3.03 PREPARATION A. Install subgirts perpendicular and parallel to panel length, securely fastened to substrates and shimmed and leveled to uniform plane, and spaced at intervals indicated by manufacturer. B. Protect surrounding areas and adjacent surfaces from damage during execution of this work. 3.04 INSTALLATION A. Install panels on walls in accordance with manufacturer's instructions. B. Protect surfaces in contact with cementitious materials and dissimilar metals with bituminous paint; allow to dry prior to wall panel installation. C. Fasten panels to structural supports; aligned, level, and plumb. D. Provide expansion and control joints where indicated. E. Use concealed fasteners unless otherwise indicated by Architect. 3.05 TOLERANCES A. Offset From True Alignment Between Adjacent Members Abutting or In Line: 1/16 inch, maximum. B. Variation from Plane or Location As Indicated on Drawings: 1/4 inch, maximum. 3.06 CLEANING A. Remove site cuttings from finish surfaces. B. Remove protective material from wall panel surfaces. C. Clean and wash prefinished surfaces with mild soap and water; rinse with clean water. 3.07 PROTECTION A. Protect metal wall panels until completion of project. B. Touch-up, repair, or replace damaged wall panels or accessories before Date of Substantial Completion. Page 391 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 4213 05-11-2023 07 4213 - Metal Wall Panels Page 6 of 6 END OF SECTION Page 392 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 6200 05-11-2023 07 6200 - Sheet Metal Flashing and Trim Page 1 of 4 Section 07 6200 Sheet Metal Flashing and Trim PART 1 GENERAL 1.01 SECTION INCLUDES A. Fabricated sheet metal items, including flashings, counterflashings, gutters, downspouts, sheet metal roofing, exterior penetrations, and other items indicated in Schedule. 1.02 RELATED REQUIREMENTS A. Section 04 2000 - Unit Masonry: Metal flashings embedded in masonry. B. Section 04 2613 - Masonry Veneer C. Section 05 4000 - Cold-Formed Metal Framing D. Section 07 7123 - Manufactured Gutters and Downspouts. E. Section 07 9200 - Joint Sealants: Sealing non-lap joints between sheet metal fabrications and adjacent construction. F. Section 08 6200 - Unit Skylights: Integral metal curbs. G. Section 09 9000 - Painting and Coating: Field painting. 1.03 REFERENCE STANDARDS A. AAMA 2605 - Voluntary Specification, Performance Requirements and Test Procedures for Superior Performing Organic Coatings on Aluminum Extrusions and Panels (with Coil Coating Appendix) 2022. B. ASTM A653/A653M - Standard Specification for Steel Sheet, Zinc-Coated (Galvanized) or Zinc-Iron Alloy-Coated (Galvannealed) by the Hot-Dip Process 2022. C. ASTM B32 - Standard Specification for Solder Metal 2020. D. ASTM B209/B209M - Standard Specification for Aluminum and Aluminum-Alloy Sheet and Plate 2021a. E. CDA A4050 - Copper in Architecture - Handbook current edition. F. SMACNA (ASMM) - Architectural Sheet Metal Manual 2012. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. Page 393 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 6200 05-11-2023 07 6200 - Sheet Metal Flashing and Trim Page 2 of 4 B. Shop Drawings: Indicate material profile, jointing pattern, jointing details, fastening methods, flashings, terminations, and installation details. 1.05 QUALITY ASSURANCE A. Perform work in accordance with SMACNA (ASMM) and CDA A4050 requirements and standard details, except as otherwise indicated. B. Maintain one copy of each document on site. C. Fabricator and Installer Qualifications: Company specializing in sheet metal work with 3 years of documented experience. 1.06 DELIVERY, STORAGE, AND HANDLING A. Stack material to prevent twisting, bending, and abrasion, and to provide ventilation. Slope metal sheets to ensure drainage. B. Prevent contact with materials that could cause discoloration or staining. PART 2 PRODUCTS 2.01 SHEET MATERIALS A. Galvanized Steel: ASTM A653/A653M, with G90/Z275 zinc coating; minimum 24-gauge, 0.0239-inch thick base metal. B. Pre-Finished Galvanized Steel: ASTM A653/A653M, with G90/Z275 zinc coating; minimum 24-gauge, 0.0239-inch thick base metal, shop pre-coated with manufacturer's coating. 1. Aluminum-zinc alloy-coated steel complying with ASTM A792/A792M; minimum AZ50 coating. 2. Color: As selected by Architect from manufacturer's custom colors. a. Flashing directly contacting roofing to be flashed with metal by roofing manufacture to match roofing material. b. Basis of Design: Weathered Copper W50 by Metal Sales c. Basis of Design Accent Color: Bronze C. Pre-Finished Aluminum: ASTM B209/B209M, 3005 alloy, H12 or H14 temper; 18 gauge, 0.040 inch thick; plain finish shop pre-coated with PVDF coating. 1. Polyvinylidene Fluoride (PVDF) Coating: Superior performing organic powder coating, AAMA 2605; pretreated metal with two-coat system including primer and color coat with at least 70 percent PVDF coating. 2. Color: As selected by Architect from manufacturer's custom colors. a. Flashing directly contacting wall panels to be flashed with metal to match wall panel material. 1) Basis of Design: Duranar; Earthtone UC12484 by PPG; www.ppgmetalcoatings.com Page 394 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 6200 05-11-2023 07 6200 - Sheet Metal Flashing and Trim Page 3 of 4 D. Note: Flashing directly contacting roofing to be flashed with metal by roofing manufacture to match roofing material. 2.02 ACCESSORIES A. Sealant: Type specified in Section 09 7200. 2.03 FABRICATION A. Form sections true to shape, accurate in size, square, and free from distortion or defects. B. Form pieces in longest possible lengths. C. Hem exposed edges on underside 1/2 inch; miter and seam corners. D. Form material with flat lock seams, except where otherwise indicated; at moving joints, use sealed lapped, bayonet-type or interlocking hooked seams. E. Fabricate corners from one piece with minimum 12-inch long legs; seam for rigidity, seal with sealant. F. Fabricate vertical faces with bottom edge formed outward as requied by the condition and hemmed to form drip. G. Fabricate flashings to allow toe to extend 4 inches over roofing -. Return and brake edges. PART 3 EXECUTION 3.01 EXAMINATION A. Verify roof openings, curbs, pipes, sleeves, ducts, and vents through roof are solidly set, reglets in place, and nailing strips located. B. Verify roofing termination and base flashings are in place, sealed, and secure. C. In the event of a discrepancy, immediately notify the Architect. 3.02 PREPARATION A. Install starter and edge strips, and cleats before starting installation. B. Install surface mounted reglets true to lines and levels, and seal top of reglets with sealant. C. Back paint concealed metal surfaces with protective backing paint to a minimum dry film thickness of 15 mil, 0.015 inch. 3.03 INSTALLATION Page 395 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 6200 05-11-2023 07 6200 - Sheet Metal Flashing and Trim Page 4 of 4 A. Secure flashings in place using concealed fasteners, and use exposed fasteners only where permitted.. B. Apply plastic cement compound between metal flashings and felt flashings. C. Fit flashings tight in place; make corners square, surfaces true and straight in planes, and lines accurate to profiles. END OF SECTION Page 396 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 7123 05-11-2023 07 7123 - Manufactured Gutters and Downspouts Page 1 of 4 Section 07 7123 Manufactured Gutters and Downspouts PART 1 GENERAL 1.01 SECTION INCLUDES A. Pre-finished galvanized steel gutters and downspouts. B. Precast concrete splash pads. 1.02 RELATED REQUIREMENTS A. Section B. Section 07 4113 - Metal Roof Panels C. Section 07 6200 - Sheet Metal Flashing and Trim. D. Section 22 0000 - Plumbing 1.03 REFERENCE STANDARDS A. ASTM A653/A653M - Standard Specification for Steel Sheet, Zinc-Coated (Galvanized) or Zinc-Iron Alloy-Coated (Galvannealed) by the Hot-Dip Process 2022. B. SMACNA (ASMM) - Architectural Sheet Metal Manual 2012. 1.04 ADMINISTRATIVE REQUIREMENTS A. Comply with SMACNA (ASMM) for sizing components for rainfall intensity determined by a storm occurrence of 1 in 5 years. 1.05 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Shop Drawings: Indicate locations, configurations, jointing methods, fastening methods, locations, and installation details. C. Samples: Submit two samples, 12 inch long, illustrating component design, finish, color, and configuration. 1.06 DELIVERY, STORAGE, AND HANDLING A. Stack material to prevent twisting, bending, or abrasion, and to provide ventilation. Slope to drain. Page 397 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 7123 05-11-2023 07 7123 - Manufactured Gutters and Downspouts Page 2 of 4 B. Prevent contact with materials that could cause discoloration, staining, or damage. 1.07 PROJECT CONDITIONS A. Coordinate the work with downspout discharge pipe inlet. PART 2 PRODUCTS 2.01 MATERIALS A. Factory-formed steel with factory-applied finish. 1. Aluminum-zinc alloy-coated steel complying with ASTM A792/A792M; minimum AZ50 coating. 2. Color: As selected by Architect from manufacturer's custom colors. a. Basis of Design: Weathered Copper W50 by Metal Sales 2.02 COMPONENTS A. Gutters:Profile as indicated. B. Downspouts: CDA rectangular profile SMACNA rectangular profile . C. Anchors and Supports: Profiled to suit gutters and downspouts. 1. To match existing 2. Anchoring Devices:In accordance with SMACNA requirements. 3. Gutter Supports: Brackets. 4. Downspout Supports: Brackets. 2.03 ACCESSORIES A. Splash Pads: Precast concrete type, cast 12 by 24 by 3 inches; minimum 3,000 psi compressive strength at 28 days, with minimum 5 percent air entrainment. B. Strainer Guard: Install "K-Style" strainer-guard at formed gutters, removable for cleaning. C. Downspout Nozzle: Cow's tounge style, polished bronze PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions before starting work. B. Verify that surfaces are ready to receive work. 3.02 PREPARATION Page 398 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 7123 05-11-2023 07 7123 - Manufactured Gutters and Downspouts Page 3 of 4 A. Paint concealed sheet metal surfaces and surfaces in contact with dissimilar metals with protective backing paint to a minimum dry film thickness of 15 mil, 0.015 inch. 3.03 INSTALLATION A. Install gutters, downspouts, and accessories in accordance with manufacturer's instructions. B. Sheet Metal: Join lengths with formed seams sealed watertight. Flash and seal gutters to downspouts and accessories. C. Slope gutters 1/16 inch per foot . D. Solder metal joints for full metal surface contact. After soldering, wash metal clean with neutralizing solution and rinse with water. E. Set splash pads under downspouts and scuppers. END OF SECTION Page 399 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 7123 05-11-2023 07 7123 - Manufactured Gutters and Downspouts Page 4 of 4 This page intentionally left blank Page 400 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 9200 05-11-2023 07 9200 - Joint Sealants Page 1 of 4 Section 07 9200 Joint Sealants PART 1 GENERAL 1.01 SECTION INCLUDES A. Nonsag gunnable joint sealants. B. Self-leveling pourable joint sealants. 1.02 RELATED REQUIREMENTS A. Section 01 6116 - Volatile Organic Compound (VOC) Content Restrictions: Additional requirements for sealants and primers. B. 32 1313 - Concrete Paving: Sealant at expansion joints 1.03 REFERENCE STANDARDS A. ASTM C661 - Standard Test Method for Indentation Hardness of Elastomeric-Type Sealants by Means of a Durometer 2015 (Reapproved 2022). B. ASTM C920 - Standard Specification for Elastomeric Joint Sealants 2018. C. ASTM C1193 - Standard Guide for Use of Joint Sealants 2016. 1.04 SUBMITTALS A. Product Data for Sealants: Submit manufacturer's technical data sheets for each product to be used, that includes the following. 1. Physical characteristics, including movement capability, VOC content, hardness, cure time, and color availability. 2. List of backing materials approved for use with the specific product. 3. Substrates that product is known to satisfactorily adhere to and with which it is compatible. 4. Substrates the product should not be used on. B. Color Cards for Selection: Where sealant color is not specified, submit manufacturer's color cards showing standard colors available for selection. 1.05 WARRANTY A. Installer's Warranty: Correct defective work within a two year period after Date of Substantial Completion. B. Manufacturer'sWarranty: Include coverage for installed sealants and accessories that fail to achieve watertight seal , exhibit loss of adhesion or cohesion, or do not cure for a period of one Page 401 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 9200 05-11-2023 07 9200 - Joint Sealants Page 2 of 4 year. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Non-Sag Sealants: Permits application in joints on vertical surfaces without sagging or slumping. 1. BASF Construction Chemicals-Building Systems: www.buildingsystems.basf.com. 2. Bostik Inc: www.bostik-us.com. 3. Dow Corning Corporation: www.dowcorning.com/construction/sle. 4. Hilti, Inc: www.us.hilti.com/#sle. 5. Pecora Corporation: www.pecora.com. 6. Tremco Global Sealants: www.tremcosealants.com. 7. Sherwin-Williams Company: www.sherwin-williams.com. 8. Sika Corporation: www.usa-sika.com. 9. W.R. Meadows, Inc: www.wrmeadows.com/sle. B. Self-Leveling Sealants: Pourable or self-leveling sealant that has sufficient flow to form a smooth, level surface when applied in a horizontal joint. 1. Bostik Inc: www.bostik-us.com. 2. Dow Corning Corporation: www.dowcorning.com/construction/sle. 3. Pecora Corporation: www.pecora.com. 4. Tremco Global Sealants: www.tremcosealants.com. 5. Sika Corporation: www.usa-sika.com. 6. W.R. Meadows, Inc: www.wrmeadows.com/sle. 2.02 JOINT SEALANT APPLICATIONS A. Scope: 1. Exterior Joints: Seal open joints, whether or not the joint is indicated on drawings, unless specifically indicated not to be sealed. Exterior joints to be sealed include, but are not limited to, the following items. a. Wall expansion and control joints. b. Joints between different exposed materials. c. Expansion joints in paving. d. Other joints indicated below. 2. Do not seal the following types of joints. a. Joints where sealant is specified to be provided by manufacturer of product to be sealed. b. Joints where installation of sealant is specified in another section. B. Exterior Joints: Use nonsag polyurethane sealant, unless otherwise indicated. 1. Control and Expansion Joints in Concrete Paving: Self-leveling polyurethane "traffic- grade" sealant. 2.03 JOINT SEALANTS - GENERAL A. Sealants and Primers: Provide products with levels of volatile organic compound (VOC) content as indicated in Section 01 6116. Page 402 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 9200 05-11-2023 07 9200 - Joint Sealants Page 3 of 4 B. Compatibility: Provide joint sealants, backings, and other related materials that are compatible with one another and with joint substrates under conditions of service and application, as demonstrated by sealant manufacturer, based on testing and field experience. C. Colors: As as selected by architect from manufacturer's full range 2.04 NONSAG JOINT SEALANTS A. Polyurethane Sealant: ASTM C920, Grade NS, Uses M and A; single or multicomponent; not expected to withstand continuous water immersion or traffic. 1. Movement Capability: Plus and minus ____ percent, minimum. 2. Manufacturers: a. Sherwin-Williams Company; Stampede 2NS Polyurethane Sealant: www.sherwin- williams.com/#sle. b. Sika Corporation; Sikaflex-2c NS: www.usa-sika.com/#sle. c. W. R. Meadows, Inc; POURTHANE NS: www.wrmeadows.com/#sle. 2.05 SELF-LEVELING SEALANTS A. Self-Leveling Polyurethane Sealant: ASTM C920, Grade P, Uses M and A; single or multicomponent; explicitly approved by manufacturer for traffic exposure; not expected to withstand continuous water immersion . 1. Movement Capability: Plus and minus 25 percent, minimum. 2. Hardness Range: 35 to 55, Shore A, when tested in accordance with ASTM C661. 3. Color: Gray. 4. Manufacturers: a. Pecora Corporation; Urexpan NR-200 and/or Dynatred: www.pecora.com. b. Sherwin-Williams Company; Loxon SL1 Polyurethane Self-Leveling Sealant: www.sherwin-williams.com. c. Sherwin-Williams Company; Loxon SL2 Polyurethane Self-Leveling Sealant: www.sherwin-williams.com. d. Sika Corporation; Sikaflex-1c SL: www.usa-sika.com/#sle. e. Sika Corporation; Sikaflex-2c SL: www.usa-sika.com/#sle. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that joints are ready to receive work. B. Verify that backing materials are compatible with sealants. 3.02 PREPARATION A. Remove loose materials and foreign matter that could impair adhesion of sealant. B. Clean joints, and prime as necessary, in accordance with manufacturer's instructions. C. Perform preparation in accordance with manufacturer's instructions and ASTM C1193. Page 403 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 07 9200 05-11-2023 07 9200 - Joint Sealants Page 4 of 4 D. Mask elements and surfaces adjacent to joints from damage and disfigurement due to sealant work; be aware that sealant drips and smears may not be completely removable. 3.03 INSTALLATION A. Perform work in accordance with sealant manufacturer's requirements for preparation of surfaces and material installation instructions. B. Perform installation in accordance with ASTM C1193. C. Measure joint dimensions and size joint backers to achieve width-to-depth ratio, neck dimension, and surface bond area as recommended by manufacturer, except where specific dimensions are indicated. D. Install bond breaker backing tape where backer rod cannot be used. E. Install sealant free of air pockets, foreign embedded matter, ridges, and sags, and without getting sealant on adjacent surfaces. F. Do not install sealant when ambient temperature is outside manufacturer's recommended temperature range, or will be outside that range during the entire curing period, unless manufacturer's approval is obtained and instructions are followed. G. Nonsag Sealants: Tool surface concave, unless otherwise indicated; remove masking tape immediately after tooling sealant surface. 3.04 POST-OCCUPANCY A. Post-Occupancy Inspection: Perform visual inspection of entire length of project sealant joints at a time that joints have opened to their greatest width; i.e. at low temperature in thermal cycle. Report failures immediately and repair. END OF SECTION Page 404 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 1 of 6 Section 08 1113 Hollow Metal Doors and Frames PART 1 GENERAL 1.01 SECTION INCLUDES A. Non-fire-rated hollow metal doors and frames. B. Thermally insulated hollow metal doors with frames. C. Accessories, including glazing, louvers, and matching panels. 1.02 RELATED REQUIREMENTS A. Section 08 7100 - Door Hardware. B. Section 08 8000 - Glazing: Glass for doors and borrowed lites. C. Section 09 9113 - Exterior Painting: Field painting. 1.03 ABBREVIATIONS AND ACRONYMS A. ANSI: American National Standards Institute. B. ASTM - American Society for Teesting Materials. C. NFPA: National Fire Protection Association. D. SDI: Steel Door Institute. E. UL: Underwriters Laboratories. 1.04 REFERENCE STANDARDS A. ADA Standards - 2010 ADA Standards for Accessible Design 2010. B. ANSI/SDI A250.4 - Test Procedure and Acceptance Criteria for Physical Endurance for Steel Doors, Frames and Frame Anchors 2022. C. ANSI/SDI A250.8 - Specifications for Standard Steel Doors and Frames (SDI-100) 2017. D. ANSI/SDI A250.10 - Test Procedure and Acceptance Criteria for Prime Painted Steel Surfaces for Steel Doors and Frames 2020. E. ASTM A653/A653M - Standard Specification for Steel Sheet, Zinc-Coated (Galvanized) or Zinc-Iron Alloy-Coated (Galvannealed) by the Hot-Dip Process 2022. Page 405 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 2 of 6 F. ASTM A1008/A1008M - Standard Specification for Steel, Sheet, Cold-Rolled, Carbon, Structural, High-Strength Low-Alloy, High-Strength Low-Alloy with Improved Formability, Required Hardness, Solution Hardened, and Bake Hardenable 2021a. G. ASTM A1011/A1011M - Standard Specification for Steel, Sheet and Strip, Hot-Rolled, Carbon, Structural, High-Strength Low-Alloy, High-Strength Low-Alloy with Improved Formability, and Ultra-High Strength 2018a. H. ASTM C143/C143M - Standard Test Method for Slump of Hydraulic-Cement Concrete 2020. I. ASTM C476 - Standard Specification for Grout for Masonry 2023. J. ASTM E90 - Standard Test Method for Laboratory Measurement of Airborne Sound Transmission Loss of Building Partitions and Elements 2009 (Reapproved 2016). K. ASTM E413 - Classification for Rating Sound Insulation 2022. L. BHMA A156.115 - Hardware Preparation in Steel Doors and Steel Frames 2016. M. ICC A117.1 - Accessible and Usable Buildings and Facilities 2017. N. ITS (DIR) - Directory of Listed Products Current Edition. O. NAAMM HMMA 810 - Hollow Metal Doors P. NAAMM HMMA 820 - Hollow Metal Frames Q. NAAMM HMMA 831 - Hardware Locations for Hollow Metal Doors and Frames 2011. R. NAAMM HMMA 840 - Guide Specifications For Receipt, Storage and Installation of Hollow Metal Doors and Frames 2017. S. NAAMM HMMA 850 - Fire-Rated Hollow Metal Doors and Frames 2014. T. NAAMM HMMA 861 - Guide Specifications for Commercial Hollow Metal Doors and Frames 2014. U. NFPA 80 - Standard for Fire Doors and Other Opening Protectives 2022. V. NFPA 252 - Standard Methods of Fire Tests of Door Assemblies 2022. W. SDI 117 - Manufacturing Tolerances for Standard Steel Doors and Frames 2023. X. UL (DIR) - Online Certifications Directory Current Edition. Y. UL 10C - Standard for Positive Pressure Fire Tests of Door Assemblies Current Edition, Including All Revisions. 1.05 SUBMITTALS Page 406 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 3 of 6 A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Materials and details of design and construction, hardware locations, reinforcement type and locations, anchorage and fastening methods, and finishes; and one copy of referenced standards/guidelines. C. Shop Drawings: Details of each opening and each different wall opening condition, showing elevations, glazing, anchorage, frame profiles, and any indicated finish requirements. D. Installation Instructions: Manufacturer's published instructions, including any special installation instructions relating to this project. E. Manufacturer's Certificate: Certification that products meet or exceed specified requirements. F. Manufacturer's Qualification Statement. G. Installer's Qualification Statement. 1.06 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing products specified in this section, with not less than three years documented experience. B. Installer Qualifications: Company specializing in performing work of the type specified and with at least three years of documented experience. C. Maintain at project site copies of reference standards relating to installation of products specified. 1.07 DELIVERY, STORAGE, AND HANDLING A. Comply with NAAMM HMMA 840 or ANSI/SDI A250.8 (SDI-100) in accordance with specified requirements. B. Protect with resilient packaging; avoid humidity build-up under coverings; prevent corrosion and adverse effects on factory applied painted finish. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Hollow Metal Doors and Frames: 1. Ceco Door, an Assa Abloy Group company; .: www.assaabloydss.com/#sle. 2. Steelcraft, an Allegion brand; .: www.allegion.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. 2.02 PERFORMANCE REQUIREMENTS A. Requirements for Hollow Metal Doors and Frames: Page 407 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 4 of 6 1. Steel Sheet: Comply with one or more of the following requirements; galvannealed steel complying with ASTM A653/A653M, cold-rolled steel complying with ASTM A1008/A1008M, or hot-rolled pickled and oiled (HRPO) steel complying with ASTM A1011/A1011M, commercial steel (CS) Type B, for each. 2. Accessibility: Comply with ICC A117.1, ADA Standards, and CBC Chapter 11B 3. Exterior Door Top Closures: Flush end closure channel, with top and door faces aligned. 4. Door Edge Profile: Manufacturers standard for application indicated. 5. Typical Door Face Sheets:Embossed. Refer to Door Schedule for additional information. B. Hollow Metal Panels: Same construction, performance, and finish as doors. C. Combined Requirements: If a particular door and frame unit is indicated to comply with more than one type of requirement, comply with the specified requirements for each type; for instance, an exterior door that is also indicated as being sound-rated must comply with the requirements specified for exterior doors and for sound-rated doors; where two requirements conflict, comply with the most stringent. 2.03 HOLLOW METAL DOORS A. Door Finish: Factory primed and field finished. B. Type 1 ,Exterior Doors: Thermally insulated. 1. Based on SDI Standards: ANSI/SDI A250.8 (SDI-100). a. Level 3 - Extra Heavy-duty. b. Physical Performance Level A, 1,000,000 cycles; in accordance with ANSI/SDI A250.4. c. Model 3 - Stile and Rail. d. Door Face Metal Thickness:16 gauge, 0.053 inch, minimum. 2. Door Thickness: 1-3/4 inches, nominal. 3. Door Finish: Factory primed and field finished. 2.04 HOLLOW METAL FRAMES A. Comply with standards and/or custom guidelines as indicated for corresponding door in accordance with applicable door frame requirements. B. Exterior Door Frames: Fully welded. Steelcraft F and FN series 1. Galvanizing: Components hot-dipped zinc-iron alloy-coated (galvannealed) in accordance with ASTM A653/A653M, with A40/ZF120 coating. 2. Frame Metal Thickness:12 gage, 0.093 inch, minimum. 3. Frame Finish: Factory primed and field finished. C. Borrowed Lites Glazing Frames: Construction and face dimensions to match door frames, and as indicated on drawings. 2.05 FINISHES A. Primer: Rust-inhibiting, complying with ANSI/SDI A250.10, door manufacturer's standard. 2.06 ACCESSORIES Page 408 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 5 of 6 A. Louvers: Roll formed steel with overlapping frame; factory-painted finish, color as selected; factory-installed. B. Door Window Frames: Door window frames with glazing securely fastened within door opening. 1. Size:As indicated on drawings. 2. Frame Material: 18 gauge, 0.0478 inch, galvanized steel. C. Glazing: As specified in Section 08 8000, factory installed. D. Grout for Frames: Mortar grout complying with ASTM C476 with maximum slump of 4 inches as measured in accordance with ASTM C143/C143M for hand troweling in place; plaster grout and thinner pumpable grout are prohibited. PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions before starting work. B. Verify that opening sizes and tolerances are acceptable. C. Verify that finished walls are in plane to ensure proper door alignment. 3.02 PREPARATION A. Coat inside of frames to be installed in masonry or to be grouted, with bituminous coating, prior to installation. 3.03 INSTALLATION A. Install doors and frames in accordance with manufacturer's instructions and related requirements of specified door and frame standards or custom guidelines indicated. B. Install fire rated units in accordance with NFPA 80. C. Coordinate frame anchor placement with wall construction. D. Grout frames in masonry construction, using hand trowel methods; brace frames so that pressure of grout before setting will not deform frames. E. Install door hardware as specified in Section 08 7100. F. Comply with glazing installation requirements of Section 08 8000. 3.04 TOLERANCES A. Clearances Between Door and Frame: Comply with related requirements of specified frame standards or custom guidelines indicated in accordance with SDI 117 or NAAMM HMMA 861. Page 409 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 1113 05-11-2023 08 1113 - Hollow Metal Doors and Frames Page 6 of 6 B. Maximum Diagonal Distortion: 1/16 inch measured with straight edge, corner to corner. 3.05 ADJUSTING A. Adjust for smooth and balanced door movement. 3.06 SCHEDULE A. Refer to Door and Frame Schedule on the drawings. END OF SECTION Page 410 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 3313 05-11-2023 08 3313 - Coiling Counter Doors Page 1 of 4 Section 08 3313 Coiling Counter Doors PART 1 GENERAL 1.01 SECTION INCLUDES A. Non-fire-rated coiling counter doors and operating hardware. 1.02 RELATED REQUIREMENTS A. Section 05 1200 - Structural Steel Framing 1.03 REFERENCE STANDARDS A. ASTM A666 - Standard Specification for Annealed or Cold-Worked Austenitic Stainless Steel Sheet, Strip, Plate, and Flat Bar 2023. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Submit manufacturer's standard literature showing materials and details of construction and finish. Include data on electrical operation. C. Shop Drawings: Indicate rough and actual opening dimensions, anchorage methods, hardware locations, and installation details. D. Samples: Two slats, 4 inches long, illustrating shape, color, and finish texture. E. Manufacturer's Installation Instructions: Indicate installation sequence and installation, adjustment, and alignment procedures. F. Manufacturer's qualification statement. G. Installer's qualification statement. H. Operation and Maintenance Data: Indicate modes of operation, lubrication requirements and frequency, and periodic adjustments required. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing the products specified in this section with minimum three years of documented experience. B. Installer Qualifications: Company specializing in performing work of type specified and with at least three years documented experience. Page 411 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 3313 05-11-2023 08 3313 - Coiling Counter Doors Page 2 of 4 1.06 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Manufacturer Warranty: Provide 2-year manufacturer warranty for counterbalance shaft assembly. Complete forms in City's name and register with manufacturer. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Coiling Counter Doors: 1. C.H.I. Overhead Doors; Model 6566 (stainless): www.chiohd.com/#sle. 2. Overhead Door: Model 651(stainless): https://www.overheaddoor.com/counter-doors-651. 3. Substitutions: See Section 01 6000 - Product Requirements. 2.02 COILING COUNTER DOORS A. Coiling Counter Metal Doors, Non-Fire-Rated:Stainless steel slat curtain. 1. Mounting:Interior face mounted. 2. Nominal Slat Size:1 1/2 inches wide. 3. Slat Profile:Flat. 4. Interior Finish, Stainless Steel: No. 4 - Brushed. 5. Curtain Color: Exterior side to be as selected by Architect from manufacturer's custom range. 6. Guides: Formed track; stainless steel same material and finish as interior unless otherwise indicated. 7. Hood Enclosure:Manufacturer's standard; primed steel. 8. Manual push up operation. 9. Locking Devices:Slide bolt on inside. 2.03 COMPONENTS A. Metal Curtain Construction: Interlocking, single-thickness slats. 1. Slat Ends: Alternate slats fitted with end locks to act as wearing surface in guides and to prevent lateral movement. 2. Curtain Bottom: Fitted with angles to provide reinforcement and positive contact in closed position. 3. Stainless Steel Slats: ASTM A666, Type 304; minimum thickness 22 gauge, 0.03 inch. B. Guide Construction: Continuous, of profile to retain door in place, with mounting brackets of same metal. 1. Stainless Steel Guides: ASTM A666, Type 304, rollable temper. C. Hood Enclosure: Internally reinforced to maintain rigidity and shape. D. Lock Hardware: 1. Latch Handle: Manufacturer's standard. Page 412 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 3313 05-11-2023 08 3313 - Coiling Counter Doors Page 3 of 4 2. Slide Bolt: Provide on both-jamb sides, extending into slot in guides, with padlock on both sides.. E. Roller Shaft Counterbalance: Steel pipe and torsion steel spring system, capable of producing torque sufficient to ensure smooth operation of curtain from any position and capable of holding position at mid-travel; with adjustable spring tension; requiring 25 lb nominal force to operate. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that adjacent construction is suitable for door installation. B. Verify that electrical services have been installed and are accessible. C. Verify that door opening is plumb, header is level, and dimensions are correct. D. Notify Architect of any unacceptable conditions or varying dimensions. E. Commencement of installation indicates acceptance of substrate and door opening conditions. 3.02 INSTALLATION A. Install units in accordance with manufacturer's instructions. B. Use anchorage devices to securely fasten assembly to wall construction and building framing without distortion or stress. C. Securely and rigidly brace components suspended from structure. Secure guides to structural members only. D. Fit and align assembly including hardware; level and plumb, to provide smooth operation. E. Install perimeter trim as indicated. 3.03 TOLERANCES A. Maintain dimensional tolerances and alignment with adjacent work. B. Maximum Variation From Plumb: 1/16 inch. C. Maximum Variation From Level: 1/16 inch. D. Longitudinal or Diagonal Warp: Plus or minus 1/8 inch per 10 ft straight edge. 3.04 ADJUSTING A. Adjust operating assemblies for smooth and noiseless operation. Page 413 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 3313 05-11-2023 08 3313 - Coiling Counter Doors Page 4 of 4 3.05 CLEANING A. Clean installed components. B. Remove labels and visible markings. END OF SECTION Page 414 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 1 of 8 Section 08 4313 Aluminum-Framed Storefronts PART 1 GENERAL 1.01 SECTION INCLUDES A. Aluminum-framed storefront, with vision glass. B. All required attachments, trim, and accessories to provide a complete installation. 1.02 RELATED REQUIREMENTS A. Section 06 1000 - Rough Carpentry B. Section 07 9200 - Joint Sealants: Sealing joints between frames and adjacent construction. C. Section 08 8000 - Glazing: Glass and glazing accessories. D. Section 12 2400 - Window Shades: Attachments to framing members. 1.03 REFERENCE STANDARDS A. AAMA CW-10 - Care and Handling of Architectural Aluminum from Shop to Site 2015. B. AAMA 501.4 - Recommended Static Test Method for Evaluating Window Wall, Curtain Wall and Storefront Systems Subjected to Seismic and Wind-Induced Inter-Story Drift 2018. C. AAMA 611 - Voluntary Specification for Anodized Architectural Aluminum 2020. D. AAMA 1503 - Voluntary Test Method for Thermal Transmittance and Condensation Resistance of Windows, Doors and Glazed Wall Sections 2009. E. AAMA 2604 - Voluntary Specification, Performance Requirements and Test Procedures for High Performance Organic Coatings on Aluminum Extrusions and Panels (with Coil Coating Appendix) 2022. F. ASCE 7 - Minimum Design Loads and Associated Criteria for Buildings and Other Structures Most Recent Edition Cited by Referring Code or Reference Standard. G. ASTM B209 - Standard Specification for Aluminum and Aluminum-Alloy Sheet and Plate 2014. H. ASTM B221 - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes 2021. I. ASTM B221M - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes (Metric) 2021. Page 415 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 2 of 8 J. ASTM E283/E283M - Standard Test Method for Determining Rate of Air Leakage Through Exterior Windows, Skylights, Curtain Walls, and Doors Under Specified Pressure Differences Across the Specimen 2019. K. ASTM E330/E330M - Standard Test Method for Structural Performance of Exterior Windows, Doors, Skylights and Curtain Walls by Uniform Static Air Pressure Difference 2014 (Reapproved 2021). 1.04 ADMINISTRATIVE REQUIREMENTS A. Coordinate with installation of other components that comprise the exterior enclosure. 1.05 PERFORMANCE REQUIREMENTS A. Design and size components to withstand the following load requirements without damage or permanent set, when tested in accordance with ASTM E 330, using loads 1.5 times the design wind loads and 10 second duration of maximum load. 1. Design Wind Loads: Comply with requirements of California Building code. a. 70 mph wind speed, exposure C 2. Member Deflection: Limit member deflection to flexure limit of glass in any direction, with full recovery of glazing materials. B. Movement: Accommodate movement between storefront and perimeter framing and deflection of lintel, without damage to components or deterioration of seals. C. Air Infiltration: Limit air infiltration through assembly to 0.06 cu ft/min/sq ft of wall area, measured at a reference differential pressure across assembly of 1.57 psf as measured in accordance with ASTM E 283. D. Water Leakage: None, when measured in accordance with ASTM E 331 with a test pressure difference of 6.00 lbf/sq ft. E. System Internal Drainage: Drain to the exterior by means of a weep drainage network any water entering joints, condensation occurring in glazing channel, and migrating moisture occurring within system. F. Expansion/Contraction: Provide for expansion and contraction within system components caused by cycling temperature range of 170 degrees F over a 12 hour period without causing detrimental effect to system components, anchorages, and other building elements. 1.06 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data: Provide component dimensions, describe components within assembly, anchorage and fasteners, glass and infill, internal drainage details. C. Shop Drawings: Indicate system dimensions, framed opening requirements and tolerances, affected related work, expansion and contraction joint location and details, and field welding required. Page 416 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 3 of 8 D. Samples: Submit two samples 6 inches long illustrating finished aluminum surface . E. Warranty: Submit manufacturer warranty and ensure forms have been completed in City's name and registered with manufacturer. 1.07 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in performing work of type specified and with at least three years of documented experience. B. Single Source Responsibility: Obtain storefronts through one source from a single manufacturer. C. Installer - The storefront installer shall be currently approved by the manufacturer, and have experience of at least five (5) years installing the selected system. 1.08 DELIVERY, STORAGE, AND HANDLING A. Handle products of this section in accordance with AAMA CW-10. B. Protect finished aluminum surfaces with wrapping. Do not use adhesive papers or sprayed coatings that bond to aluminum when exposed to sunlight or weather. C. Replacements - In the event of damage, including water intrusion, immediately make all repairs and replacements necessary to the approval of the Architect and at no additional cost to the University. 1.09 WARRANTY A. See Section 01 7800 - Closeout Submittals, for additional warranty requirements. B. Special Assembly Warranty: Manufacturer's standard form in which manufacturer agrees to repair or replace components of aluminum-framed systems that do not comply with requirements or that deteriorate as defined in this Section within specified warranty period. 1. Failures include, but are not limited to, the following: a. Structural failures including, but not limited to, excessive deflection. b. Noise or vibration caused by thermal movements. c. Deterioration of metals, metal finishes, and other materials beyond normal weathering. d. Water leakage through fixed glazing and framing areas. e. Failure of operating components to function properly. 2. Warranty Period: 2 years. C. Provide two year manufacturer warranty against excessive degradation of exterior finish. Include provision for replacement of units with excessive fading, chalking, or flaking. PART 2 PRODUCTS 2.01 MANUFACTURERS Page 417 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 4 of 8 A. All storefront and entrances system components shall be the product of a single manufacturer and represent an integrated system. B. The aluminum storefront system was designed based on the product of Arcadia as a standard of quality. C. Aluminum-Framed Storefront and Doors: 1. Kawneer North America; Trifab 451T: www.kawneer.com. 2. Substitutions:See Section 01 6000 - Product Requirements. 2.02 ALUMINUM-FRAMED STOREFRONT A. Glazing: Refer to Section 08 8000 Glazing. B. Aluminum-Framed Storefront: Factory fabricated, factory finished aluminum framing members with infill, and related flashings, anchorage and attachment devices. 1. Glazing Rabbet: For 1 inch insulating glazing. 2. Glazing Position:Center Set. 3. Vertical Mullion Dimensions: 2 inches wide by 4-1/2 inches deep. 4. Condensation Resistance Factor: 40 minimum 5. Finish:Class I color anodized. a. Factory finish all surfaces that will be exposed in completed assemblies. 6. Finish Color:Dark bronze. 7. Fabrication: Joints and corners flush, hairline, and weatherproof, accurately fitted and secured; prepared to receive anchors and hardware; fasteners and attachments concealed from view; reinforced as required for imposed loads. 8. Construction: Eliminate noises caused by wind and thermal movement, prevent vibration harmonics, and prevent "stack effect" in internal spaces. 9. System Internal Drainage: Drain to the exterior by means of a weep drainage network any water entering joints, condensation occurring in glazing channel, and migrating moisture occurring within system. 10. Expansion/Contraction: Provide for expansion and contraction within system components caused by cycling temperature range of 170 degrees F over a 12 hour period without causing detrimental effect to system components, anchorages, and other building elements. 11. Movement: Allow for movement between storefront and adjacent construction, without damage to components or deterioration of seals. 12. Perimeter Clearance: Minimize space between framing members and adjacent construction while allowing expected movement. C. Performance Requirements 1. Wind Loads: Design and size components to withstand the specified load requirements without damage or permanent set, when tested in accordance with ASTM E330/E330M, using loads 1.5 times the design wind loads and 10 second duration of maximum load. a. Design Wind Loads: Comply with requirements of ASCE 7. b. Member Deflection: Limit member deflection to 1/175 in any direction, with full recovery of glazing materials. 2. Air Leakage: 0.06 cfm/sq ft maximum leakage of storefront wall area when tested in accordance with ASTM E283/E283M at 1.57 psf pressure difference. Page 418 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 5 of 8 3. System shall not deflect more than 1/8´at the center point, or 1/16´at the center point of a horizontal member, once deadload points have been established. 4. System shall accommodate expansion and contraction movement due to surface temperature differential of 180 degrees F. 5. Seismic testing shall conform to AAMA 504.1 recommended static test method for evaluating performance of curtain walls and storefront wall systems due to horizontal displacements associated with seismic movements and building sway. 6. Thermal Performance ±When tested in accordance with AAMA 1503.1 the following results should be attained: U-Maximum .63/CRF ±minimum of 59. 7. National Fenestration Rating Council (NFRC) specific application evaluation 2.03 COMPONENTS A. Aluminum Framing Members: Tubular aluminum sections, thermally broken with interior section insulated from exterior, drainage holes and internal weep drainage system. 1. Framing members for interior applications need not be thermally broken. 2. Fabrication Method ±Shearblock or equal. Use of exposed fasteners and stacking system with receptor sill not acceptable. 3. Glazing Stops: Flush. 2.04 MATERIALS A. Extruded Aluminum: ASTM B221 (ASTM B221M). B. Fasteners: Stainless steel. C. Glazing Gaskets: Type to suit application to achieve weather, moisture, and air infiltration requirements. 2.05 FINISHES A. Comply with AA DAF-45 for aluminum finishes required. B. Class I Color Anodized Finish: AAMA 611 AA-M12C22A42 Integrally colored anodic coating not less than 0.7 mils thick. C. Touch-Up Materials: As recommended by coating manufacturer for field application. 2.06 FABRICATION A. Touch-up surfaces cut during fabrication so that no natural aluminum is visible in completed assemblies, including joint edges. B. A. Continuous sub-sill shall be provided under sill members to collect water infiltration and divert from the interior of the system. C. Develop drainage holes with moisture pattern to exterior. D. B. Framing members shall be internally reinforced and secured at head and sill as necessary for structural performance requirements, for hardware attachment, and as indicated. Page 419 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 6 of 8 E. C. Fasteners shall be so located as to ensure concealment from view in the final assembly. PART 3 EXECUTION 3.01 EXAMINATION A. Verify dimensions, tolerances, and method of attachment with other work. B. Verify that wall openings and adjoining air and vapor seal materials are ready to receive work of this section. 3.02 INSTALLATION A. Install wall system in accordance with manufacturer's instructions. B. Attach to structure to permit sufficient adjustment to accommodate construction tolerances and other irregularities. C. Provide alignment attachments and shims to permanently fasten system to building structure. D. Align assembly plumb and level, free of warp or twist. Maintain assembly dimensional tolerances, aligning with adjacent work. E. Provide thermal isolation where components penetrate or disrupt building insulation. F. Install sill flashings. Turn up ends and edges; seal to adjacent work to form water tight dam. G. Where fasteners penetrate sill flashings, make watertight by seating and sealing fastener heads to sill flashing. H. Coordinate attachment and seal of perimeter air and vapor barrier materials. I. Pack fibrous insulation in shim spaces at perimeter of assembly to maintain continuity of thermal barrier. J. Install glass and infill panels in accordance with Section 08 8000, using glazing method required to achieve performance criteria. K. Install perimeter sealant in accordance with Section 07 9005. L. Touch-up minor damage to factory applied finish; replace components that cannot be satisfactorily repaired. 3.03 TOLERANCES A. Maximum Variation from Plumb: 0.06 inch per 3 feet non-cumulative or 0.06 inch per 10 feet, whichever is less. B. Maximum Misalignment of Two Adjoining Members Abutting in Plane: 1/32 inch. Page 420 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 7 of 8 3.04 CLEANING A. Remove protective material from pre-finished aluminum surfaces. B. Remove excess sealant by method acceptable to sealant manufacturer. 3.05 PROTECTION A. Protect installed products from damage until Date of Substantial Completion. END OF SECTION Page 421 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 4313 05-11-2023 08 4313 - Aluminum-Framed Storefronts Page 8 of 8 This page intentionally left blank Page 422 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 6200 05-11-2023 08 6200 - Unit Skylights Page 1 of 4 Section 08 6200 Unit Skylights PART 1 GENERAL 1.01 SECTION INCLUDES A. Skylights with integral frame. B. Operating mechanism. 1.02 RELATED REQUIREMENTS A. Section 05 4000 - Cold-Formed Metal Framing B. Section 07 4113 - Metal Roof Panels: Building Roofing 1.03 REFERENCE STANDARDS A. AAMA/WDMA/CSA 101/I.S.2/A440 - North American Fenestration Standard/Specification for Windows, Doors, and Skylights 2022. B. ASTM B221 - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes 2021. C. ASTM B221M - Standard Specification for Aluminum and Aluminum-Alloy Extruded Bars, Rods, Wire, Profiles, and Tubes (Metric) 2021. D. ASTM E2112 - Standard Practice for Installation of Exterior Windows, Doors and Skylights 2019c. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Include structural, thermal, and daylighting performance values. C. Performance Validation: Provide specified performance validation before submitting shop drawings or starting fabrication. D. Grade Substantiation: Prior to submitting shop drawings or starting fabrication, submit one of the following showing compliance with specified grade: 1. Evidence of AAMA Certification. 2. Evidence of WDMA Certification. 3. Evidence of CSA Certification. 4. Test report(s) by independent testing agency itemizing compliance and acceptable to authorities having jurisdiction. E. Installer's qualification statement. Page 423 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 6200 05-11-2023 08 6200 - Unit Skylights Page 2 of 4 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing the products specified in this section with not less than three years documented experience. B. Installer Qualifications: Company specializing in performing work of the type specified and with at least three years documented experience. 1.06 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Manufacturer Warranty: Provide five-year manufacturer warranty including coverage for leakage due to defective skylight materials or construction. Complete forms in City's name and register with manufacturer. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Unit Skylights: 1. FAKRO America LLC: www.fakrousa.com/#sle. 2. Velux America, Inc: www.veluxusa.com/#sle. 3. Wasco Skylights - Part of the VELUX Group: www.wascoskylights.com/#sle. 4. Substitutions: See Section 01 6000 - Product Requirements. 2.02 SKYLIGHTS A. Skylights: Factory-assembled glazing in aluminum frame, free of visual distortion, and weathertight. 1. Shape:Rectangular dome. 2. Glazing: Single. 3. Operation:None; fixed. 4. Nominal Size:24 by 48 inch. 5. Color: As selected from manufacture's full line to complement roofing. 2.03 PERFORMANCE REQUIREMENTS A. Provide unit skylights that comply with the following: 1. Grade: AAMA/WDMA/CSA 101/I.S.2/A440 requirements for specific skylight type: 2. Performance Validation: Skylights shall comply with AAMA/WDMA/CSA 101/I.S.2/A440 performance requirements as indicated by having AAMA, WDMA, or CSA certified label, or an independent test report for indicated products itemizing compliance and acceptable by authorities having jurisdiction. 3. Allow for expansion and contraction within system components caused by a cycling surface temperature range of 170 degrees F without causing detrimental effects to system or components. 2.04 COMPONENTS Page 424 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 6200 05-11-2023 08 6200 - Unit Skylights Page 3 of 4 A. Single Glazing:Polycarbonate plastic; clear transparent. B. Frames:ASTM B221 ASTM B221M Extruded aluminum reinforced and welded corner joints, integral curb frame mounting flange and counterflashing to receive roofing flashing system, with integral condensation collection gutter, glazing retainer; clear anodized finish. 2.05 ACCESSORIES A. Anchorage Devices: Type recommended by manufacturer, exposed to view. B. Counterflashings:Same metal type and finish as roofing.. C. Protective Back Coating: Zinc molybdate alkyd. D. Sealant: Elastomeric, silicone or polyurethane, compatible with material being sealed . PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions before starting work. B. Verify that openings and substrate conditions are ready to receive work of this section. 3.02 PREPARATION A. Apply protective back coating on aluminum surfaces of skylight units that will be in contact with cementitious materials or dissimilar metals. 3.03 INSTALLATION A. Install unit skylights in accordance with manufacturer's instructions and ASTM E2112. B. Install skylight units and mount securely; install counterflashing as required. C. Apply sealant to achieve watertight assembly. END OF SECTION Page 425 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 6200 05-11-2023 08 6200 - Unit Skylights Page 4 of 4 This page intentionally left blank Page 426 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 1 of 6 Section 08 7100 Door Hardware PART 1 GENERAL 1.01 SECTION INCLUDES A. Hardware for hollow metal and sliding doors. B. Thresholds. 1.02 RELATED REQUIREMENTS A. Section 08 1113 - Hollow Metal Doors and Frames. 1.03 REFERENCE STANDARDS A. ADA Standards - 2010 ADA Standards for Accessible Design 2010. B. BHMA A156.1 - Standard for Butts and Hinges 2021. C. BHMA A156.4 - Door Controls - Closers 2019. D. BHMA A156.5 - Cylinders and Input Devices for Locks 2020. E. BHMA A156.6 - Standard for Architectural Door Trim 2021. F. BHMA A156.13 - Mortise Locks & Latches Series 1000 2022. G. BHMA A156.18 - Materials and Finishes 2020. H. BHMA A156.21 - Thresholds 2019. I. BHMA A156.26 - Standard for Continuous Hinges 2021. J. ICC A117.1 - Accessible and Usable Buildings and Facilities 2017. 1.04 ADMINISTRATIVE REQUIREMENTS A. Coordinate the manufacture, fabrication, and installation of products that door hardware is installed on. B. Preinstallation Meeting: Convene a preinstallation meeting one week prior to commencing work of this section; attendance is required by affected installers and the following: 1. Architect. 2. Installer's Architectural Hardware Consultant (AHC). 3. Hardware Installer. 4. Owner's Security Consultant. Page 427 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 2 of 6 C. Furnish templates for door and frame preparation to manufacturers and fabricators of products requiring internal reinforcement for door hardware. D. Keying Requirements Meeting: 1. Attendance Required: 2. Agenda: 3. Incorporate "Keying Requirements Meeting" decisions into keying submittal upon review of door hardware keying system including, but not limited to, the following: 4. Record minutes and distribute copies within two days after meeting to participants, with two copies to Architect, City, participants, and those affected by decisions made. 5. Deliver established keying requirements to manufacturers. 1.05 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Manufacturer's catalog literature for each type of hardware, marked to clearly show products to be furnished for this project, and includes construction details, material descriptions, finishes, and dimensions and profiles of individual components. C. Shop Drawings - Door Hardware Schedule: Submit detailed listing that includes each item of hardware to be installed on each door. Use door numbering scheme as included in Contract Documents. 1. Prepared by or under supervision of Architectural Hardware Consultant (AHC). 2. Provide complete description for each door listed. 3. Provide manufacturer name, product names, and catalog numbers; include functions, types, styles, sizes and finishes of each item. D. Keying Schedule: 1. Submit three (3) copies of Keying Schedule in compliance with requirements established during Keying Requirements Meeting unless otherwise indicated. E. Installer's qualification statement. F. Warranty: Submit manufacturer's warranty and ensure that forms have been completed in City's name and registered with manufacturer. 1.06 QUALITY ASSURANCE A. Installer Qualifications: Company specializing in performing work of the type specified for commercial door hardware with at least three years of documented experience. B. Supplier Qualifications: Company with certified Architectural Hardware Consultant (AHC) and Electrified Hardware Consultant (EHC) to assist in work of this section. 1.07 DELIVERY, STORAGE, AND HANDLING A. Package hardware items individually; label and identify each package with door opening code to match door hardware schedule. Page 428 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 3 of 6 1.08 WARRANTY A. See Section 01 7800 - Closeout Submittals for additional warranty requirements. B. Warranty against defects in material and workmanship for period indicated, from Date of Substantial Completion. 1. Closers: Five years, minimum. 2. Locksets and Cylinders: Three years, minimum. 3. Other Hardware: Two years, minimum. PART 2 PRODUCTS 2.01 DESIGN AND PERFORMANCE CRITERIA A. Provide specified door hardware as required to make doors fully functional, compliant with applicable codes, and secure to extent indicated. B. Provide individual items of single type, of same model, and by same manufacturer. C. Provide door hardware products that comply with the following requirements: 1. Applicable provisions of federal, state, and local codes. 2. Accessibility: ADA Standards and ICC A117.1. D. Lock Function: Provide lock and latch function numbers and descriptions of manufacturer's series. See Door Hardware Schedule. 2.02 HINGES A. Manufacturers: 1. Hager Companies; _____: www.hagerco.com/#sle. B. Hinges: Comply with BHMA A156.1, Grade 1. 1. Continuous Hinges: Comply with BHMA A156.26. 2. Provide hinges on every swinging door. 3. Provide following quantity of butt hinges for each door: 2.03 LOCK CYLINDERS A. Manufacturers: B. Lock Cylinders: Provide key access on outside of each lock, unless otherwise indicated. 1. Provide standard, conventional, and full size interchangeable core (FSIC) type cylinders, Grade 1, with six-pin core in compliance with BHMA A156.5 at locations indicated. 2. Provide cylinders from same manufacturer as locking device. 3. Provide cams and/or tailpieces as required for locking devices. 2.04 MORTISE LOCKS A. Manufacturers: Page 429 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 4 of 6 1. Schlage, an Allegion brand; _____: www.allegion.com/us/#sle. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Mortise Locks: Comply with BHMA A156.13, Grade 1, Security, 1000 Series. 1. Latchbolt Throw: 3/4 inch, minimum. 2. Deadbolt Throw: 1 inch, minimum. 3. Backset: 2-3/4 inch unless otherwise indicated. 4. Strikes: Provide manufacturer's standard strike for each latchset or lockset with strike box and curved lip extending to protect frame in compliance with indicated requirements. a. Finish: To match lock or latch. 2.05 DOOR PULLS AND PUSH PLATES A. Manufacturers: 1. Hager Companies; _____: www.hagerco.com/#sle. B. Door Pulls and Push Plates: Comply with BHMA A156.6. 1. Pull Type: Straight, unless otherwise indicated. 2. Push Plate Type: Flat, with square corners, unless otherwise indicated. a. Edges: Beveled, unless otherwise indicated. 3. Material: Aluminum, unless otherwise indicated. 2.06 CLOSERS A. Manufacturers; Surface Mounted: 1. LCN, an Allegion brand; _____: www.allegion.com/us/#sle. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Closers: Comply with BHMA A156.4, Grade 1. 1. Type:As indicated in door hardware sets. 2. Provide door closer on each exterior swinging door. 2.07 KICK PLATES A. Manufacturers: 1. Ives, an Allegion brand; _____: www.allegion.com/us/#sle. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Kick Plates: Provide along bottom edge of push side of every door with closer, except aluminum storefront and glass entry doors, unless otherwise indicated. 1. Size: 8 inch high by 2 inch less door width (LDW) on push side of door. 2.08 MOP PLATES A. Manufacturers: 1. Ives, an Allegion brand; _____: www.allegion.com/us/#sle. B. Mop Plates: Provide along bottom edge of interior of doors to provide protection from cleaning liquids and equipment damage to door surface. 1. Size: 6 inch high by 1-1/2 inch less door width (LDW) on pull side and 2 inch LDW on push side of door. Page 430 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 5 of 6 2.09 THRESHOLDS A. Manufacturers: 1. Pemko; an Assa Abloy Group company; _____: www.assaabloydss.com/#sle. 2. Hager Companies; _____: www.hagerco.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. B. Thresholds: Comply with BHMA A156.21. 1. Provide threshold at each exterior door, unless otherwise indicated. 2. Type: Flat surface. 3. Material:Brass . 4. Threshold Surface: Fluted horizontal grooves across full width. 5. Field cut threshold to profile of frame and width of door sill for tight fit. 6. Provide non-corroding fasteners at exterior locations. 2.10 FINISHES A. Finishes: Provide door hardware of same finish, unless otherwise indicated. 1. Primary Finish:613; dark oxidized satin bronze, oil rubbed, with bronze base material (former US equivalent US10B); BHMA A156.18. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that doors and frames are ready to receive this work; labeled, fire-rated doors and frames are properly installed, and dimensions are as indicated on shop drawings. 3.02 INSTALLATION A. Install hardware in accordance with manufacturer's instructions and applicable codes. B. Use templates provided by hardware item manufacturer. C. Do not install surface mounted items until application of finishes to substrate are fully completed. D. Door Hardware Mounting Heights: Distance from finished floor to center line of hardware item. As indicated in following list; unless noted otherwise in Door Hardware Schedule or on drawings. 1. Mounting heights in compliance with ADA Standards and CBC 11B. E. Set exterior door thresholds with full-width bead of elastomeric sealant at each point of contact with floor providing a continuous weather seal; anchor thresholds with stainless steel countersunk screws. 3.03 FIELD QUALITY CONTROL Page 431 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 7100 05-11-2023 08 7100 - Door Hardware Page 6 of 6 A. Perform field inspection and testing under provisions of Section 01 4000 - Quality Requirements. 3.04 ADJUSTING A. Adjust work under provisions of Section 01 7000 - Execution and Closeout Requirements. B. Adjust hardware for smooth operation. C. Adjust gasketing for complete, continuous seal; replace if unable to make complete seal. D. Adjust closing speed to comply with CBC 11B 3.05 CLEANING A. Clean finished hardware in accordance with manufacturer's written instructions after final adjustments have been made. B. Clean adjacent surfaces soiled by hardware installation. C. Replace items that cannot be cleaned to manufacturer's level of finish quality at no additional cost. 3.06 PROTECTION A. Protect finished Work under provisions of Section 01 7000 - Execution and Closeout Requirements. B. Do not permit adjacent work to damage hardware or finish. END OF SECTION Page 432 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 1 of 8 Section 08 8000 Glazing PART 1 GENERAL 1.01 SECTION INCLUDES A. Insulating glass units. B. Glazing compounds. 1.02 RELATED REQUIREMENTS A. Section 08 1113 - Hollow Metal Doors and Frames: Glazed lites in doors and borrowed lites. B. Section 08 1416 - Wood Doors: Glazed lites in doors. C. Section 08 5313 - Vinyl Windows: Glazing provided by window manufacturer. D. Section 1.03 REFERENCE STANDARDS A. 16 CFR 1201 - Safety Standard for Architectural Glazing Materials Current Edition. B. ANSI Z97.1 - American National Standard for Safety Glazing Materials Used in Buildings - Safety Performance Specifications and Methods of Test 2015 (Reaffirmed 2020). C. ASCE 7 - Minimum Design Loads and Associated Criteria for Buildings and Other Structures Most Recent Edition Cited by Referring Code or Reference Standard. D. ASTM C864 - Standard Specification for Dense Elastomeric Compression Seal Gaskets, Setting Blocks, and Spacers 2005 (Reapproved 2019). E. ASTM C1048 - Standard Specification for Heat-Strengthened and Fully Tempered Flat Glass 2018. F. ASTM C1193 - Standard Guide for Use of Joint Sealants 2016. G. ASTM C1376 - Standard Specification for Pyrolytic and Vacuum Deposition Coatings on Flat Glass 2021a. H. ASTM D882 - Standard Test Method for Tensile Properties of Thin Plastic Sheeting 2018. I. ASTM E1300 - Standard Practice for Determining Load Resistance of Glass in Buildings 2016. J. ASTM E2190 - Standard Specification for Insulating Glass Unit Performance and Evaluation 2019. Page 433 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 2 of 8 K. GANA (GM) - GANA Glazing Manual 2022. L. GANA (SM) - GANA Sealant Manual 2008. M. NFRC 100 - Procedure for Determining Fenestration Product U-factors 2020. N. NFRC 200 - Procedure for Determining Fenestration Product Solar Heat Gain Coefficient and Visible Transmittance at Normal Incidence 2020. O. NFRC 300 - Test Method for Determining the Solar Optical Properties of Glazing Materials and Systems 2023. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data on Insulating Glass Unit Glazing Types: Provide structural, physical and environmental characteristics, size limitations, special handling and installation requirements. C. Product Data on Glazing Compounds and Accessories: Provide chemical, functional, and environmental characteristics, limitations, special application requirements, and identify available colors. D. Samples: Submit two samples 12 by 12 inch in size of glass units. E. Certificate: Certify that products of this section meet or exceed specified requirements. F. Warranty Documentation: Submit manufacturer warranty and ensure that forms have been completed in City's name and registered with manufacturer. 1.05 QUALITY ASSURANCE A. Perform Work in accordance with GANA (GM) for glazing installation methods. B. Manufacturer Qualifications: Company specializing in manufacturing the products specified in this section with minimum three years of documented experience. C. Installer Qualifications: Company specializing in performing work of the type specified and with at least three years documented experience. 1.06 FIELD CONDITIONS A. Do not install glazing when ambient temperature is less than 40 degrees F. 1.07 WARRANTY A. See Section 01 7800 - Closeout Submittals, for additional warranty requirements. B. Manufacturer's Special Warranty for Coated-Glass Products: Manufacturer's standard form in which coated-glass manufacturer agrees to replace coated-glass units that deteriorate within Page 434 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 3 of 8 specified warranty period. Deterioration of coated glass is defined as defects developed from normal use that are not attributed to glass breakage or to maintaining and cleaning coated glass contrary to manufacturer's written instructions. Defects include peeling, cracking, and other indications of deterioration in coating. 1. Warranty Period: 10 years. C. Manufacturer's Special Warranty on Insulating Glass: Manufacturer's standard form in which insulating-glass manufacturer agrees to replace insulating-glass units that deteriorate within specified warranty period. Deterioration of insulating glass is defined as failure of hermetic seal under normal use that is not attributed to glass breakage or to maintaining and cleaning insulating glass contrary to manufacturer's written instructions. Evidence of failure is the obstruction of vision by dust, moisture, or film on interior surfaces of glass. 1. Warranty Period: 10 years. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Float Glass Manufacturers: 1. Pilkington North America Inc: www.pilkington.com/na. 2. PPG Industries, Inc; Basis of Design: www.ppgideascapes.com. 3. Oldcastle Building Envelope: www.obe.com 2.02 PERFORMANCE REQUIREMENTS - EXTERIOR GLAZING ASSEMBLIES A. Provide type and thickness of exterior glazing assemblies to support assembly dead loads, and to withstand live loads caused by positive and negative wind pressure acting normal to plane of glass. 1. Comply with ASTM E1300 for design load resistance of glass type, thickness, dimensions, and maximum lateral deflection of supported glass. 2. Seismic Loads: Design and size glazing components to withstand seismic loads and sway displacement in accordance with the requirements of ASCE 7. 3. Provide glass edge support system sufficiently stiff to limit the lateral deflection of supported glass edges to less than 1/175 of their lengths under specified design load. 4. Glass thicknesses listed are minimum. B. Vapor Retarder and Air Barrier Seals: Provide completed assemblies that maintain continuity of building enclosure vapor retarder and air barrier. 1. In conjunction with vapor retarder and joint sealer materials described in other sections. C. Thermal and Optical Performance: Provide exterior glazing products with performance properties as indicated. Performance properties are in accordance with manufacturer's published data as determined with the following procedures and/or test methods: 1. Center of Glass U-Value: Comply with NFRC 100 using Lawrence Berkeley National Laboratory (LBNL) WINDOW 6.3 computer program. 2. Center of Glass Solar Heat Gain Coefficient (SHGC): Comply with NFRC 200 using Lawrence Berkeley National Laboratory (LBNL) WINDOW 6.3 computer program. 3. Solar Optical Properties: Comply with NFRC 300 test method. 2.03 GLASS MATERIALS Page 435 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 4 of 8 A. Float Glass: Provide float glass based glazing unless otherwise indicated. 1. Kind HS - Heat-Strengthened Type: Complies with ASTM C1048. 2. Kind FT - Fully Tempered Type: Complies with ASTM C1048. 3. Fully Tempered Safety Glass: Complies with ANSI Z97.1 or 16 CFR 1201 criteria for safety glazing used in hazardous locations. 2.04 INSULATING GLASS UNITS A. Manufacturers: 1. Glass: Any of the manufacturers specified for float glass. 2. Fabricator certified by glass manufacturer for type of glass, coating, and treatment involved and capable of providing specified warranty. B. Insulating Glass Units: Types as indicated. 1. Durability: Certified by an independent testing agency to comply with ASTM E2190. 2. Coated Glass: Comply with requirements of ASTM C1376 for pyrolytic (hard-coat) or magnetic sputter vapor deposition (soft-coat) type coatings on flat glass; coated vision glass, Kind CV; coated overhead glass, Kind CO; or coated spandrel glass, Kind CS. 3. Spacer Color:Bronze. 4. Edge Seal: a. Color: Black. 5. Purge interpane space with dry air, hermetically sealed. C. Type IG-1 - Insulating Glass Units: Vision glass, double glazed, safetly glazing 1. Applications: Exterior glazing unless otherwise indicated. 2. Space between lites filled with air. 3. Outboard Lite:Fully tempered float glass, 1/4 inch thick, minimum. a. Tint:Bronze b. Coating: Self-cleaning type, on #1 surface. c. Coating: Low-E (solar control type), Solarban 67 on #2 surface. 4. Inboard Lite:Fully tempered float glass, 1/4 inch thick, minimum. a. Tint: Clear. 5. Total Thickness: 1 inch. 6. Thermal Transmittance (U-Value), Summer - Center of Glass: 0.29, maximum. 7. Visible Light Transmittance (VLT): 05, nominal. 8. Solar Heat Gain Coefficient (SHGC): 12, maximum. 9. Glazing Method: Dry glazing method, gasket glazing. 2.05 PLASTIC FILMS A. Type F-2 - Safety and Security Plastic Film:Micro Layered type. 1. Application: All glazing shown on the drawings 2. Tensile Strength: Minimum of 31,500 psi when measured in accordance with ASTM D882. 3. Color: Clear. 4. Thickness: 8 mil. 5. Manufacturers: a. 3M Scotchshield Ultra 800 . b. Substitutions: See Section 01 6000 - Product Requirements. Page 436 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 5 of 8 2.06 ACCESSORIES A. General: Provide products of material, size, and shape complying with referenced glazing standard, requirements of manufacturers of glass and other glazing materials for application indicated, and with a proven record of compatibility with surfaces contacted in installation. B. Cleaners, Primers, and Sealers: Types recommended by sealant or gasket manufacturer. C. Setting Blocks: Silicone, with 80 to 90 Shore A durometer hardness; ASTM C864 Option I. Length of 0.1 inch for each square foot of glazing or minimum 4 inch x width of glazing rabbet space minus 1/16 inch x height to suit glazing method and pane weight and area. D. Spacer Shims: Neoprene, 50 to 60 Shore A durometer hardness; ASTM C864 Option I. Minimum 3 inch long x one half the height of the glazing stop x thickness to suit application, self adhesive on one face. E. Cylindrical Glazing Sealant Backing: ASTM C 1330, Type O (open-cell material), of size and density to control glazing sealant depth and otherwise produce optimum glazing sealant performance. F. Glazing Splines: Resilient silicone extruded shape to suit glazing channel retaining slot; ASTM C864 Option II; color black. G. Glazing Clips: Manufacturer's standard type. PART 3 EXECUTION 3.01 VERIFICATION OF CONDITIONS A. Verify that openings for glazing are correctly sized and within tolerances, including those for size, squareness, and offsets at corners. B. Verify that surfaces of glazing channels or recesses are clean, free of obstructions that may impede moisture movement, weeps are clear, and support framing is ready to receive glazing system. C. Proceed with glazing system installation only after unsatisfactory conditions have been corrected. 3.02 PREPARATION A. Clean contact surfaces with appropriate solvent and wipe dry immediately before glazing. Remove coatings that are not tightly bonded to substrates. B. Seal porous glazing channels or recesses with substrate compatible primer or sealer. C. Prime surfaces scheduled to receive sealant where required for proper sealant adhesion. 3.03 INSTALLATION, GENERAL Page 437 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 6 of 8 A. Install glazing in compliance with written instructions of glass, gaskets, and other glazing material manufacturers, unless more stringent requirements are indicated, including those in glazing referenced standards. B. Install glazing sealants in accordance with ASTM C1193, GANA (SM), and manufacturer's instructions. C. Do not exceed edge pressures around perimeter of glass lites as stipulated by glass manufacturer. D. Set glass lites of system with uniform pattern, draw, bow, and similar characteristics. E. Set glass lites in proper orientation so that coatings face exterior or interior as indicated. F. Prevent glass from contact with any contaminating substances that may be the result of construction operations such as, and not limited to the following; weld splatter, fire-safing, plastering, mortar droppings, etc. G. Install safety and security plastic film in accordance with manufacturer's instructions. 3.04 INSTALLATION - DRY GLAZING METHOD (GASKET GLAZING) A. Application - Exterior and/or Interior Glazed: Set glazing infills from either the exterior or the interior of the building. B. Place setting blocks at 1/4 points with edge block no more than 6 inch from corners. C. Rest glazing on setting blocks and push against fixed stop with sufficient pressure on gasket to attain full contact. D. Install removable stops without displacing glazing gasket; exert pressure for full continuous contact. 3.05 CLEANING A. Remove excess glazing materials from finish surfaces immediately after application using solvents or cleaners recommended by manufacturers. B. Remove nonpermanent labels immediately after glazing installation is complete. C. Clean glass and adjacent surfaces after sealants are fully cured. D. Clean glass on both exposed surfaces not more than 4 days prior to Date of Substantial Completion in accordance with glass manufacturer's written recommendations. 3.06 PROTECTION A. After installation, mark pane with an 'X' by using removable plastic tape or paste; do not mark heat absorbing or reflective glass units. Page 438 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 7 of 8 B. Remove and replace glass that is damaged during construction period prior to Date of Substantial Completion. END OF SECTION Page 439 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 08 8000 05-11-2023 08 8000 - Glazing Page 8 of 8 This page intentionally left blank Page 440 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2116 05-11-2023 09 2116 - Gypsum Board Assemblies Page 1 of 4 Section 09 2116 Gypsum Board Assemblies PART 1 GENERAL 1.01 SECTION INCLUDES A. Metal stud wall framing. B. Gypsum wallboard. C. Joint treatment and accessories. 1.02 RELATED REQUIREMENTS A. Section 05 4000 - Cold-Formed Metal Framing: Structural steel stud framing. B. Section 07 2500 - Weather Barriers: Water-resistive barrier over sheathing. 1.03 REFERENCE STANDARDS A. ASTM C645 - Standard Specification for Nonstructural Steel Framing Members 2018. B. ASTM C754 - Standard Specification for Installation of Steel Framing Members to Receive Screw-Attached Gypsum Panel Products 2020. C. ASTM C840 - Standard Specification for Application and Finishing of Gypsum Board 2020. D. ASTM C954 - Standard Specification for Steel Drill Screws for the Application of Gypsum Panel Products or Metal Plaster Bases to Steel Studs from 0.033 in. (0.84 mm) to 0.112 in. (2.84 mm) in Thickness 2022. E. ASTM C1002 - Standard Specification for Steel Self-Piercing Tapping Screws for Application of Gypsum Panel Products or Metal Plaster Bases to Wood Studs or Steel Studs 2022. F. ASTM C1047 - Standard Specification for Accessories for Gypsum Wallboard and Gypsum Veneer Base 2019. G. ASTM C1396/C1396M - Standard Specification for Gypsum Board 2017. H. ASTM D3273 - Standard Test Method for Resistance to Growth of Mold on the Surface of Interior Coatings in an Environmental Chamber 2021. I. GA-216 - Application and Finishing of Gypsum Panel Products 2021. PART 2 PRODUCTS 2.01 GYPSUM BOARD ASSEMBLIES Page 441 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2116 05-11-2023 09 2116 - Gypsum Board Assemblies Page 2 of 4 A. Provide completed assemblies complying with ASTM C840 and GA-216. 2.02 METAL FRAMING MATERIALS A. Manufacturers - Metal Framing, Connectors, and Accessories: 1. ClarkDietrich: www.clarkdietrich.com/#sle. 2. Jaimes Industries: www.jaimesind.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. B. Structural Steel Framing for Application of Gypsum Board: See Section 05 4000. C. Non-structural Framing System Components: ASTM C645; galvanized sheet steel, of size and properties necessary to comply with ASTM C754 for the spacing indicated, with maximum deflection of wall framing of L/120 at 5 psf. 1. Studs: C-shaped with knurled or embossed faces. 2. Runners: U shaped, sized to match studs. 2.03 BOARD MATERIALS A. Manufacturers - Gypsum-Based Board: 1. American Gypsum Company: www.americangypsum.com/#sle. 2. Georgia-Pacific Gypsum: www.gpgypsum.com/#sle. 3. USG Corporation: www.usg.com/#sle. 4. Substitutions: See Section 01 6000 - Product Requirements. B. Gypsum Wallboard: Paper-faced gypsum panels as defined in ASTM C1396/C1396M; sizes to minimize joints in place; ends square cut. 1. Application: Use for vertical surfaces, unless otherwise indicated. 2. Mold Resistance: Score of 10, when tested in accordance with ASTM D3273. a. Mold resistant board is required at all locations. 3. Thickness: a. Vertical Surfaces:5/8 inch. 4. Mold Resistant Paper Faced Products: a. American Gypsum Company; M-Bloc Type X: www.americangypsum.com/#sle. b. CertainTeed Corporation; M2Tech 5/8" Type X Moisture & Mold Resistant Drywall: www.certainteed.com/#sle. c. Georgia-Pacific Gypsum; ToughRock Fireguard X Mold-Guard: www.gpgypsum.com/#sle. C. Exterior Sheathing Board: See Section 05 4000. 2.04 GYPSUM BOARD ACCESSORIES A. Water-Resistive Barrier: See Section 07 2500. B. Beads, Joint Accessories, and Other Trim: ASTM C1047, rigid plastic, galvanized steel, or rolled zinc, unless noted otherwise. C. Screws for Fastening of Gypsum Panel Products to Cold-Formed Steel Studs Less than 0.033 inches in Thickness and Wood Members: ASTM C1002; self-piercing tapping screws, Page 442 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2116 05-11-2023 09 2116 - Gypsum Board Assemblies Page 3 of 4 corrosion-resistant. D. Screws for Fastening of Gypsum Panel Products to Steel Members from 0.033 to 0.112 inch in Thickness: ASTM C954; steel drill screws, corrosion-resistant. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that project conditions are appropriate for work of this section to commence. 3.02 FRAMING INSTALLATION A. Metal Framing: Install in accordance with ASTM C754 and manufacturer's instructions. B. Studs: Space studs at 16 inches on center. or as indicated on the structural drawings 1. Extend partition framing to structure where indicated and to ceiling in other locations. 2. Partitions Terminating at Structure: Attach top runner to structure, maintain clearance between top of studs and structure, and connect studs to track using specified mechanical devices in accordance with manufacturer's instructions; verify free movement of top of stud connections; do not leave studs unattached to track. C. Openings: Reinforce openings as required for weight of doors or operable panels, using not less than double studs at jambs. 3.03 BOARD INSTALLATION A. Comply with ASTM C840, GA-216, and manufacturer's instructions. Install to minimize butt end joints, especially in highly visible locations. B. Single-Layer Nonrated: Install gypsum board in most economical direction, with ends and edges occurring over firm bearing. 3.04 JOINT TREATMENT A. Finish gypsum board in accordance with levels defined in ASTM C840, as follows: 1. Level 0: Surfaces indicated to be finished in later stage of project. B. Tape, fill, and sand exposed joints, edges, and corners to produce smooth surface ready to receive finishes. 1. Feather coats of joint compound so that camber is maximum 1/32 inch. END OF SECTION Page 443 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2116 05-11-2023 09 2116 - Gypsum Board Assemblies Page 4 of 4 This page intentionally left blank Page 444 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2236 05-11-2023 09 2236 - Lath Page 1 of 4 Section 09 2236 Lath PART 1 GENERAL 1.01 SECTION INCLUDES A. Metal lath for portland cement plaster. B. Metal lath for manufactured brick masonry. 1.02 RELATED REQUIREMENTS A. Section 04 2613 - Masonry Veneer B. Section 07 2100 - Board and Batt Insulation C. Section 07 2500 - Weather Barriers: Water-resistive barrier under exterior plaster and stucco. D. Section 09 2116 - Gypsum Board Assemblies: Sheathing on exterior walls. 1.03 REFERENCE STANDARDS A. ASTM C847 - Standard Specification for Metal Lath 2018. B. ASTM C933 - Standard Specification for Welded Wire Lath 2018. C. ASTM C954 - Standard Specification for Steel Drill Screws for the Application of Gypsum Panel Products or Metal Plaster Bases to Steel Studs from 0.033 in. (0.84 mm) to 0.112 in. (2.84 mm) in Thickness 2022. D. ASTM C1002 - Standard Specification for Steel Self-Piercing Tapping Screws for Application of Gypsum Panel Products or Metal Plaster Bases to Wood Studs or Steel Studs 2022. E. ASTM C1032 - Standard Specification for Woven Wire Plaster Base 2018. F. ASTM C1063 - Standard Specification for Installation of Lathing and Furring to Receive Interior and Exterior Portland Cement-Based Plaster 2022a. 1.04 SUBMITTALS A. See Section 01 3300 - Administrative Requirements, for submittal procedures. B. Product Data: Provide data on furring and lathing components, structural characteristics, material limitations, and finish. 1.05 QUALITY ASSURANCE Page 445 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2236 05-11-2023 09 2236 - Lath Page 2 of 4 A. Installer Qualifications: Company specializing in performing the work of this section with at least three years of documented experience. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Metal Lath and Accessories: 1. Cemco: www.cemcosteel.com. 2. Clarkwestern Dietrich Building Systems LLC: www.clarkdietrich.com. 3. Structa Wire Corporation; Structa Mega Lath: www.structawire.com/#sle. 4. Substitutions: See Section 01 6000 - Product Requirements. 2.02 FRAMING AND LATH ASSEMBLIES A. Provide completed assemblies with the following characteristics: 1. Maximum Deflection of Vertical Assemblies: 1:360 under lateral point load of 100 lbs. 2. Maximum Deflection of Horizontal Assemblies: 1:240 deflection under dead loads and wind uplift. 2.03 LATH A. Diamond Mesh Metal Lath: ASTM C847, galvanized; self-furring. 1. Weight: To suit applicationcomply with deflection criteria and as specified in ASTM C841 or ASTM C1063 for framing spacing. 2. Weight: 2.5 lb/sq yd. B. Ribbed Metal Lath: ASTM C847, galvanized; 3/8 inch thick. 1. Weight: To suit application______ and as specified in ASTM C841 or ASTM C1063 for framing spacing. 2. Weight: 3.4 lb/sq yd. 3. Backed with treated paper. 4. Location: At all horizontal surfaces C. Corner Mesh: ASTM C1063; Formed sheet steel, minimum 0.018 inch thick, perforated flanges shaped to permit complete embedding in plaster, minimum 2 inch size; same finish as lath. D. Beads, Screeds, Joint Accessories, and Other Trim: Depth governed by plaster thickness, and maximum possible lengths. 1. Material: Formed sheet steel with rust inhibitive primer, expanded metal flanges. 2. Casing Beads with Weep Holes: Square edges. 3. Corner Beads: Radiused corners. 4. Base Screeds: Beveled edges. 5. Control Joints: Accordion profile with factory-installed protective tape, 2 inch flanges. E. Refer to Section 04 7200 for metal lath requirements at cast stone masonry. 2.04 ACCESSORIES Page 446 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2236 05-11-2023 09 2236 - Lath Page 3 of 4 A. Anchorage: Tie wire, nails, and other metal supports, of type and size to suit application; to rigidly secure materials in place, galvanized. B. Fasteners: Self-piercing tapping screws; ASTM C1002 or ASTM C954. C. Tie Wire: Annealed galvanized steel. PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions before starting work. B. Verify that substrates are ready to receive work and conditions are suitable for application. C. For exterior plaster and stucco on stud walls, verify that water-resistive barrier has been installed over sheathing substrate completely and correctly; see Section 07 2500. D. Do not begin until unacceptable conditions have been corrected. E. If substrate preparation is the responsibility of another installer, notify Architect of unsatisfactory preparation before proceeding. 3.02 INSTALLATION - GENERAL A. Install metal lath and furring for Portland cement plaster in accordance with ASTM C1063. B. Install lath and furring for fire-rated assemblies in accordance with requirements of assembly as indicated. 3.03 CONTROL JOINT INSTALLATION A. Locate joints as indicated on drawings and comply with ASTM C1063. 3.04 LATH INSTALLATION A. Apply lath taut, with long dimension perpendicular to supports. B. Continuously reinforce internal angles with corner mesh, except where the metal lath returns 3 inches from corner to form the angle reinforcement; fasten at perimeter edges only. C. Place corner bead at external wall corners; fasten at outer edges of lath only. D. Place base screeds at termination of plaster areas; secure rigidly in place. E. Place 4 inch wide strips of lath centered over junctions of dissimilar backing materials, and secure rigidly in place. Page 447 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2236 05-11-2023 09 2236 - Lath Page 4 of 4 F. Place lath vertically above each top corner and each side of door frames to 6 inches above ceiling line. G. Place casing beads at terminations of plaster finish. Butt and align ends. Secure rigidly in place. H. Place additional strip mesh diagonally at corners of lathed openings. Secure rigidly in place. 3.05 TOLERANCES A. Maximum Variation from True Lines and Levels: 1/8 inch in 10 feet. B. Maximum Variation from True Position: 1/8 inch. END OF SECTION Page 448 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2400 05-11-2023 09 2400 - Cement Plastering Page 1 of 4 Section 09 2400 Cement Plastering PART 1 GENERAL 1.01 SECTION INCLUDES A. Cement plastering. 1.02 RELATED REQUIREMENTS A. Section 04 7200 - Cast Stone Masonry B. Section 07 2500 - Weather Barriers: Water-resistive barrier. C. Section 09 2236 - Lath: Lath, furring, beads, screeds, and joint accessories for plaster base. 1.03 REFERENCE STANDARDS A. ASTM C91/C91M - Standard Specification for Masonry Cement 2023. B. ASTM C150/C150M - Standard Specification for Portland Cement 2022. C. ASTM C206 - Standard Specification for Finishing Hydrated Lime 2014 (Reapproved 2022). D. ASTM C897 - Standard Specification for Aggregate for Job-Mixed Portland Cement-Based Plasters 2015 (Reapproved 2020). E. ASTM C926 - Standard Specification for Application of Portland Cement-Based Plaster 2023. F. ICC (IBC) - International Building Code Most Recent Edition Adopted by Authority Having Jurisdiction, Including All Applicable Amendments and Supplements. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals for submittals procedures. B. Product Data: Provide data on plaster materials and trim accessories. C. Samples: 1. Submit two samples, 36 by 36 inch in size illustrating finish color and texture. 1.05 QUALITY ASSURANCE A. Installer Qualifications: Company specializing in performing the work of this section with minimum three years documented experience. 1.06 FIELD CONDITIONS Page 449 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2400 05-11-2023 09 2400 - Cement Plastering Page 2 of 4 A. Exterior Plaster Work: Do not apply plaster when substrate or ambient air temperature is 40 degrees F or lower, or when temperature is expected to drop below 40 degrees F within 48 hours of application. PART 2 PRODUCTS 2.01 CEMENT PLASTER APPLICATIONS A. Lath Plaster Base: Metal lath. 1. Plaster Type: Factory prepared plaster mix. 2. Number of Coats: Three. 3. First Coat: Apply to a nominal thickness of 3/8 inch. 4. Second Coat: Apply to a nominal thickness of 3/8 inch. 5. Finish: Acrylic. B. Lath Veneer Base: Metal lath. 1. Plaster Type: Factory prepared plaster mix. 2. Number of Coats: Two. 3. First Coat: Apply to a nominal thickness of 3/8 inch. 4. Second Coat: Apply to a nominal thickness of 3/8 inch. 5. Finish: Masonry veneer - refer to 04 2613 - Masonry Veneer 2.02 FACTORY PREPARED CEMENT PLASTER A. Exterior Portland cement plaster system made of scratch and brown base coat, leveling coat with reinforcing mesh, and acrylic finish coat; install in accordance with ASTM C926. 1. Manufacturers: a. LaHabra; Fiber-47 Scratch and Brown: www.lahabrastucco.com. b. Master Builders Solutions; Stucco Base: www.master-builders-solutions.com/en-us c. Parex USA, Inc; Armourwall 300: www.parexusa.com/#sle. B. Premixed Textured Coating: Polymer modified acrylic coating, integrally colored, and trowel applied to substrates prepared in accordance with manufacturer's written installation instructions. 1. Color: As indicated on drawings. 2. Manufacturers: a. Parex USA Inc; AquaSol Sand Smooth: www.parex.com b. La Habra; Prema-Flex smooth:www.lahabrastucco.com c. Sto Corp; Stolit Lotusan, Fine: www.stocorp.com/#sle. 2.03 JOBSITE MIXED CEMENT PLASTER A. Materials: 1. Portland Cement: ASTM C150/C150M, Type I. 2. Masonry Cement: ASTM C91/C91M, Type N. 3. Lime: ASTM C206 Type S. 4. Sand: Clean, well graded, and complying with ASTM C897. 5. Water: Clean, fresh, potable, and free of mineral or organic matter that could adversely affect plaster. Page 450 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2400 05-11-2023 09 2400 - Cement Plastering Page 3 of 4 B. Plaster Mixes: Proportioned in accordance with ASTM C926; parts by volume. 1. First Coat Over Lath: a. Plaster Mix "CM": One part Portland cement, and one part Type N masonry cement. b. Minimum 2-1/2 parts and maximum 4 parts sand, per total volume of cementitious materials. 2.04 ACCESSORIES A. Lath: See Section 09 2236. B. Reinforcing Mesh: 4.5 oz/sq yd alkali-resistant mesh. C. Water-Resistive Barrier: See Section 07 2500. PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions are acceptable prior to starting this work. B. Verify lath is flat, secured to substrate, and joint and surface perimeter accessories are properly in place. C. Verify mechanical and electrical equipment and services located within areas to receive this work have been properly tested and approved. 3.02 Mixing A. Mix only as much plaster as can be used prior to initial set. B. Mix materials dry, to uniform color and consistency, before adding water. C. Protect mixtures from frost or freezing temperatures, contamination, and excessive evaporation. 3.03 APPLICATION A. Apply plaster in accordance with manufacturer's written instructions and comply with ASTM C926. B. Base Coats: 1. Apply base coat(s) to fully embed lath and to specified thickness. 2. Follow guidelines in ASTM C926 and manufacturer's written installation instructions for moist curing base coats and application of subsequent coats. C. Leveling Coat: 1. Apply leveling coat to specified thickness. D. Finish Coats: 1. Primer and Acrylic Coatings: Page 451 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2400 05-11-2023 09 2400 - Cement Plastering Page 4 of 4 a. Remove surface contaminants such as dust and dirt without damaging substrate. b. Apply primer in accordance with manufacturer's instructions. c. Apply finish coating in number of coats and to thickness recommended by manufacturer. 3.04 TOLERANCES A. Maximum Variation from True Flatness: 1/4 inch in 10 feet. 3.05 REPAIR A. Patching: Remove loose, damaged or defective plaster and replace with plaster of same composition; finish to match surrounding area. END OF SECTION Page 452 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 1 of 6 Section 09 2523 Lime Based Plastering PART 1 GENERAL 1.01 SECTION INCLUDES A. Exterior lime based plastering. 1.02 Related Requirements 1.03 Reference Standards A. ASTM C35 - Standard Specification for Inorganic Aggregates for Use in Gypsum Plaster 2001 (Reapproved 2019). B. ASTM C207 - Standard Specification for Hydrated Lime for Masonry Purposes 2018. C. ASTM C842 - Standard Specification for Application of Interior Gypsum Plaster 2005 (Reapproved 2021). D. SOI Standards and Guidelines for Preservation - The Secretary of the Interior's Standards for the Treatment of Historic Properties 2017. 1.04 Submittals A. See Section 01 3300 - Submittals for submittals procedures. B. Product Data: Submit manufacturer's product data and installation instructions for systems specified, demonstrating compliance with requirements. C. Samples: 1. Plaster Finish: Submit 12 inch by 36 inch sample of each required plaster finish. Divide each panel into thirds to illustrate each coat. a. Mount on plywood or hardboard using standard lath as a key. b. Sample shall include viewing pane head and jamb conditions D. Conservation treatment quality control plan. E. Manufacturer's qualification statement. F. Plasterwork restorer's qualification statement. 1.05 Quality Assurance A. Conservation Treatment Quality Control Plan: Prior to commencing work of this section, receive written approval of plan of proposed restoration work. Include the following: 1. Describe methods of protecting surrounding construction and landscape features. Page 453 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 2 of 6 2. Describe sequencing, work procedures, materials, and tools proposed for each type of conservation treatment specified. a. Include effects of likely weather variations on sequencing of treatments, overall construction schedule, and protection methods for completed work. 3. Describe methods for surveying original plasterwork. 4. Describe methods and approach to assure repair materials' matching and compatibility with original building materials. 5. Conservation plan to be reviewed and approved by City, Architect, and Historical Consultant prior to commencement of the work . B. Manufacturer Qualifications: Company specializing in manufacturing products specified in this section, with at least ten years of documented experience. C. Plasterwork Restorer Qualifications: Company specializing in period plaster restoration with minimum ten years of documented experience. 1. Plastering Mechanics: Experienced, with demonstrated proficiency in lime plaster on historic adobe structures. 2. Experience based solely on application of veneer plaster, gypsum plaster, or cement plaster is not sufficient. 3. Minimum year requiement may be waived upon submittal of qualifications to the installer and approval by the City, Architect, and Historical Consultant. D. Copies of Documents at Site: Maintain at the project site a copy of each referenced document that prescribes execution requirements. 1.06 MOCK-UPs A. Provide one mock-up panel 48 inches wide by 48 inches tall using existing exposed masonry wall as substrate to show workmanship and method of blending new work with existing plaster. 1. Divide panels into three sections: a. Install base coat on the entire panel. b. Install second coat full height of panel by width of panel less approximately 9 inches. c. Install finish coat full height of panel by panel width less approximately 18 inches. d. Cure mock-up for two weeks using procedures appropriate for weather conditions. Obtain Architect's review and approval. e. If the review requires rework, prepare second mock-up panel of the same dimensions and characteristics as the first and incorporate Architect¶s review comments. B. Locate where directed. C. Mock-up may remain as part of the work. 1.07 DELIVERY, STORAGE, AND HANDLING A. Deliver materials in original and unopened packaging, with brand names and manufacturer's labels intact and legible. B. Store materials in dry location, fully protected from weather. 1.08 Field Conditions Page 454 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 3 of 6 A. Weather Requirements: 1. Do not apply plaster when ambient temperature is less than 40 degrees F. 2. Do not PART 2 - PRODUCTS 2.01 Materials A. Hydraulic Hydrated Lime: 1. Manufacturers: a. Saint Astier; Natural Hydraulic Lime NHL 3.5: www.stastier.com/#sle. b. Substitutions: As approved by Architect and Histroic Consultant B. Aggregate for Base Coats: Natural sand complying with ASTM C35. C. Aggregate for Finish Coats: ASTM C842. D. Lath and Accessories: 1. Lath: Open veave, self-furring, glass fiber reinforcing lath a. Manufacgturer: Master Builders Solutions b. Product: PermaLath 1000 c. Color: Grey d. Thickness: 1/4" nominal 2. Fasteners: Nails, staples, or other approved metal supports, of type and size to suit application, compatible with lath and plaster, and rigidly securing lath and accessories in place. a. 3" deck screws with 1/4" fender washers galv. or zinc coated 3. Viewing Frame a. 2"x4" nominal clear vertical grain heart redwood b. Glazing: 1/8" think clear Lexan c. Anchors: As indicated on the plans E. Plaster Mixing: 1. Mix materials in accordance with manufacturer's instructions. PART 3 - EXECUTION 3.01 Monitoring A. Monitoring shall be performed by a qualified historian during the preservation process. Historian my stop work if not in accordance with the contract documents and approved Conservation Treatment Quality Control Plan. 3.02 Examination A. Areas of full or partial removal of existing plaster are indicated on drawings. Page 455 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 4 of 6 B. Examine areas indicated for removal and sound them out to confirm extent of work. Additional sections of existing plaster may have deteriorated subsequent to issuance of Contract Documents. C. Sound out existing plaster to determine extent of hollow, separated installation. Mark extent of hollow, separated installation of existing surfaces . 1. Assist Architect and Historical Consultant in examining marked area to confirm extent of area requiring full or partial removal. 3.03 Existing Plaster Removal A. In areas indicated, remove existing plaster to expose underlying masonry substrate. B. Select, employ, and control methods of removal. 1. Do not remove sound plaster. 2. Protect substrate and adjacent materials to remain from damage. 3. Provide scoured or fractured aggregate face on plaster to remain. 4. Leave square-edged profile, 75 degrees to 105 degrees measured between plane of wall and edge thickness, between areas of partial depth and full depth removal. C. Do not use power-operated grinders. 3.04 Plaster Mixing on Site A. Mix plaster in accordance with manufacturer¶s instructions. Do not add water or other materials unless recommended by the manufacturer to obtain desired workability. 3.05 Plaster Application A. General: 1. All work shall comply with the SOI Standards and Guidelines for Preservation and National Park Service Preservation Briefs and Preservation Tech Notes referenced in Applied Earthworks Phase 1 Report. 2. Comply with lime manufacturer's instructions. 3. Comply with application recommendations in Conservation Treatment Quality Control Plan. B. Prefill depressions or low areas in masonry substrate with coats of plaster applied not greater than 3/8 inch nominal to level the surface prior to applying plaster coats. C. Install coats as follows: 1. First or Scratch Coat: 1/8-3/16-inch nominal thickness. 2. Second, Strengthening, or Brown Coat: 5/8-3/4-inch nominal thickness. 3. Top or Finish Coat: One layer of 3/16-3/8-inch nominal thickness. a. Surface Texture: Match Exiting 4. After consolidating the scratch coat and when thumbprint hard, scratch the surface to provide key for subsequent coat. 5. Compact each base coat using a wood float. Rewet, by misting, and float brown coat at least twice to consolidate mortar during drying. Float to open-grained surface to provide sufficient key for finish coat. Page 456 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 5 of 6 6. Float finish coat to compact and provide uniform texture and color finish. Do not overwork. Patch minor imperfections by floating small quantities of fairly dry finish coat mixture into the surface. 7. Uniformity: a. Obtain uniform color within the limits of color variation, as determined by the Architect. 8. Tolerances: Deviation from plane not to exceed 1/8 inch in 10 feet, measured with a straightedge at any location on surface. 9. Curing: a. Allow approximately one to three weeks or more curing time between coats according to temperature and humidity. b. Rewet cured coats before applying subsequent coats. 10. Final Wash Coat: Apply lime wash to surface in three coats, allowing for suction during application and drying between coats. 3.06 Jointing A. Do not bridge expansion or control joints. 3.07 Curing A. Protect plaster against uneven and excessive evaporation of moisture and from strong, dry airflow. 1. Apply and cure plaster as required by climatic and job conditions to prevent drying out during curing period. 2. Cover with plastic sheeting to protect from frost, heavy rain, strong winds, and direct sunlight for minimum of 72 hours after application. 3. Mist plaster surfaces three times per day - morning, noon, and evening - to ensure plaster environment remains at 90 percent relative humidity during the first 72 hours of curing each coat. 4. Do not use commercial curing compounds. 3.08 Adjusting A. Corrective Measures: Cut out and replace defective areas and repair to match acceptable work. 1. Defective Work: Includes, but is not limited to: a. Areas showing cracks, dents, crazing, blisters, and other surface imperfections. b. Areas where bond to substrate has failed. 3.09 Cleaning A. Remove and discard temporary protection after plaster work in each area has been completed. Remove plaster from other exposed surfaces, leaving them in undamaged condition; dispose of packaging materials and plaster debris. END OF SECTION Page 457 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 2523 05-11-2023 09 2523 - Lime Based Plastering Page 6 of 6 This page intentionally left blank Page 458 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 1 of 6 Section 09 3000 Tiling PART 1 GENERAL 1.01 SECTION INCLUDES A. Tile for wall applications. B. Cementitious backer board as tile substrate. C. Ceramic accessories. D. Ceramic trim. E. Non-ceramic trim. 1.02 RELATED REQUIREMENTS A. Section 04 2000 - Unit Masonry Concrete Masonry Walls B. Section 09 2400 - Cement Plastering: Lath and Portland cement scratch coat, where required by the TCNA (HB) Method specified. 1.03 REFERENCE STANDARDS A. ANSI A108/A118/A136 - American National Standard Specifications for the Installation of Ceramic Tile (Compendium) 2019. B. ANSI A118.15 - American National Standard Specifications for Improved Modified Dry-Set Cement Mortar 2019. C. ASTM C847 - Standard Specification for Metal Lath 2018. D. TCNA (HB) - Handbook for Ceramic, Glass, and Stone Tile Installation 2023. 1.04 ADMINISTRATIVE REQUIREMENTS A. Preinstallation Meeting: Convene a preinstallation meeting one week before starting work of this section; require attendance by affected installers. 1.05 SUBMITTALS A. See Section 01 3300 - Submittals for submittal procedures. B. Product Data: Provide manufacturers' data sheets on tile, mortar, grout, and accessories. Include instructions for using grouts and adhesives. Page 459 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 2 of 6 C. Shop Drawings: Indicate tile layout, patterns, color arrangement, perimeter conditions, junctions with dissimilar materials, control and expansion joints, thresholds, ceramic accessories, and setting details. D. Samples: Mount tile and apply grout on two plywood panels, minimum 18 by 18 inches in size illustrating pattern, color variations, and grout joint size variations. E. Installer's Qualification Statement: 1. Submit documentation of National Tile Contractors Association (NTCA) or Tile Contractors' Association of America (TCAA) accreditation. F. Maintenance Materials: Furnish the following for City's use in maintenance of project. 1. See Section 01 6000 - Product Requirements, for additional provisions. 2. Extra Tile:2 percent of each size, color, and surface finish combination, but not less than 10 of each type. 1.06 QUALITY ASSURANCE A. Maintain one copy of and ANSI A108/A118/A136 and TCNA (HB) on site. B. Installer Qualifications: 1. Company specializing in performing tile installation, with minimum of five years of documented experience. a. Accredited Five-Star member of the National Tile Contractors Association (NTCA) or Trowel of Excellence member of the Tile Contractors' Association of America (TCAA). 1.07 MOCK-UPs A. See Section 01 4000 - Quality Requirements for general requirements for mock-up. B. Construct tile mock-up where indicated on drawings, incorporating all components specified for the location. 1. Minimum size of mock-up is indicated on drawings. 1.08 DELIVERY, STORAGE, AND HANDLING A. Protect adhesives from freezing or overheating in accordance with manufacturer's instructions. 1.09 FIELD CONDITIONS A. Maintain ambient and substrate temperature above 50 degrees F and below 100 degrees F during installation and curing of setting materials. PART 2 PRODUCTS 2.01 TILE A. Manufacturers: All products by the same manufacturer. Page 460 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 3 of 6 1. Dal-Tile Corporation: www.daltile.com/#sle. 2. Substitutions: See Section 01 6000 - Product Requirements. B. Gauged Porcelain Tiles and Panels/Slabs:ANSI A137.3 standard grade. 1. Moisture Absorption: 0 to 0.5 percent as tested in accordance with ASTM C373. 2. Size: 12 inch by 24 inch, nominal. 3. Thickness:3/8or7/16inch. 4. Edges: Square. 5. Surface Finish: Polished and Unpolished . 6. Color(s):White UC10. 7. Grout Joint Width: 1/8" 8. Grout Color: As selected by architect form manufacturer's full range. 9. Pattern:As indicated on the drawings. 10. Products: a. Dal-Tile Corporation; Uniform Concrete: www.daltile.com/#sle. 2.02 TRIM AND ACCESSORIES A. Ceramic Accessories: Glazed finish, same color and finish as adjacent field tile; same manufacturer as tile. B. Ceramic Trim: Matching bullnose, double bullnose, cove base, and cove ceramic shapes in sizes coordinated with field tile. 1. Applications: a. Open Edges: Bullnose. b. Inside Corners: Jointed. c. Floor to Wall Joints: Cove base. 2. Manufacturers: Same as for tile. C. Non-Ceramic Trim:Brushed stainless steel, style and dimensions to suit application, for setting using tile mortar or adhesive. 1. Manufacturers: a. Schluter-Systems: www.schluter.com/#sle. 2.03 SETTING MATERIALS A. Provide setting and grout materials from same manufacturer. B. Manufacturers: 1. ARDEX Engineered Cements: www.ardexamericas.com/#sle. 2. Custom Building Products: www.custombuildingproducts.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. C. Improved Latex-Portland Cement Mortar Bond Coat: ANSI A118.15. 1. Applications: Use this type of bond coat where Large and Heavy Tile (LHT) mortar is indicated. 2.04 GROUTS A. Provide setting and grout materials from same manufacturer. Page 461 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 4 of 6 B. Manufacturers: 1. ARDEX Engineered Cements: www.ardexamericas.com/#sle. 2. Custom Building Products: www.custombuildingproducts.com/#sle. 3. Substitutions: See Section 01 6000 - Product Requirements. C. High Performance Polymer Modified Grout: ANSI A118.7 polymer modified cement grout. 1. Applications: Use this type of grout where indicated and where no other type of grout is indicated. 2. Use sanded grout for joints 1/8 inch wide and larger; use unsanded grout for joints less than 1/8 inch wide. 3. Color(s): As selected by Architect from manufacturer's full line. 2.05 THICK-BED MATERIALS A. Mortar Bed Materials: Portland cement, sand, latex additive, and water. B. Cleavage Membrane: No. 15 asphalt saturated felt. C. Membrane at Walls: No. 15 asphalt saturated felt. D. Metal Lath: ASTM C 847, Flat diamond mesh, of weight to suit application, galvanized finish. 2.06 ACCESSORY MATERIALS A. Backer Board: Cementitious type complying with ANSI A118.9; high density, glass fiber reinforced, 7/16 inch thick; 2 inch wide coated glass fiber tape for joints and corners. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that wall surfaces are smooth and flat within the tolerances specified for that type of work, are dust-free, and are ready to receive tile. B. Verify that required wall-mounted utilities are in correct location. 3.02 PREPARATION A. Protect surrounding work from damage. B. Vacuum clean surfaces and damp clean. C. Seal substrate surface cracks with filler. Level existing substrate surfaces to acceptable flatness tolerances. D. Install backer board in accordance with ANSI A108.11 and board manufacturer's instructions. Tape joints and corners, cover with skim coat of setting material to a feather edge. Page 462 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 5 of 6 E. Prepare substrate surfaces for adhesive installation in accordance with adhesive manufacturer's instructions. 3.03 INSTALLATION - GENERAL A. Install tile and grout in accordance with applicable requirements of ANSI A108.1a through ANSI A108.20, manufacturer's instructions, and TCNA (HB) recommendations. B. Lay tile to pattern indicated. Do not interrupt tile pattern through openings. C. Cut and fit tile to penetrations through tile, leaving sealant joint space. Form corners and bases neatly. Align floor joints. D. Place tile joints uniform in width, subject to variance in tolerance allowed in tile size. Make grout joints without voids, cracks, excess mortar or excess grout, or too little grout. E. Form internal angles square and external angles bullnosed. F. Install ceramic accessories rigidly in prepared openings. G. Install non-ceramic trim in accordance with manufacturer's instructions. H. Sound tile after setting. Replace hollow sounding units. I. Keep control and expansion joints free of mortar, grout, and adhesive. J. Keep expansion joints free of adhesive or grout. Apply sealant to joints. K. Prior to grouting, allow installation to completely cure; minimum of 48 hours. L. Grout tile joints unless otherwise indicated. Use standard grout unless otherwise indicated. M. At changes in plane and tile-to-tile control joints, use tile sealant instead of grout, with either bond breaker tape or backer rod as appropriate to prevent three-sided bonding. N. Apply sealant to junction of tile and dissimilar materials and junction of dissimilar planes. 3.04 INSTALLATION - WALL TILE A. On interior walls install in accordance with TCNA (HB) Method W201, mortar bed over concrete and masonry with waterproofing membrane. 3.05 CLEANING A. Clean tile and grout surfaces. 3.06 PROTECTION A. Do not permit traffic over finished floor surface for 4 days after installation. Page 463 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 3000 05-11-2023 09 3000 - Tiling Page 6 of 6 3.07 SCHEDULE END OF SECTION Page 464 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 1 of 6 Section 09 9113 Exterior Painting PART 1 GENERAL 1.01 SECTION INCLUDES A. Surface preparation. B. Field application of paints. C. Scope: Finish exterior surfaces exposed to view, unless fully factory-finished and unless otherwise indicated, including the following: 1. Both sides and edges of plywood backboards for electrical and telecom equipment before installing equipment. 2. Exposed steel surfaces such as structural steel elements 3. Exposed galvanized metal surfaces such as sheet metal flashing, vents, and trim. D. Do Not Paint or Finish the Following Items: 1. Items factory-finished unless otherwise indicated; materials and products having factory- applied primers are not considered factory finished. 2. Items indicated to receive other finishes. 3. Items indicated to remain unfinished. 4. Fire rating labels, equipment serial number and capacity labels, and operating parts of equipment. 5. Stainless steel, anodized aluminum, bronze, terne-coated stainless steel, zinc, and lead. 6. Floors, unless specifically indicated. 7. Brick, glass unit masonry, architectural concrete, cast stone, integrally colored plaster and stucco. 8. Glass. 9. Concealed pipes, ducts, and conduits. 1.02 RELATED REQUIREMENTS A. Section 01 8113 - Sustainable Design Requirements ±LEED for Homes, including VOC restrictions 1.03 DEFINITIONS A. Comply with ASTM D16 for interpretation of terms used in this section. 1.04 REFERENCE STANDARDS A. ASTM C67/C67M - Standard Test Methods for Sampling and Testing Brick and Structural Clay Tile 2021. B. ASTM C410 - Standard Specification for Industrial Floor Brick 2013 (Reapproved 2017). Page 465 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 2 of 6 C. ASTM D16 - Standard Terminology for Paint, Related Coatings, Materials, and Applications 2019. D. ASTM D2369 - Standard Test Method for Volatile Content of Coatings 2020. E. ASTM D6490 - Standard Test Method for Water Vapor Transmission of NonFilm Forming Treatments Used on Cementitious Panels 1999. F. ASTM D7089 - Standard Practice for Determination of the Effectiveness of Anti-Graffiti Coating for Use on Concrete, Masonry and Natural Stone Surfaces by Pressure Washing 2021. G. ASTM E96/E96M - Standard Test Methods for Gravimetric Determination of Water Vapor Transmission Rate of Materials 2022a, with Editorial Revision (2023). H. MPI (APSM) - Master Painters Institute Architectural Painting Specification Manual Current Edition. I. South Coast Air Quality Management District (SCAQMD) Rule 1113. J. SSPC-SP 1 - Solvent Cleaning 2015, with Editorial Revision (2016). K. SSPC-SP 6 - Commercial Blast Cleaning 2007. 1.05 SUBMITTALS A. Product Data: Provide complete list of products to be used, with the following information for each: 1. Manufacturer's name, product name and/or catalog number, and general product category (e.g. "alkyd enamel"). 2. MPI product number (e.g. MPI #47). 3. Cross-reference to specified paint system(s) product is to be used in; include description of each system. B. Samples: Submit three paper "draw down" samples, 8-1/2 by 11 inches in size, illustrating range of colors available for each finishing product specified. 1. Where sheen is specified, submit samples in only that sheen. 2. Paint color submittals will not be considered until color submittals for major materials not to be painted, such as factory finished metals and roof tiles, have been approved. C. Certification: By manufacturer that paints and finishes comply with VOC limits specified. 1.06 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing the products specified, with minimum three years documented experience. B. Applicator Qualifications: Company specializing in performing the type of work specified with minimum three years experience and approved by manufacturer. 1.07 DELIVERY, STORAGE, AND HANDLING Page 466 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 3 of 6 A. Deliver products to site in sealed and labeled containers; inspect to verify acceptability. B. Container Label: Include manufacturer's name, type of paint, brand name, lot number, brand code, coverage, surface preparation, drying time, cleanup requirements, color designation, and instructions for mixing and reducing. C. Paint Materials: Store at minimum ambient temperature of 45 degrees F and a maximum of 90 degrees F, in ventilated area, and as required by manufacturer's instructions. 1.08 FIELD CONDITIONS A. Do not apply materials when surface and ambient temperatures are outside the paint product manufacturer's temperature ranges. B. Follow manufacturer's recommended procedures for producing best results, including testing of substrates, moisture in substrates, and humidity and temperature limitations. C. Do not apply exterior paint and finishes during rain or snow, or when relative humidity is outside the humidity ranges required by the paint product manufacturer. D. Provide lighting level of 80 ft candles measured mid-height at substrate surface. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Provide paints and finishes from the same manufacturer. B. Paints: 1. Base Manufacturer:Dunn Edwards Paints, www.dunnedwards.com 2. Behr Process Corporation: www.behr.com/#sle. 3. PPG Paints: www.ppgpaints.com/#sle. 4. Sherwin-Williams Company: www.sherwin-williams.com/#sle. 2.02 PAINT SYSTEMS - EXTERIOR A. Exterior Surfaces to be Painted, Unless Otherwise Indicated: Including primed metal and plaster. 1. Two top coats and one coat primer. 2. Top Coat(s): Exterior Latex. a. Products: 1) Dunn Edwards EVERSHIELD, Exterior Flat Paint (EVSH10) 2) Dunn Edwards EVERSHIELD, Exterior Velvet Paint (EVSH20) 3) Dunn Edwards EVERSHIELD, Exterior Eggshell Paint (EVSH30) 4) Dunn Edwards EVERSHIELD, Exterior Low Sheen Paint (EVSH40) 5) Dunn Edwards EVERSHIELD, Exterior Semi-Gloss Paint (EVSH50) 6) Dunn Edwards EVERSHIELD, Exterior Gloss Paint (EVSH60) 7) Behr Premium Plus Exterior Flat [No. 4050]. (MPI #10) 8) Behr Premium Plus Exterior Satin Enamel [No. 9050]. (MPI #15) Page 467 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 4 of 6 9) Behr Premium Plus Exterior Semi-Gloss Enamel [No. 5050]. 10) Behr Premium Plus Interior/Exterior Hi-Gloss Enamel [No. 8050]. (MPI #119) 3. Primer: As recommended by top coat manufacturer for specific substrate. 2.03 ACCESSORY MATERIALS A. Accessory Materials: Provide primers, sealers, cleaning agents, cleaning cloths, sanding materials, and clean-up materials as required for final completion of painted surfaces. B. Water and Graffiti- Resistant Treatment: Use clear-drying, penetrating, water-based silicone emulsion for weatherproofing masonry materials and protecting them from graffiti attacks without altering their natural appearance. 1. Properties: a. Total Solids per ASTM D2369: Minimum Nine (9) percent. b. Comply withCalifornia VOC regulations. c. Water Absorption Reduction (Brick) per ASTM C67/C67M: Greater than 96 percent. d. Water Absorption Reduction (CMU) per ASTM C410: 1) Heavy Weight CMU: Greater than 89 percent. 2) Split Face CMU: Greater than 95 percent. e. Water Vapor Transmission per ASTM E96/E96M: 1) Clay Brick: Greater than 85 percent. 2) Concrete Block: Greater than 95 percent. 3) Mortar: Greater than 95 percent. f. Water Vapor Transmission WVT per ASTM D6490: Minimum 88 percent retention. g. Cleanability Level 2 per ASTM D7089 2. Products: a. PROSOCO, Inc; Sure Klean Weather Seal Blok-Guard & Graffiti Control VOC 9: prosoco.com b. Or approved equal c. Substitutions: Section 01 6000 - Product Requirements. C. Patching Material: Latex filler. D. Fastener Head Cover Material: Latex filler. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that surfaces are ready to receive work as instructed by the product manufacturer. B. Examine surfaces scheduled to be finished prior to commencement of work. Report any condition that may potentially effect proper application. C. Test shop-applied primer for compatibility with subsequent cover materials. D. Measure moisture content of surfaces using an electronic moisture meter. Do not apply finishes unless moisture content of surfaces are below the following maximums: 1. Exterior Plaster and Stucco: 12 percent. Page 468 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 5 of 6 3.02 PREPARATION A. Clean surfaces thoroughly and correct defects prior to application. B. Prepare surfaces using the methods recommended by the manufacturer for achieving the best result for the substrate under the project conditions. C. Remove or mask surface appurtenances, including electrical plates, hardware, light fixture trim, escutcheons, and fittings, prior to preparing surfaces for finishing. D. Seal surfaces that might cause bleed through or staining of topcoat. E. Remove mildew from impervious surfaces by scrubbing with solution of tetra-sodium phosphate and bleach. Rinse with clean water and allow surface to dry. F. Exterior Plaster: Fill hairline cracks, small holes, and imperfections with exterior patching plaster. Make smooth and flush with adjacent surfaces. Wash and neutralize high alkali surfaces. G. Galvanized Surfaces: 1. Remove surface contamination and oils and wash with solvent according to SSPC-SP 1. H. Ferrous Metal: 1. Solvent clean according to SSPC-SP 1. 2. Remove rust, loose mill scale, and other foreign substances using using methods recommended in writing by paint manufacturer and blast cleaning according to SSPC-SP 6 "Commercial Blast Cleaning". Protect from corrosion until coated. 3.03 APPLICATION A. Apply products in accordance with manufacturer's written instructions and recommendations in "MPI Architectural Painting Specification Manual". B. Do not apply finishes to surfaces that are not dry. Allow applied coats to dry before next coat is applied. C. Apply each coat to uniform appearance. D. Vacuum clean surfaces of loose particles. Use tack cloth to remove dust and particles just prior to applying next coat. E. Reinstall electrical cover plates, hardware, light fixture trim, escutcheons, and fittings removed prior to finishing. 3.04 CLEANING A. Collect waste material that could constitute a fire hazard, place in closed metal containers, and remove daily from site. END OF SECTION Page 469 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 09 9113 05-11-2023 09 9113 - Exterior Painting Page 6 of 6 This page intentionally left blank Page 470 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 1400 05-11-2023 10 1400 - Signage Page 1 of 4 Section 10 1400 Signage PART 1 GENERAL 1.01 SECTION INCLUDES A. Room and door signs. 1.02 REFERENCE STANDARDS A. 36 CFR 1191 - Americans with Disabilities Act (ADA) Accessibility Guidelines for Buildings and Facilities; Architectural Barriers Act (ABA) Accessibility Guidelines current edition. B. ADA Standards - 2010 ADA Standards for Accessible Design 2010. C. CBC Chapter 11B - California Building Code - Accessibility to Public Buildings, Public Accommodations, Commercial Buildings and Public Housing 2022. D. ICC A117.1 - Accessible and Usable Buildings and Facilities 2017. 1.03 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Signage Schedule: Provide information sufficient to completely define each sign for fabrication, including room number, room name, other text to be applied, sign and letter sizes, fonts, and colors. 1. When room numbers to appear on signs differ from those on drawings, include the drawing room number on schedule. 2. When content of signs is indicated to be determined later, request such information from City through Architect at least 2 months prior to start of fabrication; upon request, submit preliminary schedule. 3. Submit for approval by City through Architect prior to fabrication. C. Samples: Submit two samples of each type of sign, of size similar to that required for project, illustrating sign style, font, and method of attachment. D. Selection Samples: Where colors are not specified, submit two sets of color selection charts or chips. 1.04 QUALITY ASSURANCE 1.05 DELIVERY, STORAGE, AND HANDLING A. Package signs as required to prevent damage before installation. B. Package room and door signs in sequential order of installation, labeled by floor or building. Page 471 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 1400 05-11-2023 10 1400 - Signage Page 2 of 4 C. Store tape adhesive at normal room temperature. 1.06 FIELD CONDITIONS A. Do not install tape adhesive when ambient temperature is lower than recommended by manufacturer. B. Maintain this minimum temperature during and after installation of signs. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Flat Signs: 1. Best Sign Systems, Inc: www.bestsigns.com. Basis of Design 2. Mohawk Sign Systems, Inc: www.mohawksign.com/#sle. 3. Seton Identification Products: www.seton.com/aec. 4. Substitutions: See Section 01 6000 - Product Requirements. 2.02 SIGNAGE APPLICATIONS A. Accessibility Compliance: Signs are required to comply with CBC Chapter 11B, ADA Standards, and ICC A117.1, unless otherwise indicated; in the event of conflicting requirements, comply with the most comprehensive and specific requirements. B. Room and Door Signs: Provide a sign for every doorway, whether it has a door or not, not including corridors, lobbies, and similar open areas. 1. Sign Type: Flat signs with engraved panel media as specified. 2. Provide "tactile" signage, with letters raised minimum 1/32 inch and Grade II braille. 3. Character Height: 1 inch. 4. Sign Height: 2 inches, unless otherwise indicated. 5. Service Rooms: Identify with room names and numbers to be determined later, not those indicated on drawings. 6. Rest Rooms: Identify with pictograms, the names "MEN", "WOMEN" and duplicate in braille. a. Verify gender identity signage for restrooms with city and architect prior to fabrication. 2.03 SIGN TYPES A. Flat Signs: Signage media without frame. 1. Edges: Square. 2. Corners: Square. 3. Wall Mounting of One-Sided Signs: Tape adhesive. B. Color and Font: Unless otherwise indicated: 1. Character Font: As selected by the city. 2. Character Case:Upper case only. 3. Background Color:As selected by City. Page 472 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 1400 05-11-2023 10 1400 - Signage Page 3 of 4 4. Character Color: Contrasting color. 2.04 TACTILE SIGNAGE MEDIA A. Engraved Panels: Laminated colored plastic; engraved through face to expose core as background color: 1. Total Thickness: 1/16 inch. B. Applied Character Panels: Acrylic plastic base, with applied acrylic plastic letters and braille. 1. Total Thickness: 1/8 inch. 2. Letter Thickness: 1/8 inch. 3. Letter Edges: Square. 2.05 ACCESSORIES A. Exposed Screws:Stainless steel. B. Tape Adhesive: Double sided tape, permanent adhesive. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that substrate surfaces are ready to receive work. 3.02 INSTALLATION A. Install in accordance with manufacturer's instructions. B. Install neatly, with horizontal edges level. C. Locate signs and mount at heights indicated on drawings and in accordance with CBC Chapter 11B, ADA Standards and ICC A117.1. D. Protect from damage until Date of Substantial Completion; repair or replace damaged items. 3.03 FIELD INSPECTION A. Per CBC Chapter 11B signs and identification devices shall be field inspected after installation and approved by the enforcing agency prior to the issuance of a final certificate of occupancy per Chapter 1, Division II, Section 111, or final approval where no certificate of occupancy is issued. The inspection shall include, but not be limited to, verification that Braille dots and cells are properly spaced and the size, proportion and type of raised characters are in compliance with these regulations. END OF SECTION Page 473 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 1400 05-11-2023 10 1400 - Signage Page 4 of 4 This page intentionally left blank Page 474 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2113.17 05-11-2023 10 2113.17 - Phenolic Toilet Compartments Page 1 of 4 Section 10 2113.17 Phenolic Toilet Compartments PART 1 GENERAL 1.01 SECTION INCLUDES A. Phenolic toilet compartments. 1.02 RELATED REQUIREMENTS A. Section 10 2800 - Toilet, Bath, and Laundry Accessories. 1.03 REFERENCE STANDARDS A. ASTM A666 - Standard Specification for Annealed or Cold-Worked Austenitic Stainless Steel Sheet, Strip, Plate, and Flat Bar 2023. B. NFPA 286 - Standard Methods of Fire Tests for Evaluating Contribution of Wall and Ceiling Interior Finish to Room Fire Growth 2019. 1.04 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data: Provide data on panel construction, hardware, and accessories. C. Shop Drawings: Indicate partition plan, elevation views, dimensions, details of wall supports, door swings. D. Samples: Submit two samples of partition panels, 4 by 4 inch in size illustrating panel finish, color, and sheen. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Phenolic Toilet Compartments: 1. Partition Systems International of South Carolina; Phenolic Toilet Partitions: www.psisc.com/#sle. 2. Substitutions: Section 01 6000 - Product Requirements. 2.02 PHENOLIC TOILET COMPARTMENTS A. Toilet Compartments: Factory fabricated doors, pilasters, and divider panels made of solid phenolic core panels with through color, floor-mounted headrail-braced. 1. Color: Black Page 475 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2113.17 05-11-2023 10 2113.17 - Phenolic Toilet Compartments Page 2 of 4 2. Fire Rating: Class A B. Doors: 1. Thickness: 3/4 inch. 2. Width: 24 inch. 3. Width for Handicapped Use:36 inch. 4. Height: 72 inch. Set 6" above finsih floor C. Panels: 1. Thickness:3/4 inch. 2. Height: 72 inch. Set 6" above finsih floor D. Pilasters: 1. Thickness:1inch. 2. Width: As required to fit space; minimum 4 inch. 2.03 ACCESSORIES A. Pilaster Shoes: Formed ASTM A666 Type 304 stainless steel with No. 4 finish, 3 inch high, concealing floor fastenings. 1. Provide adjustment for floor variations with screw jack through steel saddles integral with pilaster. B. Head Rails: Hollow stainless steel, 1 inch by 1-1/2 inch size, with anti-grip profile and cast socket wall brackets. C. Wall and Pilaster Brackets:Satin stainless steel; manufacturer's standard type for conditions indicated on drawings. D. Attachments, Screws, and Bolts: Stainless steel , tamper proof type. E. Hardware:Satin stainless steel: 1. Pivot hinges, gravity type, adjustable for door close positioning. a. 14 ga. stainless steel b. Provide self closing hinges at accessible stall 2. Door Latch: Slide type with exterior emergency access feature. Cast Stainless Steel 3. Door strike and keeper with rubber bumper; mounted on pilaster in alignment with door latch. 4. Coat hook with rubber bumper; one per compartment, mounted on door. a. Mount at accessible reach range in accessible stall 5. Door Pull: Stainless Steel. a. Provide accessible door pull at both sides of door at accessible stall PART 3 EXECUTION 3.01 EXAMINATION A. Verify that field measurements are as indicated. B. Verify correct spacing of and between plumbing fixtures. Page 476 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2113.17 05-11-2023 10 2113.17 - Phenolic Toilet Compartments Page 3 of 4 3.02 INSTALLATION A. Install partitions secure, rigid, plumb, and level in accordance with manufacturer's instructions. B. Maintain 3/8 inch to 1/2 inch space between wall and panels and between wall and end pilasters. C. Attach panel brackets securely to walls using anchor devices. D. Attach panels and pilasters to brackets. Locate head rail joints at pilaster center lines. 3.03 TOLERANCES A. Maximum Variation From True Position: 1/4 inch. B. Maximum Variation From Plumb: 1/8 inch. 3.04 ADJUSTING A. Adjust and align hardware to uniform clearance at vertical edge of doors, not exceeding 3/16 inch. B. Adjust hinges to position doors in partial opening position when unlatched. Return out- swinging doors to closed position. C. Adjust adjacent components for consistency of line or plane. END OF SECTION Page 477 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2113.17 05-11-2023 10 2113.17 - Phenolic Toilet Compartments Page 4 of 4 This page intentionally left blank Page 478 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2800 05-11-2023 10 2800 - Toilet, Bath, and Laundry Accessories Page 1 of 4 Section 10 2800 Toilet, Bath, and Laundry Accessories PART 1 GENERAL 1.01 SECTION INCLUDES A. Commercial toilet accessories. B. Under-lavatory pipe supply covers. C. Electric hand/hair dryers. D. Utility room accessories. 1.02 RELATED REQUIREMENTS A. Section 01 3514 - LEED Credit Summary B. Section 01 3515 - LEED Certification Procedures C. Section 06 1000 Rough Carpentry: Concealed supports for accessories, including in wall framing and plates. D. Section 09 3000 - Tiling E. Section 10 2113.19 - Plastic Toilet Compartments. F. Section 22 0000 Plumbing: Toilet and lavatory fixtures 1.03 REFERENCE STANDARDS A. ADA Standards - 2010 ADA Standards for Accessible Design 2010. B. ASTM A123/A123M - Standard Specification for Zinc (Hot-Dip Galvanized) Coatings on Iron and Steel Products 2017. C. ASTM A653/A653M - Standard Specification for Steel Sheet, Zinc-Coated (Galvanized) or Zinc-Iron Alloy-Coated (Galvannealed) by the Hot-Dip Process 2022. D. ASTM A666 - Standard Specification for Annealed or Cold-Worked Austenitic Stainless Steel Sheet, Strip, Plate, and Flat Bar 2023. E. ASTM C1036 - Standard Specification for Flat Glass 2021. F. ASTM C1503 - Standard Specification for Silvered Flat Glass Mirror 2018. 1.04 ADMINISTRATIVE REQUIREMENTS Page 479 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2800 05-11-2023 10 2800 - Toilet, Bath, and Laundry Accessories Page 2 of 4 A. Coordinate the work with the placement of internal wall reinforcement to receive anchor attachments. 1.05 SUBMITTALS A. See Section 01 3300 - Submittals, for submittal procedures. B. Product Data: Submit data on accessories describing size, finish, details of function, and attachment methods. C. Provide LEED submittal forms with the product submittal for each different product and manufacturer. Recycled content, regional distance and materials costs must be identified for each manufacturer and product. Submittals without the LEED forms will be rejected as incomplete. Refer to Specification Section 01 3516 ±LEED Submittal Forms. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Basis of Design: Bobrick. B. Commercial Toilet, Shower, and Bath Accessories: 1. ASI - American Specialties, Inc: www.americanspecialties.com. 2. Bradley Corporation: www.bradleycorp.com. C. Electric Hand/Hair Dryers: 1. American Dryer, Inc: www.americandryer.com. 2. Excel Dryer: www.exceldryer.com. 3. World Dryer Corporation; Basis of Design: www.worlddryer.com. 4. Bobrick Washroom Equipment Inc.: www.bobrick.com D. Provide products of each category type by single manufacturer. 2.02 MATERIALS A. Accessories - General: Shop assembled, free of dents and scratches and packaged complete with anchors and fittings, steel anchor plates, adapters, and anchor components for installation. B. Stainless Steel Sheet: ASTM A666, Type 304. C. Galvanized Sheet Steel: Hot-dipped galvanized steel sheet, ASTM A653/A653M, with G90/Z275 coating. D. Mirror Glass: Annealed float glass, ASTM C1036 Type I, Class 1, Quality Q2, with silvering, protective and physical characteristics complying with ASTM C1503. 2.03 FINISHES A. Stainless Steel: Satin finish, unless otherwise noted. Page 480 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2800 05-11-2023 10 2800 - Toilet, Bath, and Laundry Accessories Page 3 of 4 B. Galvanizing for Items Other than Sheet: Comply with ASTM A123/A123M; galvanize ferrous metal and fastening devices. 2.04 Commercial Toilet Accessories A. Toilet Paper Dispenser:Double roll, surface mounted bracket type, stainless steel, spindleless type for tension spring delivery designed to prevent theft of tissue roll. 1. Products: B. Electric Dryers: Traditional fan-in-case type, with downward nozzle. 1. Style: High speed, energy efficient, fixed nozzle. 2. Cover: Stainless steel with brushed finish. 3. Heater: Capible of rasing 70 degree ambient air to 130 degrees. 4. Fan Control: Hi/low speed switch 5. Total Wattage: 950, maximum. 6. Air Filter: HEPA to remove contaminants 0.3 microns or larger 7. Warranty: 5 years. 8. Product: Verdedri by Workd Dryer as Basis of Design C. Soap Dispenser: Liquid soap dispenser, wall-mounted, surface, with stainless steel cover and stainless steel tank and working parts; push type soap valve, check valve, and window refill indicator, key lock. 1. Minimum Capacity: 40 ounces. 2. Product: B-2111 manufactured by Bobrick. D. Mirrors: Stainless steel framed, 1/4 inch thick annealed float glass; ASTM C1036. 1. Tempered Float Glass: Silvering, protective and physical characteristics in compliance with ASTM C1503. 2. Size: 24 inches wide by 36 inches tall. 3. Frame: 0.05 inchangle shapes, with mitered and welded and ground corners, and tamperproof hanging system; satin finish. 4. Backing: Full-mirror sized, minimum 0.03 inch galvanized steel sheet and nonabsorptive filler material. 5. Product: B-2908 manufactured by Bobrick. E. Seat Cover Dispenser: Stainless steel, surface-mounted, reloading by concealed opening at base, tumbler lock. 1. Minimum capacity: 250 seat covers. 2. Product: B-221 as manufactured by Bobrick F. Grab Bars: Stainless steel, smooth surface. 1. Standard Duty Grab Bars: a. Push/Pull Point Load: 250 pound-force, minimum. b. Dimensions: 1-1/4 inch outside diameter, minimum 0.05 inch wall thickness, exposed flange mounting, 1-1/2 inch clearance between wall and inside of grab bar. c. Length and Configuration: As indicated on drawings. d. Products: B-5806 as manufactured by Bobrick G. Sanitary Napkin Disposal Unit: Stainless steel, surface-mounted, self-closing door, removable receptacle. Page 481 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 10 2800 05-11-2023 10 2800 - Toilet, Bath, and Laundry Accessories Page 4 of 4 1. Product: B-270 manufactured by Bobrick. 2.05 UNDER-LAVATORY PIPE AND SUPPLY COVERS A. Under-Lavatory Pipe and Supply Covers: 1. Insulate exposed drainage piping, including hot, cold, and tempered water supplies under lavatories or sinks to comply with ADA Standards. 2. Exterior Surfaces: Smooth non-absorbent, non-abrasive surfaces. 3. Construction: 1/8 inch flexible PVC. 4. Color: White. 2.06 Utility Room Accessories A. Combination Utility Shelf/Mop and Broom Holder: 0.05 inch thick stainless steel, Type 304, with 1/2 inch returned edges, 0.06 inch steel wall brackets. 1. Hooks: 4, 0.06 inch stainless steel rag hooks at shelf front. 2. Mop/broom holders: Three spring-loaded rubber cam holders at shelf front. 3. Length: 34 inches. 4. Product: B-239 manufactured by Bobrick. PART 3 EXECUTION 3.01 EXAMINATION A. Verify existing conditions before starting work. B. Verify exact location of accessories for installation. C. For electrically-operated accessories, verify that electrical power connections are ready and in the correct locations. 3.02 PREPARATION A. Deliver inserts and rough-in frames to site for timely installation. B. Provide templates and rough-in measurements as required. 3.03 INSTALLATION A. Mounting Heights: As required by accessibility regulations, unless otherwise indicated. END OF SECTION Page 482 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 1 SECTION 22 0000 PLUMBING PART 1 - GENERAL 1.1 DESCRIPTION A. Related Documents: 1. The other Contract Documents complement the requirements of this Section and apply to this Section 2. Division 1 - General Requirements and Section 23 0013 apply to the Work of this Section. 3. Where requirements of this Section exceed those in other Contract Documents, Contractor shall comply with the requirements of this Section. B. Codes and Regulations: 1. California Plumbing Code (CPC). 2. California Mechanical Code (CMC). 3. California Building Code (CBC). 4. California Green Building Standards Code (CGBSC). 5. California Electrical Code (CEC). 6. California Fire Code (CFC). 7. National Fire Code (NFC). 8. National Fire Protection Association (NFPA). 9. Local Building Department. 10. Local Fire Marshal. 11. California Energy Code (CEnC). 12. In the event of conflict between or among specified requirements and pertinent regulations, the more stringent requirements will govern when so directed by the Architect. C. Scope of Work: (Plumbing Section Division 15) 1. Material and labor including rough-in for and connection to fixtures, appliances and equipment are: a. WASTE AND VENT 1. Soil piping 2. Drain waste and vent piping (DWV) Page 483 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 2 3. Indirect waste piping 4. Wet vent piping 5. Floor drains. 6. Traps. 7. Vent flashings. b. WATER 1. Potable water piping systems including, pressure reducing valves, relief valves, balancing valves, water hammer shock absorbers, air chambers. 2. Isolation, Zone and Control Valves. 3. Hot water systems including heaters and storage tanks. 4. Piping for water service. 5. Backflow preventers. 6. Disinfecting of water systems. 7. Insulation of piping and equipment for heat, sound, and vibration. c. ALL PLUMBING FIXTURES AND SUPPORTS 1. Including, but not limited to: (a) Sinks, lavatories, water closets, service sinks, etc., - all materials (b) Supports (backing) for all plumbing fixtures and accessories (c) Installation of sinks in or part of drain boards - all materials d. CONNECTIONS 1. Utilities-Sanitary sewer, storm drain, water, gas 2. Make-up water for heating and cooling systems 3. Hot water tanks 4. Temporary water, waste and air lines 5. The joining of pipe by any mode or method including, but not limited to, acetylene and arc welding, brazing, lead burning, plastics welding, soldering, wiped joints, caulked joints expanded or rolled joints, etc., used in connection with any of the work listed herein Page 484 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 3 e. LAYOUT AND CUTTING 1. Holes, chases, channels, the setting and erection of bolts, inserts, stands, brackets, stanchions, supports, sleeves, escutcheon plates, thimbles, hangers, conduits, and boxes. f. EXCAVATION, TRENCHING AND BACKFILL 1. In connection with plumbing and piping work shown herein g. TEMPORARY PIPING in connection with: 1. Building and construction work 2. Excavating and underground construction h. PIPE HANGERS, SUPPORTS, ANCHORS, GUIDES, EXPANSION JOINTS 1. Including: (a) Supports for equipment to which pipe is connected, such as tank supports (b) Acoustical pipe isolation (c) Isolators-dielectric and vibration (d) Anchors and thrust blocks of concrete, metal, etc. (e) Seismic bracing (1) Anvil/Badger, Mason Industries, B- Line/TOLCO or approved equal. (2) Seismic hanger system design shall comply with current CBC requirements and ASCE 7-05 and 7-10. i. SIGNS AND NOTICES j. ROOF FLASHINGS FOR PIPING PENETRATIONS k. TESTS 1. Piping, for tightness 2. Equipment for performance 3. Operating instructions 4. Final operation 1.2 ACCESSIBLE PLUMBING FIXTURES A. Accessible plumbing fixtures shall comply with all of the requirements of CBC Sections 11B-213, 11B-305, & 11B-308, 11B-Division 6. Page 485 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 4 1.3 QUALITY ASSURANCE A. Use adequate numbers of skilled workers who are thoroughly trained and experienced in the necessary crafts and who are completely familiar with the specified requirements and the methods needed for proper performance of the Work of this Section. B. Without additional cost to the Owner, provide such other labor and materials as are required to complete the Work of this Section in accordance with the requirements of governmental agencies having jurisdiction, regardless of whether such materials and associated labor are called for elsewhere in these Contract Documents. C. Welder's Qualifications: Comply with ASME B31.8. The pipe welder shall have a copy of a certified ASME B31.8 qualification test report. Contractor shall also conduct a qualification test. Submit each welder's identification symbols, assigned number, or letter, used to identify work of the welder. Affix symbols immediately upon completion of welds. Welders making defective welds after passing a qualification test shall be given a requalification test and, upon failing to pass this test, shall not be permitted to work this contract. D. Comply with NSF 14, "Plastics Piping System Components and Related Materials," for plastic, potable domestic water piping and components. Include marking "NSF-pw" on piping. E. Comply with NSF 61, "Drinking Water System Components - Health Effects; Sections 1 through 9," for potable domestic water piping and components. F. Comply with NSF 372, “Drinking Water System Components – Lead Content” for potable domestic water piping and components. SUBMITTALS G. Comply with pertinent provisions of Architectural Division 1 Sections. H. Product Data: Within 35 calendar days after the Contractor has received the Notice to Proceed, submit 1 electronic PDF copy of the following to the Architect for approval prior to acquisition: 1. Materials list of items proposed to be provided under this Section. 2. Manufacturer's specifications, catalog cuts, and other data needed to prove compliance with the specified requirements. All pieces of equipment shall be clearly identified on corresponding manufacturer's literature being submitted. 3. Shop Drawings or other data as required to indicate method of installing and attaching equipment, except where such details are fully shown on the Drawings. Page 486 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 5 4. Submittals for the entire project shall be submitted at the same time or may be rejected until all are included in one submittal package. 5. Submittals shall be provided electronically in PDF format, bookmarked by design tags for equipment and specification sections for materials. Incomplete or noncompliant submittals may be rejected. 1.4 DESIGN CHANGES CAUSED BY PRODUCT SUBSTITUTIONS A. Contractor shall pay costs of design and installation for changes resulting from substitution of alternate products. B. Acceptance of alternate products by Architect does not change this requirement. 1.5 PRODUCT HANDLING A. Comply with pertinent provisions of Architectural Sections. B. Storage and Protection: Store materials protected from exposure to harmful environmental conditions and at temperature and humidity conditions recommended by the manufacturer. PART 2 - PRODUCTS 2.1 WASTE, VENT, SEWER A. Above and Below Grade 1. All waste, vent, sewer and storm lines shall be of cast iron soil pipe and fittings and shall conform to the requirements of CISPI Standard 301, ASTM A-888 or ASTM A-74 for all pipe and fittings. Pipe and fittings shall be marked with the collective trademark of the Cast Iron Soil Pipe Institute and be listed by NSF International. a. Acceptable Manufacturers: 1. AB&I Foundry 2. Charlotte Pipe and Foundry 3. Tyler Pipe Company b. Couplings 1. Standard Couplings: for hubless pipe and fittings shall conform to the manufacturer's installation instructions and local code requirements. Hubless coupling gaskets shall conform to ASTM Standard C-564 and be listed with NSF International. c. Mandatory Referenced Standards Page 487 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 6 1. Cast Iron Soil Pipe Institute Standard Specifications - Latest Issue (a) CISPI 301: Hubless Cast Iron Soil Pipe and Fittings for Sanitary and Storm Drain, Waste, and Vent Piping Applications. (b) CISPI 310: Couplings for use in connection with Hubless Cast Iron Soil Pipe and Fittings for Sanitary and Storm Drain, Waste, and Vent Piping Applications. 2. ASTM Standard Specifications - Latest Issue (a) A-888: Standard Specifications for Hubless Cast Iron Soil Pipe and Fittings. (b) C-564: Standard Specifications for Rubber Gaskets for Cast Iron Soil Pipe and Fittings. 2.2 DOMESTIC WATER PIPING A. Below Grade Water Service outside building 1. 3" NPS and smaller, Schedule 40 PVC Plastic Pipe and fittings. ASTM D1785, D2466, with Solvent Cement Joints ASTM D2564. 2. 2" NPS and smaller, Type K Soft Annealed Temper Copper Tube ASTM B88 with Wrought Copper pressure fittings, ANSI B16.22. SIL-FOS - High temperature Brazing Metal Filler. B. Above Grade (Distribution System inside building) 1. Piping a. For soldered, brazed, and mechanical joints, 4" and smaller Copper Water Tube Type L Annealed Temper (Hard Drawn) ASTM B75 or ASTM B88. 2. Fittings a. Wrought Copper Pressure Solder Fittings, ASME B16.22 or ASME B16-25, 95-5 Tin-Antimony Filler Metal. b. Bronze Flanges: ASME B16.24, Class 150, with solder-joint ends. c. Copper Unions: MSS SP-123, cast-copper alloy, hexagonal-stock body, with ball-and-socket, met-to-metal seating surfaces, and solder-joint or threaded ends. d. Press Fitting: Copper press fittings shall conform to the material and sizing requirements of ASME B16.18 or ASME B16.22. O- rings for copper press fittings shall be EPDM. Press fittings shall have an inboard bead design. Page 488 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 7 1. Copper Press Fittings: Viega/Rigid Tool Company, NIBCO, Elkhart/Apollo Xpress or approved equal. 2. 2"NPS and smaller: Wrought copper fitting with EPDM- rubber O-ring seal in each end. 3. 2-1/2" to 4"NPS: Cast-bronze or wrought copper fitting with EPDM-rubber O-ring seal in each end. e. Installation- Ready™ fittings for grooved end copper tubing shall be manufactured to copper-tube dimensions, ductile iron conforming to ASTM A-536, Grade 65-45-12, with Installation- Ready™ ends, PVDF (Poly Vinylidene Fluoride) and Grade “EHP” EPDM-HP [Grade ‘T’ Nitrile] gasket, and ASTM A449 electroplated steel bolts and nuts, rated to 300 psi (2065 kPa) with Type K or L Copper Tubing. f. All underground water piping within the building boundaries shall be ASTM B88-93a Type "L" annealed (soft) copper tube made up without fittings below the floor level. 2.3 VALVES A. Acceptable Manufacturers: Victaulic, Milwaukee, Hammond, Jomar, NIBCO, others as noted. Type Size Range Part Number Ball 2" and smaller Milwaukee UPBA400 (2 or 3 piece) Hammond UP8301A NIBCO 585-80-LF Victaulic Series P569 Note: Stem extensions of non-thermal-conductive material and protective sleeve that meets UL 2043 approved for inside air plenum and allows operation of value without breaking the vapor seal shall be used on all insulated pipe. NIBCO NIB- Seal handle or acceptable equal. B. All valves in copper piping shall be soldered in or have screwed threads. Copper- tube dimensioned grooved joints are acceptable for 2-1/2” and larger sizes. Threaded valves shall be installed with sweat to screwed adapters. C. Valves used on potable water services shall be UL classified in accordance with NSF-61, and meets the low-lead requirements of NSF-372. 2.4 HANGERS AND SUPPORTS A. In general, all pipe hangers and supports shall conform to the following except where special pipe hangers and supports are detailed on the Drawings. In all cases hanger and support details on the Drawings shall take precedent over the following: Page 489 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 8 Piping 6" Size and Smaller: Items TOLCO Anvil Pipe Hanger 1; 2; 200 260 Side Beam Clamp for Wood Joist 58 207 Beam Coupling for Steel Beams 65 92 Rod Coupling for Connection to "Hilti" 70 135 Inserts in Concrete Decks 107; 109A; 109AF N/A Trapeze Hangers Tolstrut A12 AS200 Pipe Clamp TOLCO cush clamp AS004OD- AS098OD B. Similar items by HOLDRITE, Anvil International, Erico-Caddy, or TOLCO/B- Line will be acceptable. C. Hanger Rods shall conform to the following table: Tube/Pipe Size Rod Diameter 1/2" to 4" 3/8" 5" to 8" 1/2" 10" to 12" 5/8" D. Trapeze hangers may be used where parallel runs of pipe occur. All rods on trapeze hangers shall be 1/2" minimum size. E. Hanger Support Spacing shall be as follows unless shown otherwise on the Drawings: 1. Horizontal: a. Cast Iron: Every other joint unless over 4 feet, then at every joint. b. Copper: Every 6 feet for 1-1/2 inch and smaller, and 10 feet for 2 inch and larger. 2. Vertical: a. Cast Iron: Base and every floor not to exceed 15 feet. b. Copper: Every floor not to exceed 10 feet. F. Refer to the plumbing code for materials not listed above. G. At all points where insulated pipe contacts a hanger or support, the point of contact shall be protected by metal insulation pipe shield #B3153 as manufactured by B-Line. Equivalent pipe protectors will be considered provided the substitute item meets the same standard of quality and performance as the specified item. H. Abrasion-Protection Isolators: Use for prevention of damage to tubes and piping caused by abrasion when passing through or in contact with studs, joists, and similar framing. 1. Products: Page 490 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 9 a. HOLDRITE #200 Series Isolators and Clamps. I. Dissimilar Metal Isolators: Use for prevention of damage to tubes and pipes caused by contact between dissimilar metals. 1. Products: a. HOLDRITE #200 Series Isolators and Clamps. J. Acoustical Noise & Vibration Isolation System: Consisting of through-stud isolators, pipe clamps, riser clamp pads, neoprene and felt lining material and associated support brackets. For applications requiring acoustical isolation of tubing, piping, and equipment from structure. 1. Products: a. HOLDRITE Silencer System with HOLDRITE STOUT Bracket System. K. Seismic restraint devices 1. Available Manufacturers: a. Anvil/Badger b. Mason Industries c. B-Line Tolco Division of Eaton 2. Seismic hanger system design shall meet the requirements of IBC, CBC and ASCE 7-05 and 7-10. 2.5 WALL AND FLOOR PENETRATIONS A. Fire walls and floors: 1. Wall and floor penetrations shall be protected with a U.L. approved fire rated system. The system shall be per the Drawing Details, or other manufacturer’s installation instructions. 2. Fire stopping materials by Hilti, Metacaulk, or 3M are considered equal. The material shall be the same as called out for in the U.L. approved system. B. Poured concrete walls and floors: 1. Pipes penetrating poured concrete walls and floors shall be protected by providing the following: a. A Schedule 40 PVC sleeve one (1) size larger than the pipe or one quarter (1/4) inch of foam material wrapped around and secured to the pipe or packed and caulked with mineral wool. b. Protection shall end flush with the wall or floor surface. Page 491 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 10 C. All walls and floors: 1. Piping passing through walls and floors exposed to view shall be provided with chrome plated split-ring escutcheon plates in finished areas. Brass or galvanized escutcheon plates may be used elsewhere. 2.6 FLASHING A. All flashing shall be 4 lb. sheet lead and all vents penetrating the roof shall be flashed and counter-flashed. Stoneman Co. roof flashing assembly with 10" skirt or equal may be used. B. The flashing for vents penetrating a metal roof shall have a corrosion resistant aluminum base compatible with the roofing system. A rubber type flashing by "Tech Specialties" shall be installed between the flashing and pipe. 2.7 VALVE BOXES A. Brooks Products Inc., Christy Co., or equal with the word "Water" or "Gas" cast in cover as applicable. 2.8 CLEANOUTS A. Provide cleanouts per Drawings and details on Drawings. Cleanouts as manufactured by J.R. Smith, Mifab, Sioux Chief, or Zurn are acceptable substitutes provided they are equal if approved by Engineer. B. Cleanout tops to be installed with tamper-proof screws. 2.9 FLOOR DRAINS, FLOOR SINKS A. Provide floor drains as specified on the Plumbing Fixture Schedule. Cast iron body floor drains as manufactured by J.R. Smith, Mifab, Sioux Chief, or Zurn are acceptable substitutes provided they are equal if approved by Engineer. B. Provide floor sinks as specified on the Plumbing Fixture Schedule. Enameled cast iron floor sinks as manufactured by J.R. Smith, Mifab, Sioux Chief, Zurn, or Commercial Enameling are acceptable substitutes provided they are equal if approved by Engineer. 2.10 WATER HAMMER ARRESTORS A. Provide Wilkins Piston Model #1250XL, Sioux Chief #65X-X, Precision Plumbing Products, or equal, as sized on the Drawings or required by PDI. Install per manufacturer’s instructions. 2.11 AUTOMATIC TRAP PRIMERS A. Provide Precision Plumbing Products, J.R. Smith, Mifab, Sioux Chief, or Zurn as specified on the Drawings. Install per manufacturer's instructions. Page 492 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 11 2.12 PLUMBING FIXTURES A. Fixture locations, quantities, types, sizes and connections shall be as shown on both the Plumbing and Architectural Drawings. If a conflict in fixture location is noted between the Plumbing and Architectural Drawings, the Architectural Drawings shall take precedence. B. Fixtures shall be thoroughly protected against damage to the chrome plate or enamel, by chipping, scratching or other damage during the entire period of construction. Roof drains, floor sinks and drains, toilet and sink drains, plumbing vents, and all other similar fixtures shall be covered to prevent trash from entering the pipes until final installation of grates, domes, fixtures or other protective devices. C. Provide fixtures as specified in the Plumbing Fixture Schedule. D. Stainless Steel lavatories or sinks: Just, Elkay, Advance Tabco, Haws, or Acorn are acceptable substitutes provided they are equal if approved by Engineer. E. Vitreous China fixtures: American Standard, Kohler, Mansfield, Sloan, Toto, or Zurn are acceptable substitutes provided they are equal if approved by Engineer. F. Fixture carrier numbers listed are as specified on the Plumbing Schedule; however, carriers as manufactured by J.R. Smith, Mifab, or Zurn are acceptable provided they are equal. 2.13 CONNECTORS A. Provide Brass Craft "Speedway" or equal heavy pattern iron pipe size brass stops, rigid or flexible supplies and chrome plated brass "P" traps. Stops in "Public" areas are to have screwdriver slots and those in "Private" areas are to have all cross handles. B. Provide Brass Craft or equal flexible stainless steel braided water supplies to appliances. They may also be used to fixtures as an option to rigid supplies. Aquaflo is an acceptable substitute. 2.14 ACCESS BOXES A. See section 15100 for access panels. 2.15 BACKFLOW PREVENTORS A. Provide all potable water outlets with hose attachments with non-removable hose bibb backflow preventers per the C.P.C. 2.16 WATER HEATERS A. Provide water heaters as specified in Plumbing Schedule or approved equal of size, capacity, recovery, and KW/BTUH input. American, A.O. Smith, Bradford White and State are considered equal. Heater shall be A.G.A. or U.L. listed. Page 493 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 12 1. Heater storage tank shall be provided with magnesium anodes, approved standard pressure/temperature relief valve and all standard factory trim. 2. Provide approved flexible copper supplies for the water heater water connections. B. Provide an aluminum Smitty Pan Mfg. Co. overflow pan with 1” drain outlet or equal under water heater as specified on the drawings. Oatey, HOLDRITE, & Benjamin Mfg. Co are considered equal. 2.17 PRESSURE-TEMPERATURE RELIEF VALVE A. Pressure-temperature relief valve shall be Wilkins TP220, TP3000 series, or equal. B. Piping from valve to termination shall be Type L Copper, hard drawn with wrought copper pressure fittings and 95-5 tin antimony filler metal. 2.18 EXPANSION TANK A. Expansion tank shall be Wilkins XT series as specified on the Drawings or approved equal in size and capacity. Amtrol expansion tanks are considered equal. Expansion tanks shall be lead-free for use in domestic water piping system. 2.19 WATER HEATER SEISMIC RESTRAINTS A. Seismic restraints shall be Watts Spacemaker restraint system Model E-50 or E- 100 as applicable for the water heater specified. Spacemaker Model #TSE-25 or Seismik Model #SR-2 may be substituted when first approved by the Engineer. Refer to details on drawings for additional specifications. 2.20 INSULATION A. All pipe insulation shall conform to Section 120.3 of the California Energy Efficiency Standards except to the extent that this Specification supersedes the minimum standards as established by the Code, in which case this Specification shall take precedent. Outside insulation shall be protected with a hard plastic or metal shell covering. B. Insulation and lining material shall meet requirements of flame spread not to exceed 25 and smoke developed not to exceed 50 as tested by Procedure ASTM- E-84, NFPA 255 or U.L. 723 and shall conform to NFPA 90A and 90B. C. Interior primary condensate piping shall be insulated with Armacell AP/Armaflex tube insulation with reinforced lap seal or approved equal. D. Domestic cold water piping shall be insulated with a minimum 1" insulation in unheated areas of the building and where exposed outside of the building. E. Domestic hot water piping shall be insulated with Owens-Corning Fiberglass heavy density pipe insulation 25 ASJ/SSL-II (All Service Jacket/Double/ Self- Page 494 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 13 Sealing Lap). Insulation shall be UL rated non-combustible pipe insulation with a k factor of 0.24-0.28 @ 100 degrees F. mean temperature, an embossed vapor barrier laminated and pressure sealing lap adhesive. All lap and butt strips shall have integral pressure-sensitive strips and shall be applied in strict accordance with manufacturer's instructions. 1. Closed cell polyethylene foam by IMCOA or equal may be used at Contractor's option provided it meets the above requirements. F. Insulation thickness’ shown below are based on insulation having a conductivity range of 0.22 to 0.28 per BTU/inch per hour per square foot per qF temperature of 100 degrees F. Temperature Range: Above 105qF-140qF Pipe Size Minimum Insulation Wall Thickness 1" and less 1.0" 1.25" 1.5" 1.5” 1.5” 2” and more 2.0” G. Insulation materials not meeting the specified conductivity range shall be submitted for approval and determination of the insulation thickness required. PART 3 - EXECUTION 3.1 GENERAL CONDITIONS A. Examine the areas and conditions under which Work of this Section will be performed. Conditions detrimental to timely and proper completion of the Work shall be brought to the attention of the Architect before the installation of materials. Do not proceed until unsatisfactory conditions are corrected. Incorrectly installed materials requiring changes will be at Contractor's expense. B. All plumbing fixtures, appliances, and appurtenances furnished with manufacturer's installation instructions shall be installed per those instructions. 3.2 PLUMBING SYSTEM LAYOUT A. Lay out the plumbing system in careful coordination with the Drawings. Determine proper elevations for all components of the system and use only the minimum number of bends to produce a satisfactorily functioning system. B. Follow the general layout shown on the Drawings in all cases except where other Work may interfere. C. Lay out pipes to fall within partitions, walls, or roof cavities, and to not require furring other than as shown on the Drawings. Page 495 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 14 3.3 PIPING INSTALLATION A. Pipe sizes as shown on drawings are Nominal Pipe Size (NPS) or Iron Pipe Size (IPS). Drawings and fixture schedule indicate pipe sizing per the CPC and Standard Engineering Practice. Pipe sizes shall be maintained to fixtures, appliances and equipment. Approved reducing fittings shall be installed at all points of connections. B. Install piping generally square with building, free of traps or air pockets, and true to line and grade. Keep all piping tight to the building structure, unless pipe slope is required. Do not install piping in any locations where, in the Architect's opinion, it will interfere with the use of the building or create a safety hazard. Where space is inadequate, notify the Architect in time to avoid unnecessary Work. Install all exposed piping as high as possible without interfering with other trades. C. Make changes in direction with manufactured fittings; use long radius elbows. Street elbows, bushings, close nipples and bending of pipe or tubing will not be allowed. D. Provide "P" traps at sanitary sewer drainage devices without integral traps. E. Underground plastic pipe will horizontally transition to metal pipe 5 feet before the above ground riser. Install plastic pipe with a minimum of 36" of cover when located under areas of possible vehicle traffic. Approved metallic pipe must be used if the minimum depth is not met. A tracer wire, terminating at each end at an exposed location, will be installed with all underground plastic pipe. Gas piping will also have a continuous tape marked "Gas" laid 6" above it. 1. Piping may terminate a maximum of one foot above ground when encased in a listed metallic transition riser. F. Use friction wrenches when installing brass, polished, or soft metal piping, and when installing piping exposed in finished areas. Replace piping showing wrench marks. G. Attach escutcheon plates to pipes with set screws or spring clamps with concealed hinges. Continue insulation through escutcheon plates. H. General: 1. Proceed as rapidly as the building construction will permit. 2. Thoroughly clean items before installation. Cap pipe openings to exclude dirt until fixtures are installed and final connections have been made. 3. Cut pipe accurately, and work into place without springing or forcing, properly clearing windows, doors, and other openings. Excessive cutting or other weakening of the building will not be permitted. Page 496 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 15 4. Show no tool marks or threads on exposed plated, polished, or enameled connections from fixtures. Tape all finished surfaces to prevent damage during construction. 5. Provide sufficient swing joints, ball joints, expansion loops, and devices necessary for a flexible piping system, whether or not shown on the Drawings. 6. Support piping independently at pumps, coils, tanks, and similar locations, so that weight of pipe will not be supported by the equipment. Support the equipment independently from the pipe. 7. Pipe the drains from mechanical equipment, drip pans, relief valves, air vents and similar locations, to an open sight drain, floor drain, or other acceptable discharge point, and terminate with an air break or air gap per C.P.C. 8. Securely bolt all equipment, isolators, hangers, and similar items in place. 3.4 HANGER AND PIPE SUPPORT INSTALLATION A. Support pipes from structure with assemblies specified. Provide auxiliary members, anchors, guides, and sway braces necessary to maintain pipe alignment and prevent excessive movement or strain on piping system or components; allow for expansion and contraction of piping. Provide at least one hanger for each branch. Do not use powder driven fasteners, wire, perforated tape, nails, wood blocking, or other makeshift devices to support pipe. B. Install hangers and supports to allow controlled thermal and seismic movement of piping systems, to permit freedom of movement between pipe anchors, and to facilitate action of expansion joints, expansion loops, expansion bends, and similar units. C. Isolate piping systems from building structure to minimize noise transfer by using acoustical suspension isolator silencer and bracket system. D. Protect tubing and piping from damage caused by abrasion when passing through studs, joists, and similar framing using abrasion protection isolators. E. Penetration Protection: Provide allowance for thermal expansion and contraction of copper tubing passing through a wall, floor, ceiling or partition by wrapping with an approved tape or pipe insulation, or by installing through an appropriately sized sleeve. Penetrations of fire resistance rated assemblies shall maintain the rating of the assembly. F. Prevent damage to piping and tubing caused by contact between dissimilar metals using insert system designed specifically for this application. G. Attach supports to structure with bolts, screws or concrete anchors, per support manufacturer’s requirements. Page 497 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 16 H. Use pipe positioning systems in pipe spaces behind plumbing fixtures to support supply and waste piping for plumbing fixtures. I. CPVC Piping Systems: Provide necessary allowance in piping systems to handle expansion and contraction. Install ample swings or offsets in branch connections to avoid undue strains on fittings or short pipe supplies. Provide expansion loops and pipe anchors as required and/or indicated on the drawings. Refer to manufacturers’ recommendations for proper loop sizing of CPVC piping systems. 3.5 JOINTS AND CONNECTIONS A. Cut pipe shall be reamed to full inside diameter of pipe. Cut threads straight and true. Insure all filings have been removed from inside of the pipe. Apply liquid Teflon to male pipe threads and not inside fittings. Use graphite on cleanout plug threads. B. Couplings in cast iron "No-Hub" soil/waste pipe and fittings shall be made up with neoprene gaskets and stainless steel bands conforming to CISPI 310, torque to the manufacturer's specification with an approved torque wrench. Joints in hub and spigot shall be made up with compression gaskets conforming to ASTM C- 564. C. Joints in copper tube shall be made with 95-5 tin-antimony or lead-free solder, applied in strict accordance with the manufacturer's directions. D. Dissimilar metals shall be isolated with dielectric couplings, "EPCO" or approved equal. Dielectric Waterway Fittings shall be UL classified in accordance with ANSI / NSF-61 for potable water service, Victaulic Style 647. Provide access panels at all hidden couplings. E. Press Connections: Copper press fittings shall be made in accordance with the manufacturer’s installation instructions. The tubing shall be fully inserted into the fitting and the tubing marked at the shoulder of the fitting. The fitting alignment shall be checked against the mark on the tubing to assure the tubing is fully engaged (inserted) in the fitting. The joints shall be pressed using the tool approved by the manufacturer. 3.6 SANITARY SEWER, VENT AND INDIRECT WASTE SYSTEM INSTALLATION A. Install horizontal drainage piping at a minimum 2%, condensate 1%, slope unless otherwise noted. Where this is impractical notify the Architect before installing the pipes. B. Install vent piping to drain back into the sewer system. C. Provide cleanouts where shown on Drawings and where required by governmental agencies having jurisdiction. Page 498 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 17 1. All cleanouts to grade shall be firmly secured by means of a concrete block 20" square by 5" thick, and shall be flush with finished grade, unless otherwise noted on the plans. D. Provide automatic trap primers as specified at floor sinks and drains as indicated on Drawings or where required by governmental agencies having jurisdiction. Provide access panels for all hidden mechanical trap primers. 3.7 VALVE INSTALLATION A. Provide valves in the water system. Locate and arrange to provide complete regulation of apparatus, equipment, and fixtures. B. Provide valves in at least the following locations: 1. In branches and/or headers of water piping serving a group of fixtures. 2. On both sides of apparatus and equipment. 3. For shutoff of risers and branch mains. 4. For flushing and sterilizing the system. 5. Where shown on the Drawings. C. Locate valves for easy accessibility and maintenance. Provide access panels for all hidden valves. D. Unions shall be installed downstream of all screwed valves. 3.8 WATER HAMMER ARRESTOR INSTALLATION A. Provide water hammer arrestor on hot and cold water lines. 1. Install at all quick closing valves, solenoids, and supply headers at plumbing fixture groups. 2. Locate and size as shown on Drawings, and where not shown, locate in accordance with Plumbing and Drainage Institute Standard WH-201. 3. Install water hammer arrestor behind access panels. 3.9 BACKFLOW PREVENTION INSTALLATION A. Protect plumbing fixtures, faucets, hose connections, and other equipment having plumbing connection, against possible back-siphonage. B. Arrange for testing of backflow devices as required by the governmental agencies having jurisdiction. 3.10 PLUMBING FIXTURE INSTALLATION A. Connect plumbing services to fixtures as shown on Drawings and as specified. Page 499 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 18 B. Provide & install compression stops and flexible supplies per fixture manufacturer’s recommendation or as high as possible on wall directly below fixtures. C. Install fixtures at right angles to, and tightly against, building surfaces, and in proper alignment. Fill gaps between fixtures and building surfaces with white grout. Mounting heights and locations shall be as shown on the Drawings, or, if not shown, as directed by the Architect. 3.11 INSULATION INSTALLATION A. Ensure surfaces are clean and dry surfaces to application of insulation or adhesives. B. Insulate piping, fittings, valves, and strainers. Leave unions exposed. Where insulation terminates, bevel ends of insulation and continue jacket over insulation and secure to pipe. Do not interrupt insulation at hangers, supports, clamps, or penetrations through structure. Fittings shall be finished with "Zeston" or approved equal fitting closures. If fitting closures not available, use 8 oz. canvas dipped in "Seal-Fas". C. Attach longitudinal jacket laps and butt strips with factory applied pressure sensitive adhesive. On concealed piping only, outward clinching coated staples at two inch spacing may be used. Cover elbows with one piece polyvinyl chloride covers. Secure with tack fasteners. Tape ends of covers with matching tape on exposed piping. Seal off all cut ends with canvas and Benjamin Foster 30-36. D. Install closed cell polyethylene foam per manufacturer’s instructions. E. Insulate traps and trap arms on floor sinks located above slab receiving discharge from ice machines and soda dispensers with ½” insulation. F. Insulate primary condensate piping located within return air plenums with ½” wall thickness. 3.12 TESTING AND ADJUSTING A. Provide personnel and equipment, and arrange for and pay the costs of, all required tests and inspections required by governmental agencies having jurisdiction. See Section 15100 for test requirements. B. Where tests show materials or workmanship to be deficient, replace or repair as necessary, and repeat the tests until the specified standards are achieved. C. Adjust the system to optimum standards of operation. Page 500 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10-11-2022 22 0000 - Plumbing Page 19 3.13 CLEANING (For potable water systems) A. Disinfection: The hot and cold water distribution system shall be disinfected prior to being placed in service. The system shall be disinfected within 3 weeks of occupancy in accordance with AWWA C651 or the following requirements: 1. The piping system shall be flushed with potable water until discolored water does not appear at any of the outlets. 2. The system shall be filled with a water chlorine solution containing at least 50 parts per million of chlorine. The system shall be valved off and allowed to stand for 24 hours. Or, the system shall be filled with a water chlorine solution containing at least 200 parts per million of chlorine. The system shall be valved off and allowed to stand for 3 hours. 3. Following the standing time, the system shall be flushed with water until the chlorine is purged from the system. 4. Provide bacteriological sampling and analysis results to the Engineer for review. 3.14 WARRANTY A. The contractor shall warranty all systems for proper operation installed by the contractor for not less than one calendar year from date of project completion. This completion date shall be set by the Architect or owner. END OF SECTION 22 0000 Page 501 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 1 SECTION 23 0013 GENERAL MECHANICAL REQUIREMENTS PART 1 - GENERAL 1.1 DESCRIPTION A. Related Documents: 1. The other Contract Documents complement the requirements of this Section. 2. Division 1 - General Requirements applies to the Work of this Section. 3. Where requirements of this Section exceed those in other Contract Documents, Contractor shall comply with the requirements of this Section. B. Codes and Regulations: 1. In addition to complying with the specified requirements, comply with pertinent regulations of governmental agencies having jurisdiction. C. Included: Work includes, but is not limited to the following: 1. Plumbing 2. Carpentry and metal Work required for Work of this Section and not specifically shown under another Section. Openings in concrete or masonry construction shall be either core drilled or saw cut unless indicated otherwise on Drawings. 3. Excavation and Backfill 4. Coordination Drawings D. Related Work: 1. Painting (Division 09) 2. Cutting and Patching (Division 30) 3. Low voltage electrical control (Division 26) 1.2 DEFINITIONS A. Furnish: Purchase and deliver to job site in new condition. B. Install: Receive and store at job site until required; place secure and connect; furnish required appurtenances. C. Provide: Furnish and install as defined above. D. Section: Refers to a Section of these Specifications. E. Standards: The issue in effect as of the date of the contract documents. Page 502 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 2 1.3 PROJECT RECORD DRAWINGS A. Comply with pertinent provisions of Architectural Sections (Division 1). 1.4 SERVICE INTERRUPTIONS A. When Work of this Section requires temporary shutdown of existing systems for connections, the shutdown shall be made only during pre-arranged time agreeable to the Owner. 1.5 CORRELATION, INTERPRETATION AND INTENT OF CONTRACT DOCUMENTS A. The Mechanical Drawings are, in general, made to scale and the Contractor may obtain approximate distances and dimensions by scaling the Plans. It is distinctly understood, however, that it is done entirely at the Contractor's responsibility. Refer to Architect's Plans and Specifications for construction details, which will affect the Work and equipment. Examine the Architectural, Civil, Structural, Mechanical, Electrical, Landscape, Irrigation, Data, Fire Protection and Plumbing Plans and Specifications to ensure that this work does not conflict with the above trades. Plumbing, Mechanical and Electrical Plans are diagrammatic and, therefore, do not necessarily represent the exact installation. However, pipe sizing for utility services and ductwork are calculated per their respective codes and Standard Engineering Practice and shall be installed as sized from point of origin to terminal point. It shall remain the Contractor's responsibility to submit Shop Drawings if he/she has any questions about the final arrangement. Nothing on these Plans or Specifications shall be construed to permit work not conforming to all applicable codes and regulations. PART 2 - PRODUCTS 2.1 ACCESS PANELS A. If not called for under other Sections, furnish Milcor, Elmdor, or Jay R. Smith access panels where shown on the Drawings or required for maintenance access to completed Work of this Section. Submit size, type, and location of proposed access panels not specifically shown, for review by Architect. B. Access panels shall be constructed of 16 gauge prime coated steel or stainless steel with screwdriver operated cam latch, concealed hinges, and fire rating equal to adjacent construction. C. Provide flush type doors with: 1. Stainless steel finish for tiled surfaces. 2. Prime coated finish for other surfaces. Page 503 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 3 2.2 FLASHING A. Provide watertight flashing at all openings through exterior walls and roof. Refer to Architectural Drawings. 2.3 PIPE WRAPPING A. All pipe, metal components, and joints buried in ground shall be primed and protected with 10-mil tape double wrapped or approved equal per IAPMO IS 13- 2006. Before tape application, all bare pipe and fittings to be wrapped must be coated with pipe wrap primer. Stretch first layer of tape to conform to the surface while spirally half-lapping, apply a second layer, half-lapped and spiraled as the first layer with spirals perpendicular to first wrapping. In lieu of tape wrap, heat shrinkable 10-mil minimum thick polyethylene sleeve may be used. B. When applying tape, use only enough pull to cause the tape to properly conform to the irregular surfaces of the item. The proper amount of pull is reached when the tape surface is smooth without any wrinkles. Continue tape 4" above grade. End overlaps should point down. Tape shall be applied per manufacturer’s installation instructions. 2.4 GENERAL EQUIPMENT INSTALLATION REQUIREMENTS A. Install equipment to provide neat appearance, required manufacturer’s access, and required space to allow replacement or maintenance. Provide bases, supports, anchor bolts, and other items required to install equipment. Installation shall be level and braced per CBC. 2.5 COORDINATION OF WORK A. Coordinate Work of this Section with Work of other Sections to avoid conflicts. If required, provide shop drawings and submit to Architect for approval. B. Insure that Work of other Sections is suitable to accommodate Work of this Section. 2.6 ADEQUACY OF FURRING A. Conceal piping and ductwork in spaces provided unless specifically shown otherwise. If spaces are inadequate, notify Architect prior to ordering materials and fabrication of components. 2.7 PROTECTION AND CLEANING A. Protect equipment from dirt, moisture, and mechanical damage during construction. Restore or replace damaged equipment to original condition. B. Keep interior of piping free of foreign material during construction. Flush piping systems with test medium specified under Piping Tests before installing equipment and appurtenances or making final connections. Page 504 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 4 2.8 CLOSING-IN OF UNINSPECTED WORK A. Do not conceal or cover Work before tests and observations are completed. Uncover Work prematurely closed in and repair resulting damage to all Work, if requested by Architect, Engineer, or Project Inspector. 2.9 DAMAGE A. Repair or replace items damaged by leaks or overflow from Work provided under this Section and for any damage to any part of the project site, for a period of 1 year after notice of completion date. This is in addition to and not a limitation of other rights the Owner may have against the contractor under the Contract Documents. 2.10 MECHANICAL SYSTEM TESTING A. Furnish all test pumps, gauges, and equipment. Test all safety controls and devices. B. For air tests, install a calibrated test pressure gauge in the piping system to observe any loss in pressure. Calibrate the test pressure gauge with a dead weight tester within 15 days before use and certify by initial and date on a sticker applied to the dial face. Maintain the required test pressure for the time indicated. Brush joints with a soapy water solution to check for leaks if the required pressure cannot be maintained. C. After any test, repair all leaks found as directed and re-test as necessary until the system is proven tight. D. Before applying test pressure to any piping systems the Contractor shall be responsible for isolating all equipment e.g. control valves, regulators, relief devices, tanks and any other line accessories, which would otherwise be damaged by the test pressure. 1. Soil, Waste, Vent: a. Entire System: Tightly close all openings except the highest one. Fill to overflowing with water. b. Sections of System: Tightly close all openings except the highest opening of the section under test. Fill section with water to test each section with a minimum 10-foot head of water except for the uppermost 10 feet of the system. c. Allow to stand for (4) hours or longer, as required to complete the inspection. 2. Domestic Water: Fill with water and test at 150 psig. Retain for (4) hours. Page 505 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 5 2.11 CUTTING AND PATCHING A. The Contractor shall do all cutting and patching which may be required for the installation of the Work under this Division of the Specifications. Patching shall be of the same quality, materials and finish as, and shall match accurately, all surrounding construction. No cutting of the Structure shall be permitted without the approval of the Architect. B. Wherever concrete or paved surfaces are cut to provide for the installation under this Section, the Contractor shall restore the surfaces to their original condition. Subgrade materials, concrete, and paving materials, along with the placement of same, shall be in accordance with the respective Sections of this Specification as they apply to the installation of such material. 2.12 EXCAVATION AND BACKFILL: (Buried pipes within the building walls and to 5 feet from the building.) A. Dig trenches straight and true to line and grade; bottom shall be left smoothed of rock points. Pipe shall be supported for the entire length on undisturbed, original earth. The minimum trench width shall be 16" and all pipe shall be 2 feet below the finished grade, minimum, wherever conditions permit. Sewer pipes to be below grade a s necessary to meet the slope and invert on the Drawing. Whenever substantial variations of pipe bury is indicated by field conditions, the proposed changes in depth of bury shall be submitted, in writing, to the Architect for approval. B. All piping shall be laid on a bed of clean dry sand not less than 6" thick. The space between the pipe and the sides of the trench shall be backfilled with clean dry sand to a point 6" above the crown of the pipe. Both sides of the pipe shall be filled at the same time. C. Installation of Thermoplastic Pipe and Fittings: Trench width for thermoplastic sewer pipe shall be 1.25 times the outside diameter of the piping plus 12 inches or the outside diameter of the piping plus 16 inches. Thermoplastic piping shall be bedded in not less than 4 inches of granular fill supporting the piping. The backfill for thermoplastic piping shall be compacted along the sides of the piping in 6 inch layers and continue to not less than 12 inches above the piping. Compaction shall be not less than a 85 percent standard proctor density. D. The remainder of the trench shall be backfilled with native soil in lifts no greater than 12" and shall be mechanically compacted by tamping so to maintain a minimum relative dry density of 95%, determined by California Impact Test Method No. 216. E. All backfilling shall be brought flush with finished subgrade. F. Excess material shall be removed from the site. Trenches shall be backfilled immediately after approval. Page 506 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 6 2.13 INSTALLATION OF PIPING, A. The installation of piping shall be made in such a manner to clear beams and obstructions. Do not cut into or reduce the size of plates or any load carrying members without approval of the Architect. Check Drawings and Work of others to prevent interference. Deviations of the Work determined by the Architect shall be installed by the Contractor without additional cost. B. Install piping promptly, cap or plug open ends of pipe. No piping shall be permanently covered by construction before inspection and approval. Piping and ductwork shall be installed in accordance with best practice and recommendations of the manufacturer. C. Conceal piping unless indicated otherwise. Inspect each piece of pipe, tubing, fittings, and equipment for defects and obstructions. Remove defective material from site. Install piping generally level, free of traps and unnecessary bends to conform with building requirements, and provide space for other work. Piping to be free of unusual noises. Avoid any possible galvanic action by isolating dissimilar metals with suitable Dielectric Insulating Fittings. D. Unless called for otherwise, hereinafter in this Specification or by specific detail on the Drawings, all water pipes in contact with structure and/or hangers shall be suitably isolated. In the case of uninsulated pipe, "Trisolators" or equal shall be used. E. Protect enameled or polished equipment from damage, tool marks, etc. 2.14 STERILIZATION OF PIPES A. After preliminary purging of the Systems, the entire domestic potable water system pertaining to Work under this Contract shall be chlorinated in accordance with American Water Works Association, State of California Health and Safety Code procedure for disinfecting water mains. A thorough flushing operation shall be run upon completion of sterilization. Contractor shall then arrange with local health authority for test on mains and water systems and provide three (3) copies of test results to the Architect. 2.15 SEISMIC BRACING A. It shall be required that pipes, ducts and conduits be supported and braced per the SMACNA "Seismic Restraints Manual Guidelines for Mechanical Systems", 1998 Edition. B. When the SMACNA "Seismic Restraint Manual Guidelines for Mechanical Systems" does not specifically address the size of duct or pipe to be braced, the following shall apply: 1. All ducts shall be braced and guyed to prevent lateral or horizontal swing to the satisfaction of the Architect, Engineer, and State Inspector. Page 507 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 22 0000 10/19/2022 23 0013- General Mechanical Page 7 2. All pipes shall be braced and guyed to prevent lateral or horizontal swing to the satisfaction of the Architect, Engineer, and State Inspector. Absolutely, no "Plumber's Tape" shall be used anywhere on this project. C. The SMACNA Manual can be obtained through SMACNA online. Contractor shall obtain manual prior to the start of any work. 2.16 OPERATION AND INSTRUCTION A. The Contractor shall furnish competent Technicians to supervise start-up operations of equipment specified by the Architect or Engineer and to instruct Owner's operators. The Contractor shall furnish six complete sets of operating instructions and service manuals to the Architect. B. Instruction period shall be started after instruction books and service manuals have been submitted to and approved by the Architect and shall be at hours (regular and non-regular) arranged by the Architect. C. Service manuals shall include oiling, cleaning, and servicing data, compiled in clearly and easily understood form and in a durable binder. Data shall show all serial numbers of every piece of equipment and complete list of replacement parts. 2.17 WARRANTY A. The contractor shall warranty all of the systems for proper operation installed by the contractor for not less than one calendar year from date of project completion. This completion date shall be set by the Architect or Owner. END OF SECTION 22 0013 Page 508 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 1 of 7 SECTION 26 0500 COMMON WORK RESULTS FOR ELECTRICAL PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Materials and equipment shall be furnished and installed in support of electrical work described in these plans and specifications including but not limited to, raceways, boxes, enclosures, feeders, branch circuiting, supports, terminal cabinets, sleeves, gutters, panels, transformers, switchgear, lighting fixtures, controls, relays, contactors, in order to complete and make fully functional the systems described. 2. Lighting systems, both interior and exterior as shown on the plans and as specified herein, including controls, occupancy sensors, lumen sensors, photocell controls, lamps, dimmers, racks, dimming ballasts, supports, fasteners, straps, and miscellaneous mounting hardware and support structures for such equipment. 3. Electrical, Telephone and CATV Utility company site work as required by the serving companies. All utility company conduits, raceways, trenching, backfilling, utility vaults, equipment pads and substructures shall meet both the respective utility companies requirements as well as those of the authority having jurisdiction, whichever is more restrictive. In no case shall work be completed and covered without the written approval of the serving utility companies both on and off site. 4. Duct banks and raceways for all power and communications systems as shown and/or required. Duct banks shall include all trenching, racking, conduit, concrete, backfill, boxes, pads, substructures required for a fully developed and useable pathway for cables, conductors, as shown on site, etc. 5. HVAC and plumbing electrical: Conduit, conductors and terminations for all line voltage power, line voltage controls and fusible and/or non-fusible safety disconnect switches for HVAC equipment, including but not limited to air conditioners, furnaces, fans, heat pumps, cooling towers, system pumps, condensing units. Provide protective equipment unless otherwise noted, etc. including protective devices. 6. Plumbing Electrical: Conduit, conductors and terminations for plumbing equipment with power requirements including necessary fusible and/or non-fusible safety disconnect devices. Provide motor starters where required unless provided by mechanical specification. 7. Power and Lighting Distribution: Furnish and install power and lighting distribution systems including but not limited to panels, feeders, transformers, branch circuits, devices, fixtures, disconnect switches, contactors, controls, etc. for a complete working system. Page 509 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 2 of 7 8. Fiber infrastructure including all boxes, raceways, cable tray, , dedicated branch circuits, sleeves and penetrations, etc. as described and as shown in plans, risers, specifications, EIA/TIA standards and/or required for a complete and operating system. 9. Lighting acceptance testing, documentation and completion of required forms as specified in Section 26 5670, LIGHTING ACCEPTANCE TESTING. 10. Allocation of time to adequately train the Owner on the use and operation of all systems installed within the facility or on the property. Minimum two week advance notice shall be coordinated with the Owner and his representatives. Training shall be as outlined in individual system specifications identified to follow. B. Related Sections Under Other Divisions: 1. Mechanical Wiring: Control circuit wiring, energy management controls and interlocks for mechanical equipment shall be installed by Mechanical Contractor. 2. Painting of electrical equipment where exposed and required by the Architect to be painted as described elsewhere in the specification. 3. Irrigation System: Provide all line voltage (50 volts or above) connections to irrigation system equipment, time clocks and or powered satellite controls. Coordinate locations of this work with the Landscape Contractor. 4. Pole Bases: Contractor shall be responsible to furnish light standard concrete pole bases, rebar, bolt templates and anchor bolt kits for a complete installation. Concrete, rebar, excavation shall be by Contractor in accordance with all parts of this specification. 5. HVAC Control Raceway: Raceways, boxes, and control wiring for thermostats, temperature sensors and control components specified within the mechanical specifications, shall be furnished and installed as required by Division 25 and installed in accordance with the minimum wiring methods allowed for branch circuit wiring in Division 26 (the DDC systems/EMS systems and components are installed in accordance with Division 25). 1.3 SYSTEM DESCRIPTION A. The electrical plans indicate the general layout and arrangement; the architectural drawings and field conditions shall determine exact locations. Field verify all conditions and modify as required to satisfy design requirements as well as code minimums. Maintain all required working clearances as described in CEC Article 110 as well as other applicable articles. B. Discrepancies shall be brought immediately to the attention of the Architect for clarification. The Architect shall approve any changes. Prior to rough-in, refer to architectural plans that shall take precedence over electrical plans with respect to locations. C. Verify all power and communications utility company requirements prior to commencement of utility work. Make proper adjustments to the construction to satisfy the serving utility requirements if they differ from the construction documents. It shall be the Contractor’s responsibility to contact each utility company for obtaining finalized utility design drawings and/or approval, and for scheduling inspection of utility infrastructure installations. D. Charges imposed by the electric and communications utility companies shall be paid by Owner directly to utility companies. Page 510 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 3 of 7 1.4 SUBMITTALS AND SHOP DRAWINGS A. Before construction, submit in accordance with the General Conditions of this Specification: A complete list of all materials proposed to be furnished and installed under this section. B. Manufacturers' specifications, catalog cuts and shop drawings as required to demonstrate compliance with the specifications. Identify specific intended use for each component where submittal may be ambiguous. Submit entire bound submittal at one time; partial submittals will not be accepted. At a minimum, submittals will be required for the following: 1. Utility service/site work equipment including ducts, conduits, fittings, concrete manholes, concrete and fiberglass pull, manhole, boxes, vaults, trench racks, accessories, etc. 2. Distribution equipment including main switchboards, distribution switchgear, transformers, distribution panels and breakers, motor controls, distribution and branch circuit panels, grounding, transient voltage surge suppressors, etc. 3. Electrical equipment including disconnects, fuses, raceways, straps and racks, fittings, conductors, boxes, gutters, devices, plates, etc. 4. Lighting equipment including fixtures, ballasts, lamps, mounting accessories, color charts (where required), etc. 5. Lighting control equipment including low voltage switching system, dimmer switchbank / accessories, occupancy sensing equipment, time clocks, contactors, photocells, lumen sensors, etc. 6. Constructability review letter/comments for lighting acceptance testing as required by Section 26 5670, LIGHTING ACCEPTANCE TESTING. 7. Complete system component submittals and shop drawings for: a. City Fiber b. Communication Data Cabinet 8. Conduit including all fittings, etc. 9. Wiring and cable, terminations, etc. 10. Fire rating penetration materials, details, etc. C. The intent of these specifications is to establish a standard of quality for materials and equipment. Therefore, some items are identified by manufacturer or trade name designation. Substitutions shall be subject to the Architect's approval. Samples of the proposed and substitute materials may be required for inspection prior to approval. Costs, if any, for evaluation of substitutions shall be the Contractor's responsibility. The decision of the Architect shall be final. Where the substitution will affect other trades, coordinate all changes with those trades concerned and pay any additional costs incurred by them as a result of this substitution. Approval of substitutions shall not relieve the Contractor from providing an operational system in accordance with all applicable codes and ordinances. D. SUPPORTING DEVICES 1. Provide all details of suspension and support for ceiling hung equipment. 2. Where walls, floor, slabs or supplementary steel work are used for seismic restraint locations, details of acceptable attachment methods for ducts, conduit and pipe must be included and approved before the submittals must include spacing, static loads and seismic loads at all attachment and support points. 3. Provide seismic details of seismic restraints and anchors; including number, size and locations for each piece of equipment. Page 511 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 4 of 7 1.5 DELIVERY, STORAGE AND HANDLING A. Storage of equipment for the job is the responsibility of the Electrical Contractor and shall be scheduled for delivery to the site, as the equipment is required. Damage to the equipment delivered to the site or in transport to the job shall be the responsibility of the Electrical Contractor. PART 2 - PRODUCTS 2.1 MATERIALS A. Materials shall be new and bear the label of or be listed by a nationally recognized testing laboratory. The quality and suitability of all materials shall conform to the standards and practices of this trade. B. Supplied materials shall be of a current manufactured product line. Discontinued products are not acceptable. Where products are identified on the contract documents by part number, supply the current product model or series which meets the specification and intended use of the specified component. 2.2 SUPPORTING DEVICES A. Hangers: Kindorf B-905-2A Channel, H-119-D washer, C105 strap, 3/8” rod with ceiling flange. B. Concrete Inserts: Kindorf D-255, cast in concrete for support fasteners for loads up to 800 lbs. C. Pipe Straps: Two-hole galvanized or malleable iron. PART 3 - EXECUTION 3.1 INSTALLATION A. Professionalism and appearance of installations shall be in accordance with accepted practices of this trade. Installation methods shall conform to manufacturers' specifications and recommendations. The Contractor shall man the job with qualified journeymen and helpers in this trade for the duration of the job. It is the Contractor's responsibility to communicate with and keep the job superintendent appraised of changes or clarifications, etc. B. Employment of any person on any job in the capacity of an electrician is not permitted unless such person has qualified for and holds a valid Journeyman Electrician Pocket Card or General Journeyman Electrician Certificate issued by the State of California Division of Apprenticeship Standards except, Contractor may employ electrical helpers or apprentices on any job of electrical construction, new or existing, when the work of such helpers or apprentices is performed under the direct and constant personal supervision of a journeyman electrician Page 512 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 5 of 7 holding a valid Pocket Card accepted by the State of California Division of Apprenticeship Standards. 1. Each Pocket Card carrying journeyman electrician will be permitted to be responsible for the quality of workmanship for a maximum of one helper or apprentice during any same time period, provided the nature of work is such that good supervision can be maintained and the quality of workmanship is the best, as expected by Owner and implied by the latest edition of the National Electrical Code. 2. Before each journeyman electrician commences work, deliver to Owner at the project site, a photocopy of the journeyman’s valid Pocket Card. C. Materials shall be installed in accordance with the manufacturers' specification and recommendations. They must conform to the approval AHJ adopted codes and standards, but not less than the 2013 CEC and all applicable codes and standards, including but not necessarily limited to California Code of Regulations Title 24, NFPA, National Electrical Manufacturers Association, ANSI, CBC, and any other adopted ordinances of applicable agencies having jurisdiction. Refer to general conditions of specifications. D. Electrical Contractor shall lay work out in advance in order to avoid unnecessary cutting, chasing, and drilling of floors, walls, ceilings and other surfaces. Work of this nature shall be carefully done so as not to damage work already performed by other trades. Any damage which results must be properly repaired at no extra cost to the Owner. Such alterations shall not depreciate the integrity of the structure. Approval for cuts or penetrations in structural members shall be by the Architect. E. Supporting Devices: 1. Verify mounting height of all luminaires or items prior to installation when heights are not detailed. 2. Install vertical support members for equipment and luminaires, straight and parallel to building walls. Provide independent supports to structural member for electrical luminaires, materials, or equipment installed in or on ceiling, walls or in void spaces or over furred or suspended ceilings. 3. Do not use other trade’s fastening devices as supporting means for electrical equipment, materials or luminaires. Do not use supports or fastening devices to support other than one particular item. 4. Support conduits within 18” of outlets, boxes, panels, cabinets and deflections. Maximum distance between supports not to exceed 8’ spacing. 5. Securely suspend all junction boxes, pull boxes or other conduit terminating housings located above suspended ceiling from the floor above or roof structure to prevent sagging and swaying. 6. Provide seismic bracing per UBC requirements for this building location. F. Coordinate work with other trades as required to eliminate any delays during construction. Coordinate changes with other prime contractors to avoid construction conflicts. G. Engineer's Field Observation: Site visits during construction for field observations and reports will be conducted by electrical engineer when directed by the Architect. A list of items that need to be addressed will be submitted to the Architect for forwarding to the Contractor. A written response to all items shall be submitted for Owner’s review once complete. When Electrical Engineering representative performs a field observation, the Electrical Contractor shall be present and available to remove equipment covers as needed. Page 513 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 6 of 7 H. Drawings of Record: Provide a full and accurate set of field record drawings marked up in a neat and understandable manner submitted to the Owner Representative, Construction Manager, or Architect upon completion of the work and prior to issuance of a certificate of completion. The drawings shall dimension all electrical facilities including but not limited to underground conduit, vaults, boxes as well as conduit routing scaled to within 12" of actual field conditions and shall be kept up to date on a daily basis reflecting changes or deviations. Electrical facilities shall be accurately drawn on the plan to scale. Refer to the general conditions of these specifications for additional requirements. Record drawings shall be required to identify both horizontal and vertical dimensions to visible and fixed points such as concrete, asphalt, buildings, sidewalks, etc. I. Identification: Provide engraved laminated plastic nameplates for all switchboards, panelboards, fire alarm terminal cabinets, telephone and cable television backboards, main devices, control panels, time clocks, contactors and safety disconnect switches accurately identifying each device. Labels shall be attached to the equipment by means of screws or rivets. Self-adhering labels will not be acceptable. Refer to Section 26 0553, IDENTIFICATION OF ELECTRICAL SYSTEMS. J. Safety: The Electrical Contractor is responsible to maintain equipment in a safe and responsible manner. Keep dead front equipment in place while equipment is energized. Conduct construction operations in a safe manner for employees as well as other work persons or anyone visiting the job site. Provide barriers, trench plates, flags, tape, etc. The Contractor shall hold all parties harmless of negligent safety practices that may cause injury to others on or near the job site. K. Guarantees: Equipment and labor shall be guaranteed and warranted free of defects, unless otherwise stated to be more restrictive, for a period of one year from the date of final acceptance by the Owner. A written warranty shall be presented to the Architect at the time of completion prior to final acceptance. Equipment deemed to be damaged, broken or failed should be repaired or replaced at no additional cost to the Owner. Materials or system requiring longer than a one-year warranty as described herein shall be separately warranted in separate letters of guarantee stating the duration of warranty. L. Operating and Installation Manuals: Provide two copies each of manuals, operating and installation instructions for equipment indicated in submittal packages. Instruct the Owner's representative as to the operation and location of equipment necessary to allow them to operate the facility upon final acceptance. This instruction period shall be prearranged with the Owner's representative prior to occupancy of the facility and the weeks prior to training scheduled. M. Lighting Acceptance Testing: Provide two copies of lighting acceptance testing results and equipment operating manuals as specified in Section 26 5670, LIGHTING ACCEPTANCE TESTING. Instruct the Owner on operation of control systems. END OF SECTION Page 514 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU1 Section 26 0500 26 0500 – Common Work Results for Electrical Page 7 of 7 THIS PAGE INTENTIONALLY LEFT BLANK Page 515 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 1 of 6 SECTION 26 0519 LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. Section Includes: 1. Wires and cables. 2. Connectors. 3. Lugs and pads. 4. MC cable (not allowed) 1.3 SYSTEM DESCRIPTION A. Provide wires, cables, connectors, lugs, strain reliefs, racking insulators for a complete and operational electrical system. 1.4 SUBMITTALS A. Provide product data for the following equipment: 1. Wires. 2. Cables. 3. Connectors. 4. Lugs. 5. Splice Kits. 6. Strain Relief Fittings. 7. Cable Racking and Insulators. B. Provide the insulation cable testing report in the project closeout documentation, refer to Closeout Requirements in the General Conditions portion of this specification. 1.5 REGULATORY REQUIREMENTS A. Conform to requirements of the CEC, latest adopted version with amendments by local Authority Having Jurisdiction (AHJ). B. Furnish products listed by UL or other testing firm acceptable to AHJ. Page 516 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 2 of 6 PART 2 - PRODUCTS 2.1 MANUFACTURERS A. Wires and Cables: General Cable, Okonite, Southwire, or approved equal. B. Connectors: Burndy, Ilsco, Thomas & Betts, or approved equal. C. Wire connectors shall be minimum 75 degree centigrade rated and properly sized for the number of conductors being connected, terminated, spliced etc. All above grade connectors shall be solderless lug or plastic wire nut type, screw on, pressure cable type (wire nut or spring nut type), 600 volt, 105 degree C, with skirt to cover all portions of stripped wires. Connector shall be U.L. rated for number and size of conductors being joined together as a splice. D. Splices: 1. Branch Circuit Splices: Ideal, Scotch-Lock, 3M, or approved. 2. Feeder Splices: Compression barrel splice with two layers Scotch 23 and four layers of Scotch 33+ as vapor barrier. 3. Screw Terminal Lugs. 4. Kearney Split Bolt. E. MC Cable: Alflex, AFC, or approved and shall meet all CEC Article 334 provisions. 2.2 WIRES AND CABLES FOR LINE VOLTAGE SYSTEM AND CONTROLS. WIRE AND CABLE SHALL BE: A. Copper, 600 volt rated throughout. Conductors 14AWG to 10AWG, solid or stranded. Conductors 8AWG and larger, stranded. B. Phase color to be consistent at all feeder terminations; A-B, top to bottom, left to right, front to back. Phasing tape shall be permitted on sizes #6 and larger. C. Color Code Conductors as Follows: PHASE 240 VOLT A Black B. Red Neutral White Ground Green D. All conductors shall be copper unless otherwise noted. Minimum size for individual conductors shall be #12 AWG unless otherwise noted. Sizes #8 AWG and larger shall be stranded conductor. Individual conductors shall be insulated with type, XHHW, THW, THHN/THWN 600-volt insulation unless otherwise noted. Control, signal, communication conductors shall be as dictated by the vendor of that equipment or as specified here-in. Proper insulation type shall be used for the proper environmental application (i.e., waterproof, wet location, plenum, temperature rated). If a condition exists where the application is uncertain, contact the Engineer for direction. Contractor is responsible to follow specific cabling requirements described in other sections of this specification relative to various communications and controls systems as Page 517 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 3 of 6 well as the respective riser diagrams shown on plans. If a discrepancy occurs, communicate such discrepancy to the Architect and Engineer immediately for resolution. E. Insulation types THWN, THHN or XHHW. Minimum insulation rating of 90C for branch circuits. F. Refer to signal and communications specification sections for cable requirements. 2.3 CONNECTORS A. Copper Pads: Drilled and tapped for multiple conductor terminals. B. Lugs: Indent/compression type for use with stranded branch circuit or control conductors. C. Solid Conductor Branch Circuits: Spring connectors, wire nuts, for conductors 18 through 8AWG. 2.4 LUGS AND PADS A. Ampacity: Cross-sectional area of pad for multiple conductor terminations to match ampere rating of panelboard bus or equipment line terminals. PART 3 - EXECUTION 3.1 INSTALLATION A. Installation: Conductors shall not be installed until after conduit systems are permanently in place. Use an approved non hardening type wire pulling lubricant if lubricant is to be used. Maintain all conduits and wire pulls free from foreign material. If due to field conditions, more than a total of 300 degrees of bend are required; a pull box shall be furnished and installed for ease of installation. Said pull boxes must be sized and rated for the appropriate application and must remain easily accessible upon completion of the project (approval of the location shall be obtained from the Architect prior to installation). Show these pullboxes on the field record drawings. Conductors installed in underground raceways on site shall be duct sealed and taped where they exit the raceway to prevent the entrance of foreign material and moisture after the conductors are installed. Proper drainage shall be provided for underground pull and splice boxes. B. Insulation: Use proper insulation types where temperature and environment are a factor. C. Splices at or below grade level shall be made with wet location rated and approved mechanical connectors and shall be encapsulated in epoxy or plastic molded poured kits. The connections must be assured to be watertight. Splices at or below grade shall always be avoided and minimized. Prior approval is required for feeder splices below grade. Submit proposed materials and exhibit showing location of intended splices for Engineer’s review and approval prior to commencing with the work. Page 518 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 4 of 6 D. Labeling: All conductors in panels, switchboards, terminal cabinets, vaults, pull boxes, and junction boxes shall be labeled with tape number markers indicating circuit number and identifying system. All labeling shall be permanent. In manholes and vaults, provide embossed brass tags identifying system serviced and function. See Section 26 0553 IDENTIFICATION OF ELECTRICAL SYSTEMS. E. All conductors, wiring, cable where installed below floor, slab or underground shall be considered wet locations, and shall be rated accordingly. Non waterproof cabling is not allowed in any below grade or wet application. F. Cables routed together in cable tray shall be stacked, organized and tie wrapped together in a neat and workman like manner. Random cable routing is not acceptable. G. Cable and conductors routed through pull boxes and vaults shall be properly supported on porcelain or equal insulators mounted on steel rack inserts. Bend radius of cable or conductor shall not be less than six times the overall cable diameter. H. Wires and Cables: 1. Conductor Installation: a. Install conductors in raceways having adequate, code size cross-sectional area for wires indicated. b. Install conductors with care to avoid damage to insulation. c. Do not apply greater tension on conductors than recommended by manufacturer during installation. d. Use of pulling compounds is permitted. Clean residue from exposed conductors and raceway entrances after conductor installation. 2. Conductor Size and Quantity: a. Install no conductors smaller than 12AWG unless otherwise shown. b. Provide all required conductors for a fully operable system. 3. Provide dedicated neutrals (one neutral conductor for each phase conductor) in the following single phase circuits: a. Dimmer controlled circuits. b. 120v circuit c. Ground fault and arc fault protected circuits where a GFI and arc fault breakers are used in panelboards. 4. Conductors in Cabinets: a. Cable and train all wires in panels and cabinets for power and control neatly and uniformly. Use plastic ties in panels and cabinets. b. Tie and bundle feeder conductors in wireways of panelboards. c. Hold conductors away from sharp metal edges. d. Connectors: Retighten mechanical type lugs and connectors for conductors to equipment prior to Notice of Completion. 3.2 FIELD QUALITY CONTROL A. Tests: 1. Test conductor insulation on feeders of 400 amp and greater for conformity with 1000 volt megohmmeter. Use Insulated Cable Engineers Association testing procedures. Minimum insulation resistance acceptable is 1 megohm for systems 600 volts and below. Page 519 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 5 of 6 2. Test Report: Prepare a typed tabular report indicating the testing instrument, the feeder tested, amperage rating of the feeder, insulation type, voltage, the approximate length of the feeder, conduit type, and the measured resistance of the megohmmeter test. Submit report with operating and maintenance manual. END OF SECTION Page 520 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0519 26 0519 – Low Voltage Electrical Power Conductors and Cables Page 6 of 6 THIS PAGE INTENTIONALLY LEFT BLANK Page 521 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 1 of 6 SECTION 26 0526 GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Grounding and bonding requirements of electrical installations for personnel safety and to provide a low impedance path for possible ground fault currents as described in CEC Article 250. 2. “Grounding electrode system” refers to all electrodes required by CEC, as well as including made, supplementary, lightning protection system and telecommunications system grounding electrodes. 3. The terms “connect” and “bond” are used interchangeably in this specification and have the same meaning. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES. PART 2 - PRODUCTS 2.1 GROUNDING AND BONDING CONDUCTORS A. Equipment grounding conductors shall be UL 83 insulated stranded copper, except that sizes No. 10 AWG and smaller shall be solid copper. Insulation color shall be continuous green for all equipment grounding conductors, except that wire sizes No. 4 AWG and larger shall be permitted to be identified per CEC. B. Bonding conductors shall be ASTM B8 bare stranded copper, except that sizes No. 10 AWG and smaller shall be ASTM B1 solid bare copper wire. C. Conductor sizes shall not be less than what is shown on the drawings and not less than required by the CEC, whichever is greater. Page 522 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 2 of 6 2.2 GROUND RODS A. Copperclad steel, 5/8" diameter by 8’ long, conforming to UL 467 unless otherwise noted on drawings and details. B. Quantity of rods shall be as required to obtain the specified ground resistance or additional rods shall be driven to obtain specified resistance or less. 2.3 SPLICES AND TERMINATION COMPONENTS A. Components shall meet or exceed UL 467 and be clearly marked with the manufacturer, catalog number, and permitted conductor size(s). PART 3 - EXECUTION 3.1 GENERAL A. Ground in accordance with the CEC, as shown on drawings, and as hereinafter specified. B. System Grounding: 1. Secondary service neutrals: Ground at the supply side of the secondary disconnecting means and at the related transformers. 2. Separately derived systems (transformers downstream from the service entrance): Ground the secondary neutral. C. Equipment Grounding: Metallic structures (including ductwork and building steel), enclosures, fire sprinklers, plumbing piping, raceways, junction boxes, outlet boxes, cabinets, machine frames, and other conductive items in close proximity with electrical circuits shall be bonded and grounded. 3.2 INACCESSIBLE GROUNDING CONNECTIONS A. Make grounding connections which are buried or otherwise normally inaccessible (except connections for which periodic testing access is required) by exothermic weld. 3.3 SECONDARY EQUIPMENT AND CIRCUITS A. Main Bonding Jumper: Bond the secondary service neutral to the ground bus in the service equipment. B. Metallic Piping, Building Steel, and Supplemental Electrode(s): 1. Provide a grounding electrode conductor sized per CEC between the service equipment ground bus and all metallic water and gas pipe systems, building steel, and supplemental or made electrodes. Jumper insulating joints in the metallic piping. All connections to electrodes shall be made with fittings that conform to UL 467. 2. Provide a supplemental ground electrode and bond to the grounding electrode system. Page 523 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 3 of 6 C. Service Disconnect: Provide a ground bar bolted to the enclosure with lugs for connecting the various grounding conductors. D. Switchgear, Switchboards, Unit Substations, and Motor Control Centers: 1. Connect the various feeder equipment grounding conductors to the ground bus in the enclosure with suitable pressure connectors. 2. For service entrance equipment, connect the grounding electrode conductor to the ground bus. 3. Connect metallic conduits, which terminate without mechanical connection to the housing, by grounding bushings and grounding conductor to the equipment ground bus. E. Transformers: 1. Exterior: Exterior transformers supplying interior service equipment shall have the neutral grounded at the transformer secondary. Provide a grounding electrode at the transformer. 2. Separately derived systems (transformers downstream from service equipment): Ground the secondary neutral at the transformer. Provide a grounding electrode conductor from the transformer to nearest component of the grounding electrode system and the ground bar at the service equipment. F. Conduit Systems: 1. Ground all metallic conduit systems. All metallic conduit systems shall contain an equipment grounding conductor sized per CEC. 2. Non metallic conduit systems shall contain an equipment grounding conductor, except that non-metallic feeder conduits which carry a grounded conductor from exterior transformers to interior or building-mounted service entrance equipment need not contain an equipment grounding conductor. 3. Metal conduit containing only a grounding conductor, and which is provided for mechanical protection of the conductor, shall be bonded to that conductor at the entrance and exit from the conduit. G. Feeders and Branch Circuits: Install equipment grounding conductors with all feeders, power and lighting branch circuits. H. Boxes, Cabinets, Enclosures, and Panelboards: 1. Bond the equipment grounding conductor to each pullbox, junction box, outlet box, device box, cabinets, and other enclosures through which the conductor passes. 2. Provide lugs in each box and enclosure for equipment grounding conductor termination. 3. Provide ground bars in panelboards, bolted to the housing, with sufficient lugs to terminate the equipment grounding conductors. I. Motors and Starters: Provide lugs in motor terminal box and starter housing or motor control center compartment to terminate equipment grounding conductors. J. Receptacles shall not be grounded through their mounting screws. Ground with a jumper from the receptacle green ground terminal to the device box ground screw and the branch circuit equipment grounding conductor. K. Ground lighting fixtures to the equipment grounding conductor of the wiring system when the green ground is provided; otherwise, ground the fixtures through the conduit systems. Fixtures Page 524 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 4 of 6 connected with flexible conduit shall have a green ground wire included with the power wires from the fixture through the flexible conduit to the first outlet box. L. Fixed electrical appliances and equipment shall be provided with a ground lug for termination of the equipment grounding conductor. M. Raised Floors: Provide bonding of all raised floor components. N. Panelboard Bonding: The equipment grounding terminal buses of the normal and emergency branch circuit panelboards shall be bonded together with an insulated continuous copper conductor not less than No. 8 AWG where panels are in same room together or within 25’ of each other. These conductors shall be installed in rigid metal conduit. 3.4 CONDUCTIVE PIPING A. Bond all conductive piping systems, interior and exterior, to the building to the grounding electrode system. Bonding connections shall be made as close as practical to the equipment ground bus. 3.5 TELECOMMUNICATIONS SYSTEM A. Bond telecommunications system grounding equipment to the electrical grounding electrode system. Refer to City of SLO Cabling Standards 3.6 GROUND RESISTANCE A. Grounding system resistance to ground shall not exceed 25 ohms. Make necessary modifications or additions to the grounding electrode system for compliance without additional cost to the Owner. Final tests shall assure that this requirement is met and test results shall be submitted to the Owner with final close out documents. B. Resistance of the grounding electrode system shall be measured using a four-terminal fall-of- potential method as defined in IEEE Standard 81. Ground resistance measurements shall be made before the electrical distribution system is energized and shall be made in normally dry conditions not less than 48 hours after the last rainfall. Resistance measurements of separate grounding electrode systems shall be made before the systems are bonded together below grade. The combined resistance of separate systems may be used to meet the required resistance, but the specified number of electrodes must still be provided. C. Services at Pacific Gas and Electric Company interface point shall comply with their ground resistance requirements. D. Below-grade connections shall be visually inspected by the IOR prior to backfilling. The Contractor shall notify the IOR 24 hours before the connections are ready for inspection. E. Furnish a copy of tests to Owner at completion of project. Page 525 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 5 of 6 3.7 GROUND ROD INSTALLATION A. Drive each rod vertically in the earth, not less than 7 1/2’ in depth. B. Where permanently concealed ground connections are required, make the connections by the exothermic process to form solid metal joints. Make accessible ground connections with mechanical pressure type ground connectors. C. Where rock prevents the driving of vertical ground rods, install angled ground rods or grounding electrodes in horizontal trenches to achieve the specified resistance. END OF SECTION Page 526 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0526 26 0526 – Grounding and Bonding for Electrical Systems Page 6 of 6 THIS PAGE INTENTIONALLY LEFT BLANK Page 527 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 1 of 10 SECTION 26 0533 RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. Section Includes: 1. Conduit and fittings. 2. Outlet boxes. 3. Weatherproof outlet boxes. 4. Junction and pull boxes. 5. Cabinets, termination cabinets. 6. Gutters. 7. Concrete boxes and vaults. 8. Fiberglass or composite boxes and vaults. 9. Hazardous Location: Sealing Fitting B. Related Work: 1. Installation of all wire, cable, conductor, boxes/gutters, pull ropes, fiber optic cable raceway, conduit, innerduct, cable sleeve and duct as described on the plans and/or as specified here-in. This scope shall include pathways to be installed underground on site and offsite, underslab, above grade, both concealed and exposed, overhead concealed and exposed as appropriately applied. Raceways/boxes shall be installed in accordance with their intended and allowed uses and as specified here-in whichever is more restrictive. Size and capacity of all raceway/boxes shall be as specified here-in or as depicted on the drawings, but shall not be less than that required by code. Larger raceway sizes may be specified than code would permit. The specifications shall govern. 2. Listed products for termination, coupling, extending, benching supports of raceways shall be used. 3. Raceways/boxes described by this section shall include, but not be limited to, power for site utilities and lighting, site and building communications, controls, fire alarm, security, access control, sound systems, data system, energy management systems, power distribution, lighting, lighting controls, video, CATV, voice communications, intercom, nurse call, HVAC and other building low voltage/communications systems controls as may be required. Raceways, boxes and duct paths required for utility companies shall be installed per plans unless utility company requirements are more restrictive at which time those requirements shall take precedence. 4. Protection of and cleanliness of pathways and raceways must be assured during the construction process in order to eliminate the possibility of debris entering the conduit, Page 528 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 2 of 10 duct, pathway resulting in decreased wire capacity and potential damage to installed conductors and cables. 5. Pathways are shown in a diagrammatic way and are generally accurate as to routing, however, it is the Contractor’s responsibility as a means and methods process to coordinate with all other trades that require space within a building. The Contractor shall obtain approval for installation of raceways routing through structural footings, retaining walls, columns, beams, perlins, grade beams, etc. 6. It is the Contractor’s responsibility to insure that all raceway and boxes systems penetrate fire assemblies and sound rated assemblies in an approved manner using the appropriate and listed products for the purpose. 7. Trenching and backfilling for all underground conduit systems installed by the Electrical Contractor shall be the responsibility of the Contractor. Conduits shall have minimum cover requirement of 36” below finish grade with the exception of site lighting conduits which may be 24” below finish grade minimum. More stringent depth requirements may be imposed by the local agency and utility company and shall be adhered to, and / or this specification or as detailed on the plans. Joint trenching may be utilized where practicable and where permitted by this specification. Concrete, native material and sand shall be used as backfill material and shall be compacted in accordance with and coordinated with the grading and site preparation requirements. Conduits shall rest in a minimum of 4” bed of sand prior to backfill and compaction. Locations of existing underground (UG) utility systems shall be determined by calling Underground Service Alert (USA) at least 48 hours prior to any excavation. Also refer to Section 26 0546.13, ELECTRIC UTILITY SYSTEMS. 8. Minimum conduit size shall be 1/2" except if plan shows or code requires larger size. Exception: Use minimum 3/4" for underslab and below grade applications outside of building exterior walls. 9. All electrical, control, communications systems shall be installed in metallic conduit system. This shall include but not be limited to all systems described in Section B.3 above, except for voice and data systems which shall be installed as described on these plans and as specified here-in but shall not be less than the recommendations of EIA/TIA standards. 10. All line voltage wiring within the building shall be installed in metallic conduit. 11. All conduit, concrete pads, underground concrete or fiberglass substructures shall be furnished and installed with the approved materials and type for the application. Provide proper traffic control during construction as well as barriers and protection of all excavations and trenching. 12. Empty or future conduits shall be properly plugged with plastic caps or inserts with a 3/8” polyethylene pull rope. Plastic or "duct" tape will not be acceptable. 13. Exterior installations: After conductors are installed, seal conduit ends to prevent entrance of foreign material using pliable duct seal, caps or waterproof expanding foam. 14. All low voltage systems including intercom, fire alarm, public address, etc. shall be in dedicated conduit systems and as recommended by EIA/TIA standards. It shall be the contractor’s responsibility to provide raceway down walls to outlet boxes and to provide sleeves across inaccessible ceiling spaces. 15. Underground conduits entering building shall have the open end of conduit within building above the elevation of the conduit outside the building such that water cannot enter building through conduit. If such a condition exists, a pull box outside of building footprint shall be installed in conduit route before conduit enters building whereby top of pull box is below finish floor of building and moisture may exit box before entering building. Page 529 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 3 of 10 16. No single conduit run of any type shall exceed 300 degrees of radius bend from termination box to termination box. 17. Separate Raceway System: Provide a separate dedicated raceway system for each system installed, do not combine different systems into a raceway or cable tray system, unless otherwise noted or allowed. 18. Spare, Future Conduits: Conduits labeled conduit only, spare, or for future use, shall be provided with a pullrope, capped at each end, labeled as spare with destination marked, and turned over to the Owner in an unused state. Contractor shall not utilize these conduits for the installation of cabling or conductors as part of this scope of work. Contractor to verify and install at no additional cost to the Owner, additional conduits as required for the installation of the systems being installed. 19. Outlet System: Provide electrical boxes and fittings as required for a complete installation. Including but not limited to outlet boxes, junction boxes, pull boxes, bushings, locknuts, covers and all other necessary components. 20. Code Compliance: Comply with CEC as applicable to construction and installation of electrical boxes and fittings and size boxes according to CEC 312, 314 and 366 except as noted otherwise. 21. Outlets to be flush mounted: Maintain integrity of insulation and vapor barrier. Unless otherwise noted, flush mount all outlet boxes. 22. Provide putty pads of proper type around outlet boxes and/or as detailed on plan to meet sound transmission restrictions and fire ratings of walls. 1.3 SUBMITTALS A. Provide Shop Drawings and Product Data for the Following Equipment: 1. Conduit and fittings. 2. Outlet boxes. 3. Weatherproof outlet boxes. 4. Junction and pull boxes. 5. Cabinets, termination cabinets. 6. Gutters. 7. Concrete boxes and vaults. 8. Paver vaults boxes and vaults 9. Putty pads. 10. Raceways 1.4 REGULATORY REQUIREMENTS A. Conform to requirements of the CEC, latest adopted version with amendments by local AHJs. B. Furnish products listed by UL or other independent and nationally recognized testing firm. Page 530 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 4 of 10 PART 2 - PRODUCTS 2.1 MATERIALS A. Heavy wall Rigid Non-Metallic Conduit, shall be PVC schedule 40 manufactured in accordance with NEMA Standard TC-2, UL-651 and WC 1094A specifications. B. Extra heavy wall non-metallic conduit, shall be PVC schedule 80 manufactured in accordance with NEMA Standard TC-2, UL-651 and WC 1094A specifications. C. Galvanized Rigid Steel (GRS) conduit shall be hot dipped galvanized, zinc coated and shall comply with Underwriters Laboratories UL-6, ANSI Specification C-80.1 and Federal Specification WW-C-581E. D. Electrical Metallic Tubing (EMT) shall be zinc coated, with a protective coating applied to the inside surface and shall comply with Underwriter Laboratories UL-797 ANSI Specification C- 80.3 and Federal Specification WW-C-563A. E. Flexible Metal Conduit (FMC) shall be continuous wound reduced wall galvanized steel produced to UL standards. F. Liquid tight flexible metal conduit shall have a thermoplastic cover over a galvanized steel core containing an integral copper ground in sizes to 1 1/4" and shall be in compliance with UL standards and CEC Article 350. G. Manufacturers: 1. Outlet Boxes: Bowers, Raco, Steel City or equal. 2. Weatherproof Outlet Boxes: Bell, Red Dot, [Carlon] or equal. 3. Floor Boxes: Wiremold/Walker, Hubbell, Steel City, or equal. 4. Junction and Pull Boxes: Circle AW, Hoffman, Wireguard or equal. 5. Box Extension Adapter: Bell, Red Dot, [Carlon] or equal. 6. Conduit Fittings: O-Z Gedney, Thomas & Betts, or equal. 7. Vaults: Christy, Brooks, Utility Vault or equal. 8. Putty pads: 3M, Hilti, or equal. 9. Heavy wall rigid non-metallic conduit, Carlon, Certainteed, R&G Sloane or equal. 10. Extra heavy wall non-metallic conduit, Carlon, Certainteed, R&G Sloane or equal. 11. Galvanized Rigid Steel (GRS) conduit shall be hot dipped galvanized, zinc coated and shall comply with Underwriters Laboratories UL-6, ANSI Specification C-80.1 and Federal Specification WW-C-581E. 12. Electrical Metallic Tubing (EMT) shall be zinc coated, with a protective coating applied to the inside surface and shall comply with Underwriter Laboratories UL-797 ANSI Specification C-80.3 and Federal Specification WW-C-563A. 13. Flexible Metal Conduit (FMC), Alflex, American Flexible Conduit or equal. 14. Liquid tight flexible metal conduit, Anacanda (type UA), Electri-flex Liquatite or equal. 15. Surface mount raceway, Wiremold, Three Compartment Series 5500 or equal 16. Masonry Boxes, outlets in concrete, Raco Series 690 or equal. 17. Exterior In-Grade Boxes for Non-Utility Company, Precast concrete or polymer concrete, Utility Vault and Christy. Page 531 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 5 of 10 2.2 OUTLET BOXES A. NEMA 1 gutter, junction and pull boxes shall be fabricated from code gage steel finished in grey enamel with screw cover fronts and concentric knockouts in all sides. B. NEMA 3R gutter, junction and pull boxes shall be fabricated from code gage galvanized steel with screw cover fronts and concentric knockouts in the bottom only. Any penetrations to the side, top or back shall be weatherproofed in an approved manner such as “MYERS” gasketed type hub or equal. C. Steel outlet boxes and plaster rings shall be galvanized rigid assemblies, either one piece pressed or factory welded construction containing the size and number of knockouts required. Steel outlet boxes shall be manufactured, sized and installed in accordance with CEC Article 314. Device Outlet: Installation of one or two devices at common location, minimum 4” square, minimum 1 1/2" deep. Single or 2 gang flush device plaster ring. Raco Series 681 and 686 or equal. D. Luminaire Outlet: minimum 4” square with correct plaster ring depth, minimum 1 1/2” deep with 3/8” luminaire stud if required. Provide proper depth plaster ring on bracket outlets and on ceiling outlets. E. Multiple Devices: Three or more devices at common location. Install 1 piece gang boxes with 1 piece device plastering. Install one device per gang unless otherwise allowed. F. Construction: Provide galvanized steel interior outlet wiring boxes, of the type, shape and size, including depth of box, to suit each respective location and installation; constructed with stamped knockouts in back and sides, and with threaded holes with screws for securing box covers or wiring devices. Boxes shall be properly secured to the structure such that they are flush with the finish surface. Boxes shall be made structurally secure by means of the proper fastening devices. G. Accessories: Provide outlet box accessories as required for each installation, including mounting brackets, wallboard hangers, extension rings, plaster rings, luminaire studs, cable clamps and metal straps for supporting outlet boxes, compatible with outlet boxes being used and meeting requirements of individual wiring situations. 2.3 WEATHERPROOF OUTLET BOXES A. Cover plates on outlet boxes mounted flush in the wall shall be gasketed to the wall in a watertight manner. Weatherproof boxes in wet locations as described in CEC 406.8 (B) shall be provided with a “while-in-use” cover; red dot ‘CK’ Series of aluminum die-cast construction, NEMA 3R, with lacquer finish. 2.4 JUNCTION AND PULL BOXES A. Construction: Provide galvanized sheet steel junction and pull boxes, with screw-on covers; of the type shape and size, to suit each respective location and installation; with welded seams and equipped with steel nuts, bolts, screws and washers. Page 532 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 6 of 10 B. Location: 1. Install junction boxes above accessible ceilings for drops into walls for receptacle outlets from overhead. 2. Install junction boxes and pull boxes as required to facilitate the installation of conductors and limiting the accumulated angular sum of bends between boxes, cabinets and appliances to 300 degrees. 3. Locations: Junction boxes shall be located only where necessary and only in equipment rooms, closets, and accessible attic and underfloor spaces. A horizontal distance of 24” shall separate outlet boxes on opposite sides of occupancy separation walls, fire-rated walls or partitions. 4. Labeling: Junction box covers shall be marked with indelible ink indicated the circuit numbers passing through the box. 2.5 BOX EXTENSION ADAPTER A. Construction: Diecast aluminum. B. Location: Install over flush wall outlet boxes to permit flexible raceway extension from flush outlet to fixed or movable equipment. 2.6 CONDUIT FITTINGS A. Requirements: Provide corrosion-resistant punched-steel box knockout closures, conduit locknuts and plastic conduit bushings of the type and size to suit each respective use and installation. B. Steel boxes may allow for field knock-out modifications, but shall in all other ways conform to code requirements. 2.7 EXTERIOR IN-GRADE BOXES FOR NON-UTILITY COMPANY USE SHALL BE: A. Precast concrete or polymer concrete type with full bottoms and draining into gravel drywell. . Open bottom splice/pull boxes 24” x 36” and smaller shall be open bottom, with minimum 12” of gravel below for drainage. B. Flushmount in hardscape and 1” above grade in softscape. C. Provided with correct traffic type lid, i.e., full vehicular, intermediate incidental vehicular or pedestrian-rated as applicable stamped with “ELECTRIC”, “LIGHTING”, COMMUNICATIONS”, etc. cover identification as shown on the drawings or as applicable. All boxes or vaults located in streets, driveways, sidewalks wider than 8’, and turf areas where mowing takes place shall be traffic rated. D. Provided with brass hold-down bolts in cover. E. Provided with necessary box extensions to gain proper depth. F. Seal all conduits in underground boxes with duct seal after conductors have been installed. Page 533 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 7 of 10 2.8 IN-GRADE UTILITY COMPANY BOXES AND VAULTS A. In-grade boxes and pads for utility company, shall be as specified by the respective utility company with all of the company’s requirements and construction methods met. 2.9 PUTTY PADS A. Intumescent moldable firestop putty designed to protect electrical outlet boxes. B. Designed to install around outside of outlet boxes. PART 3 - EXECUTION 3.1 INSTALLATION A. Conduit systems listed below are for use in installations where they are permitted to be used by CEC and/or other occupancy restrictions. The below installation methods do not intend to suggest that these materials be installed in conflict with any applicable code. Special attention to applications shall be made in building types such as Educational, Health Care, wet location, hazardous locations, assembly occupancy and multi-story, but not limited to these. Requirements which are more restrictive than the CEC may be called for by the drawings and / or these specifications. These requirements must be adhered to. The Electrical Contractor shall be responsible to use the proper conduit system for the application. Exposed conduit is not allowed below ceilings or above slab of floor, without the permission and approval of the Architect. All conduits shall be concealed except in electrical and telecommunication rooms or where shown to be surface mounted. Exposed conduit (where allowed) shall be run square and plumb with building lines in an approved manner. Support roofmount conduits, where allowed, with minimum 12” wide blocks set in mastic unless otherwise detailed in roof requirements or as specified in roofing specification, by the Architect. Strap conduits to blocks with proper sized conduit straps. Spacing of support shall be a minimum as provided for in the CEC. All exposed conduit mounted below 8’ above finished grade shall be strapped at a minimum of 5’ spacing. B. Non-Metallic Rigid Conduit shall be used in concrete slabs, below concrete slabs on grade, or underground outside of a building slab or foundation. Maintain minimum depth requirements and cover with appropriate fill material. Minimum 4” of bedding and cover of backfill material 1/4" size grain and smaller maximum. Conduit shall be heavy wall Schedule 40 or 80, rigid PVC only. Rigid utility P&C duct shall not be used in any application. Properly sized grounding conductors shall be installed per CEC article 250, in all non-metallic conduit branch circuit and feeder runs. PVC conduit shall be formed or field bent only with the use of properly approved bending tools such as to not decrease the internal bore of the conduit. All conduits shall be cut square and reamed of burrs. Approved and compatible glue shall be used on all PVC fittings to attain watertight joints. All non-metallic conduit runs over 150’ in length and over 1 1/4" trade size conduit shall utilize galvanized rigid steel elbows. C. Galvanized Rigid Steel (GRS) conduit shall be used where exposed less than 8’–0” above finished grade to 18” below finished grade and where subject to physical damage. Conduits shall be cut square and reamed to remove burrs and sharp edges. Strap conduit below 8’ above Page 534 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 8 of 10 grade at 5’ intervals. Unless otherwise noted, threadless setscrew and threadless weathertight fittings may be used in lieu of threaded fittings. All threaded ends entering a junction box of any type shall require one locknut on the inside and one on the outside of the enclosure and be provided with a plastic bushing or grounding bushing where necessary for proper grounding. Where exposed to moisture, a watertight hub or other approved method shall be required. All conduits shall be stubbed up straight and uniform into junction boxes, panels, cabinets, etc., and shall be (GRS) properly supported and strapped. All GRS conduit located below grade, shall be tape wrapped. D. Electrical Metallic Tubing (EMT) shall be used as allowed by code and as permitted by this specification. It shall not be in contact with soil or the concrete slab on the ground floor of any structure. Connectors and couplings shall be steel insulated set screw type where installed in indoor dry locations not subject to moisture. Where the potential for moisture is present, compression type weathertight fittings are required. One hole conduit straps are permitted from 1/2" to 1” and two hole conduit straps are required for size 1 1/4” and larger. EMT shall not be allowed in areas subject to severe physical damage. Install copper ground wire sized per CEC 250-122 in all EMT conduits. E. Flexible conduit may be used where concealed in building construction or above dropped ceilings, but shall meet the following criteria: No individual circuit path from distribution panel to last device shall exceed a cumulative length of 30’ of flexible conduit from start to end. Flexible conduit shall not exceed a total directional change of 270 bending degrees in any one run between conduit terminations. Squeeze type or Jake type steel flex fittings of a grounding type are required. Flexible conduit must be supported in accordance with CEC. Where exposed to the weather, moisture, or spray down flexible conduit shall be of the liquidtight type. Fittings shall be manufactured for use with liquidtight flexible conduit. All motor connections shall be made with liquidtight flex. Flexible conduit may not be used where exposed except for last 2’ of equipment connection and unless otherwise noted or approved. A copper ground wire sized per CEC 250-122 shall be installed in all flexible conduit runs. Flexible conduit may not be used exposed. Weatherproof liquid tight conduit shall not be used at roof level for equipment connections with lengths exceeding 24” nor shall it be used to circumvent a rigid conduit system in a horizontal direction. Connect recessed lighting fixtures to conduit runs with a maximum of 6’ of flexible metal conduit extending from junction box to fixture. “Master” “Slave” fixtures are permitted to use manufactured flexible cable of longer dimension up to 12’ between “Master” and “Slave” only and only as a U.L. listed system component. F. Underground conduits and transition to above grade/slab shall be as follows: 1. PVC elbows allowed if top of elbow is minimum 18” BFG or below top of slab, otherwise GRS elbows are required. 2. GRS elbows are required if conduit run is 150’ or greater. 3. GRS risers are required from elbow below grade to equipment (device, outlet, panel, cabinet, etc.) above grade. 4. GRS elbows/risers to be PVC coated or 10 MIL taped wrapped (1/2” lapped) to 3” above finish grade or top of slab. G. Conduit Supports: Conduit runs may be supported by one-hole and two-hole straps or supports as manufactured by Unistrut, Minerallac, Caddy or equals. Supports may be fastened by means of anchors, shields, beam clamps, toggle bolts, or other approved methods appropriate for the application and size of conduit. Pipe nailers (J-hooks) may only be used for 1” conduit and smaller and only in wood frame construction. Conduit support methods are subject to review by Page 535 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 9 of 10 the engineer and authority having jurisdiction for adequacy. Installations deemed inadequate shall be corrected by the contractor at no cost to the Owner. H. Bends and offsets shall be made with approved tools for the type of conduit being utilized. Bends shall be made without kinking or destroying the smooth bore of the conduit. Parallel conduits shall be run straight and true with bends uniform and symmetrical. Minimum radii shall be per CEC 344-24. I. Conduit Stub-outs below grade shall be capped with plastic cap, and identified by placing a pull box marked with correctly identified utility such as “Elec”, “Tel”, etc. Dimension for exact location on field record drawings. Provide lids for proper field application (i.e. traffic, incidental, pedestrian). J. Conduit Seals: Where below grade conduits enter structure through slab or retaining wall of building or basement, seal the inside of each conduit as follows: 1. Provide damming material around conductors 3” into conduit. 2. Fill 3” of conduit with 3M #2123 sealing compound. 3. Wrap conductors where they exit the conduit with 3M #2229 "Scotch Seal" mastic tape. Lap tape to approximate diameter of the raceway and wrap outside of conduit opening with (minimum) one turn. 4. Use conduit sealing bushings type CSB (O-Z/Gedney) or equal. 5. Empty conduits shall be sealed with standard non-hardening duct seal compound and then capped to prevent entrance of moisture and gases and to meet fire resistance requirements. 6. Provide cable drip loop minimum 12” high. K. Marker tape: Place plastic yellow marker tape at 12” below finish grade along and above buried conduits. Label tape "CAUTION: ELECTRICAL LINES BELOW" or similar wording. L. Electrical and communications systems raceways routed underground shall not occupy the same trench as plumbing utilities such as sewer, water, storm drain, gas or other wet or dry gaseous utility system. A minimum of 12” of undisturbed earth is required. Where utilities must cross in closer proximity to each other due to physical constraints, 6” minimum crossing distances are allowed, however 18” on all sides of a utility crossing must be concrete encased. M. Conduits, routed below footings, slabs, grade beams, columns, and other structural elements shall be installed in strict compliance with structural details and criteria shown on structural plans. Clearances below structural elements and sleeves through structural elements must be carefully planned to avoid conflict and must be approved by the structural engineer if conflict arises. N. All conduit or raceways passing through fire rated walls, floors, or ceilings shall be installed with a listed penetration method which protects the opening to the same rating as the assembly and is non hardening. O. Expansion Joints 1. Conduits 3” and larger, that are secured to the building structure on opposite sides of a building expansion joint, require expansion and deflection couplings. Install the couplings in accordance with the manufacturer’s recommendations. 2. Provide conduits smaller than 3” with junction boxes on both sides of the expansion joint. Connect conduits to junction boxes with sufficient slack of flexible conduit to produce 5” Page 536 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0533 26 0533 – Raceways and Boxes for Electrical Systems Page 10 of 10 vertical drop midway between the end. All conduit shall have a copper green grounding bonding conductor installed. P. Seismic Joints 1. At seismic joints, provide conduits rigidly secured to the building structure on opposite sides of a building expansion joint with junction boxes or approved fittings, on both sides of the joint. Connect conduits to junction boxes with sufficient slack flexible conduit such that these slack conduits are 1 1/2 times the distance between conduit ends. Flexible conduit shall have a copper green ground bonding jumper installed. Q. Location: Locate boxes and conduit bodies so as to ensure accessibility of electrical wiring. R. Anchoring: Secure boxes rigidly to the substrate upon which they are being mounted, or solidly embed boxes in concrete or masonry. S. Special Application: Provide weatherproof outlets for locations exposed to weather or moisture. T. Knockout Closures: Provide knockout closures to cap unused knockout holes where blanks have been removed. U. Mount outlet boxes, unless otherwise required by ADA, or noted on drawings, the following distances above the finished floor: 1. Receptacles, Telephone, TV & Data outlets. (measured to bottom of outlet box): +15". 2. Outlet above counter (measured to top of outlet box): +46". 3. Control (light) Switches. (measured to top of outlet box): +48". 4. Fire Alarm Manual Pull Stations, T-stats. (measured to top of outlet box): +48". 5. Fire Alarm Visuals: the lower of +80" to bottom of lens, or 6" below ceiling. 6. Other Outlets: As indicated in other sections of specifications or as detailed on drawings. V. Coordinate all electrical device locations with the architectural floor plan and interior and exterior elevations to prevent mounting devices within elements that they may conflict such as cabinetry, mirrors, planters, etc. W. Size outlet and junction boxes to minimum wire fill space requirements. Upsize box as required to allow ease of wire installation and device installation. X. Outlet and junction boxes in fire rated walls shall be gauged and spaced so as not to exceed the maximum penetration allowed by the assembly without compromising the fire rating. If a conflict arises relative to a specific condition, the contractor shall follow the requirements of the fire authority and ask for guidance from the design team. At no time should a larger box be installed prior to resolution of conflict. END OF SECTION Page 537 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0534 26 0534 – Cabinets Page 1 of 2 SECTION 26 0534 CABINETS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Cabinets where shown on the contract drawings and specified herein. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 0553, IDENTIFICATION OF ELECTRICAL SYSTEMS. PART 2 - PRODUCTS 2.1 MATERIALS A. Type: Cabinets shall be flush or surface mounted type as indicated on the contract drawing, as per Code and U.L. Standard 50. B. Cabinet Construction: Sizes as indicated, constructed of code gauge sheet steel with hinged lockable doors, common keyed with panelboards. Equip cabinets with 3/4" fire retardant treated plywood backboards and/or barriers as applicable, terminal blocks for connection; index card holders and cards mounted behind heavy plastic on inside of cabinet doors. C. Finish: Cabinets shall be chemically cleaned and the fronts shall be finished in same way as panelboards and switchboards. D. Controls: As indicated on the contract drawings. E. Identification: Provide on exterior of cabinet doors engraved plastic nameplate identifying the cabinet as designated on the Contract Drawing. Lettering shall be white on black finish and shall be minimum 3/16” high. Affix nameplates to cabinet doors with a minimum of two escutcheon pins or screws. Page 538 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0534 26 0534 – Cabinets Page 2 of 2 PART 3 - EXECUTION 3.1 GENERAL A. Required: To be located where indicated on the Contract Drawing and installed as per manufacturer's instruction. Securely fasten to structural members or Unistrut support in vertical and plumb position and at heights indicated. B. Nameplates: Conform to provisions noted in 2.1E above or as designated on the plans. END OF SECTION Page 539 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 1 of 6 SECTION 26 0546.13 ELECTRIC UTILITY SYSTEMS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Manholes, handholes and ducts to form a complete underground raceway system. 2. “Duct” and “conduit”, and “raceway” are used interchangeably in this specification and have the same meaning. Refer to Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS for approved raceway and materials as well as execution. 3. Scope of Work: Furnishing, installation and connection of manholes, handholes and ducts to form a complete underground raceway system for distribution of electrical and signal systems and utility service entrance facilities. This specification shall also provide guidance for construction of the utility company underground and substructure requirements. Contact serving company directly and obtain current detailed requirements of installation and adhere by same. Provide trenching, conduit, backfill, boxes and equipment pads as applicable. Nothing here in shall be construed to be in conflict with the requirements of the utility company, which shall take precedence over any possible conflicting requirement. B. Related Work: 1. SITEWORK. 2. FLATWORK. 3. LANDSCAPING. 4. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 5. Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS: Conduits, fittings and boxes for raceway systems. 6. Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS. 7. Section 31 2200, GRADING 1.3 SUBMITTALS A. Submit in accordance with Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. B. Shop Drawings: Page 540 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 2 of 6 1. Sufficient information, clearly presented, shall be included to determine compliance with drawings and specifications. 2. Include manholes, handholes, duct materials, and hardware. Proposed deviations from details on the drawings shall be clearly marked on the submittals. 3. If necessary to locate manholes or handholes at locations other than shown on the drawings, show the proposed locations accurately on scaled site drawings. 4. Precast manholes and handholes: Submit detail drawings and design calculations for approval prior to installation. 1.4 APPLICABLE PUBLICATIONS A. Publications listed below (including amendments, addenda, revisions, supplements, and errata) form a part of this specification to the extent referenced. Publications are referenced in the text by the basic designation only. B. Underwriters Laboratories, Inc. (UL): 1. UL 467 Grounding and Bonding Equipment 2. UL 651 Schedule 40 and 80 Rigid PVC Conduit 3. UL 6 Electrical Rigid Metal Conduit-Steel C. National Fire Protection Association (NFPA): 1. 70 California Electrical Code (CEC) D. National Electrical Manufacturers Association (NEMA): 1. RN 1 Polyvinyl Chloride (PVC) Externally Coated Galvanized Rigid Steel Conduit and Intermediate Metal Conduit 2. TC 2 Electrical Polyvinyl Chloride (PVC) Tubing And Conduit 3. TC 3 PVC Fittings For Use With Rigid PVC Conduit And Tubing E. American Concrete Institute (ACI): 1. 318 Building Code Requirements For Structural Concrete F. American Society for Testing and Materials (ASTM): 1. C478 Standard Specification for Precast Reinforced Concrete Manhole Sections 2. C478M Standard Specification for Precast Reinforced Concrete Manhole Sections (Metric). 3. F512-95 Standard Specification for Smooth-Wall Polyvinyl Chloride (PVC) Conduit and Fittings for Underground Installation G. Utility company Handout Package and Construction Requirements for Underground and Substructure Installation. PART 2 - PRODUCTS 2.1 MATERIALS A. Concrete: ACI 318, 3000 psi minimum 28 day compressive strength. Page 541 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 3 of 6 B. Reinforcing Steel: Number 4 minimum. C. Manhole Hardware: 1. Frames and covers (traffic type). 2. Sump frames and gratings. 3. Pulling Irons: 7/8” diameter hot dipped galvanized steel bar with exposed triangular shaped opening. 4. Cable supports: a. Cable stanchions, hot rolled, heavy duty, hot dipped galvanized "T" section steel 2 1/4" by 1/4" in size and punched with 14 holes on 1 1/2" centers for attaching cable arms. b. Cable arms, 3/16” gage, hot rolled, hot dipped galvanized sheet steel pressed to channel shape. Arms shall be approximately 2 1/2" wide and 14” long. c. Insulators for cable supports, high glazed, wet process porcelain. d. Spares: Equip each cable stanchion with two spare cable arms and six spare insulators for future use. e. Miscellaneous hardware, hot dipped galvanized steel. D. Handhole Hardware: 1. Frames and covers configuration as shown on the drawings. 2. Pulling irons, 7/8” diameter galvanized steel bar with exposed triangular shaped opening. E. Cable supports are not required. F. Ground Rod Sleeve: Provide a 3” PVC sleeve in manhole floors so that a driven ground rod may be installed. G. Manholes and Handholes shall be precast units and be constructed as described below. Units shall comply with ASTM C478, C478M. 1. Size: Plan area and clear height shall be not less than that shown on the drawings. 2. Accessories, hardware, and facilities shall be the same as required for poured in place type. 3. Assume ground water level 3’ below ground surface unless a higher water table is shown in the boring logs and adjust design accordingly. H. Ducts: 1. Size shall be as shown on drawings. 2. Ducts (concrete encased): a. Plastic Conduit: 1) NEMA TC6 & 8 and TC9 plastic utilities conduit UL 651 and 651A Schedule 40 PVC. 2) Duct shall be suitable for use with 90 degree C rated conductors. 3. Ducts (direct burial): a. Plastic duct: 1) NEMA TC2 and TC3, EPC-40, Type II. 2) UL 651 and 651A, Schedule 40 Schedule 80 PVC. 3) Duct shall be suitable for use with 75 degree C rated conductors. b. Rigid metal conduit, PVC-coated: UL6 and NEMA RN1 galvanized rigid steel, threaded type, coated with PVC sheath bonded to the galvanized exterior surface, nominal 0.040” thick. Page 542 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 4 of 6 I. Ground Rods: Per Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS. J. Ground Wire: Stranded bare copper No. 6 AWG minimum. K. Conduit Spacers: Prefabricated plastic. L. Warning Tape: Standard 4 mil polyethylene 3” wide tape, detectable type, red with black letters, imprinted with “CAUTION BURIED ELECTRIC CABLE BELOW”. M. Pull Rope: Plastic with 200 pound minimum tensile strength. PART 3 - EXECUTION 3.1 TRENCHING A. Refer to EARTHWORK section of specification for trenching back-filling, and compaction requirements. B. Work with extreme care near existing ducts, conduits, cables, and other utilities to avoid damaging them. C. Cut the trenches neatly and uniformly for utility company trenches, notify for inspections by utility company a minimum of 48 hours in advance. D. Conduits to be installed under existing paved areas, roads, and railroad tracks which are not to be disturbed shall be protected into place. Conduits shall be minimum 36” cover. E. Trench Preparation: A 4” sand bedding is required if trench bottom is not rock free. A 4” sand covering over the cable is required if the native backfill is not rock free. Backfill and compaction should meet City, County, State and utility company requirements. The serving utility company may required 100% sand backfill. All backfill requirements shall also meet or exceed those set forth in the earthwork or civil section of this specification. F. Excavation: Provide 6” gravel in bottom of excavated holes for subsurface transformers and all concrete boxes. Spare gravel shall be available for final adjustment. The Contractor is responsible for final grade level of enclosures and boxes. Non-conformance will be corrected by electrical contractor at his expense. G. Conduit Routing: Sharp turns, bends, or other irregularities in the conduit must be avoided. Minimum radius bends shall be as required by the serving utility company. Every effort should be made to obtain a straight water tight conduit line. The end of all spare conduits must be capped. The utility company Inspector must approve deviation from layout. H. Conformance: All work must conform to the utility company “handout package” and Specification 59 and/or 99. Copies are available from the utility company upon request. I. Joint Trenching: Maintain all required depths, clearance and separations as required by code, ordinance or utility company policies. Coordinate with other utilities to confirm requirements. Page 543 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 5 of 6 3.2 OTHER PADMOUNTED EQUIPMENT A. Provide adequately sized and reinforced concrete pads with openings for conduit(s) as necessary by the utility company and or the equipment manufacturer. B. A grounding system shall be installed at each padmounted piece of equipment including, but not limited to, a ground rod, grounding conductor, ufer, and ground grid (if called for). C. Padmounted equipment shall be bolted to concrete pad with minimum 5/8” x 7 1/2" anchor bolts, one in each of 4 corners of each section of padmounted equipment. END OF SECTION Page 544 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0546.13 26 0546.13 – Electric Utility Systems Page 6 of 6 THIS PAGE INTENTIONALLY LEFT BLANK Page 545 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0553 26 0553 – Identification of Electrical Systems Page 1 of 4 SECTION 26 0553 IDENTIFICATION OF ELECTRICAL SYSTEMS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Nameplates and warning signs where specified herein and as shown on contract documents including the following: a. Nameplates and warning signs permanently installed on all electrical equipment and devices including, but not limited to, the following items: 1) Enclosures for transformers, switchboards, motor control, panels, pullboxes, cabinets, motors, generators, transfer switches. 2) Enclosures for all separately enclosed devices including, but not limited to, disconnect switches, circuit breakers, contactors, time switches, control stations and relays, fire alarm panels and lighting control panel. 3) Wall switches not within sight of outlet controlled. 4) Special systems such as, but not limited to, telephone, fire alarm, warning and signal systems. Identification shall be at each equipment rack, terminal cabinet, control panel, annunciator and pullbox. 5) Devices mounted within and part of equipment including circuit breakers, switches, control devices, control transformers, relays, indication devices and instruments. 2. Conductor and Cable Identification. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES. 3. Section 26 2416, PANELBOARDS. PART 2 - PRODUCTS 2.1 EQUIPMENT LABEL DESIGNATIONS A. Equipment labels indicating equipment designations both emergency and normal. Designation data per drawings or to be supplied with shop drawings approval. Page 546 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0553 26 0553 – Identification of Electrical Systems Page 2 of 4 B. Panelboard labels showing panel designation, voltage, phase and source. C. In accordance with CEC 110.16, provide arc flash protection warning labels on all switchboards, panelboards, distribution panels, transformers, safety switches, transfer equipment, etc. Labels shall be per ANSI Z535.4 guidelines. 2.2 MATERIALS A. For Labels: Three layer laminated plastic or micarta with engraved white letters over black background. B. For Warning Signs: Minimum 18 gauge steel with red lettering on white porcelain enamel finish. C. Arc flash labels shall be provided as required by CEC Article 70E. D. Conductor tape number markers: TayMac MX4280 Series non-fading permanent adhesive. PART 3 - EXECUTION 3.1 MOUNTING A. Equipment labels shall be mounted by self-tapping, threaded screws and bolts, or by rivets. Adhesive types are not acceptable unless specifically noted in this section. B. Conductor tape markers shall be consistently placed for ready conductor identification. 3.2 HEIGHTS ON LABELS A. Panelboards, Switchboards and Motor Control Centers and Special Systems Enclosures: 1/4" identify equipment designation; 1/8” identify voltage rating and source. B. Individual Circuit Breakers, Switches, and Motor Starters in Panelboards, Switchboards, and Motor Control Centers: 3/16” identify circuit and load served, including location of equipment. C. Enclosed Circuit Breakers, Enclosed Switches, and Motor Starters: 3/16” identify load served. D. Transformers: 3/16” identify equipment designation; 1/8” identify primary and secondary voltages, primary source and secondary load. Include location of primary source or secondary load if remote from transformer. 3.3 WARNING SIGNS A. Warning signs shall be permanently mounted with cadmium plated steel screws or nickel-plated brass bolts. Page 547 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0553 26 0553 – Identification of Electrical Systems Page 3 of 4 B. Warning signs to read "DANGER - HIGH VOLTAGE", with letters 1 1/2" high, 3/16” stroke minimum. C. Provide warning sign on all doors or immediately next to door for equipment rooms, enclosures or closets containing equipment energized above 150 volts to ground as per CEC, and/or as directed by the Architect. For interior finish spaces and interior doors, signage shall be coordinated and approved with the Architect in advance of installation. END OF SECTION Page 548 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0553 26 0553 – Identification of Electrical Systems Page 4 of 4 THIS PAGE INTENTIONALLY LEFT BLANK Page 549 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0900 26 0590 – Controls and Instrumentation Page 1 of 2 SECTION 26 0900 CONTROLS AND INSTRUMENTATION PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Control devices, shown on the drawings and/or required by other sections, to assure a complete and operating system. 2. Furnish submittals/shop drawings for all equipment in this section as described in Section 26 0500, 1.4, COMMON WORK RESULTS FOR ELECTRICAL. PART 2 - PRODUCTS 2.1 MATERIALS A. Terminal and Control Cabinets shall be manufactured from code gauge galvanized steel with hinged locking covers finished in grey or hammer tone enamel. Knockouts, barriers and plywood backing shall be provided where required. Cabinets shall be of raintight construction where exposed to the weather. Approved manufacturers are Circle AW, Wireguard, Benner- Nawman, or equal. B. Photocontrols and time switches shall be provided as indicated on the drawings. Approved manufacturers are Intermatic, Paragon, Tork or equal. Where indicated on the fixture schedule, photocells in outdoor fixtures shall be factory installed and wired. C. Lighting Contactors shall be of the correct number of poles with suitable contact ampere ratings. Provide fusing protection for all lighting contactor control circuits. Verify all coil voltages prior to installation. Approved manufacturers are General Electric, Westinghouse, Square "D" or equal. D. Motor Controls shall be manual or magnetic with motor overload thermal relays. Individual thermal elements sized to the correct motor full load amps shall be used. Provide correct NEMA rated enclosure. Select proper voltage, class, size and horsepower rating. Select the correct coil voltage if magnetic. Page 550 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 0900 26 0590 – Controls and Instrumentation Page 2 of 2 PART 3 - EXECUTION 3.1 INSTALLATION A. Power to all irrigation controllers shall be provided by the Electrical Contractor as required for the irrigation equipment. Also provide and install conduit sweeps as required to house low voltage wiring between controller and exterior below grade. B. General Purpose Control Contactors shall be rated for the use with the correct ampere rating, voltage, size and horse power rating. Select the correct control coil voltage. END OF SECTION Page 551 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 1 of 6 SECTION 26 2416 PANELBOARDS PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Panelboards. B. Related Work: 1. Division 09 “PAINTING”: Identification and painting of panelboards. 2. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 3. Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS. 4. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES (600 VOLTS AND BELOW): Cables and wiring. 5. Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS: Requirements for personnel safety and to provide a low impedance path for possible ground fault currents. 1.3 APPLICABLE PUBLICATIONS A. Publications listed below (including amendments, addenda, revisions, supplements and errata) form a part of this specification to the extent referenced. Publications are referenced in the text by the basic designation only. B. Underwriters Laboratories, Inc. (UL): 1. No. 50-1995 Enclosures for Electrical Equipment 2. No. 67-1993 Panelboards 3. No. 489-1991 Molded Case Circuit Breakers and Circuit Breaker enclosures C. National Fire Protection Association (NFPA): 1. No. 70-2010 California Electrical Code (CEC) D. National Electrical Manufacturers Association (NEMA): 1. No. PB-1-2002 Panelboards. 2. No. AB-3-1996 Molded Case Circuit Breakers and Their Application. Page 552 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 2 of 6 PART 2 - PRODUCTS 2.1 PANELBOARDS A. Panelboards shall be in accordance with UL, NEMA, NEC, CEC and as shown on the drawings. Approved manufacturers are Cutler Hammer, Square D, Seimens, General Electric. B. Panelboards shall be standard manufactured products. All components of the panelboards shall be the product and assembly of the same manufacturer. All similar units of all panelboards to be of the same manufacturer. C. All panelboards shall be dead front safety type. Arrange sections for easy removal without disturbing other sections. D. All panelboards shall be completely factory assembled with molded case circuit breakers. All factory wiring shall be checked for correct tightness and visually inspected to insure that bussing and terminations have not become loose in transit to job site. E. Panelboards shall have main breaker or main lugs, bus size, voltage, phase, top or bottom feed, and flush or surface mounting as scheduled on the drawings. Refer to single line diagram and panel schedules on drawings. Terminals shall be minimum 75 degree rated. Back fed main circuit breakers are not allowed. Main circuit breakers shall be vertically mounted. F. Panelboards shall have the following features: 1. Nonreduced size copper bus bars, and connection straps bolted together and rigidly supported on molded insulators. Bus bar taps for panels with single pole branches shall be arranged for sequence phasing of branch circuit devices. 2. Full size neutral bar, mounted on insulated supports. 3. Ground bar and isolation ground bar (where called for in panel schedule) with sufficient terminals for all grounding wires. Buses braced for the available short circuit current. 4. All breakers and phase bus connections shall be arranged so that it will be possible to substitute a 2-pole breaker for two single pole breakers, and a 3-pole breaker for three single pole breakers, when trip is 30 amps or less and frame size is 100 amperes or less, without having to drill and tap the main bus bars at bus straps. Where used for heating and air conditioning, and refrigeration equipment, use only HACR type U.L. listed circuit breakers. 5. Design interior so that protective devices can be replaced without removing adjacent units, main bus connectors, and without drilling or tapping. 6. Where designated on panel schedule as "space", include all necessary bussing, device support and connections. Provide blank cover for each space. 7. In two section panelboards, the main bus in each section shall be full size. The first section shall be furnished with subfeed lugs on the line side with cable connections to the second section. Panelboard sections with tapped bus or crossover bus are not acceptable. 8. Series rated panelboards are not permitted. 9. Label all panels in accordance with Section 26 0553, IDENTIFICATION OF ELECTRICAL SYSTEMS. 10. Recessed panel space conduit: Provide (1) ¾ inch spare conduit stubbed to accessible ceiling space and/or interstitial space below floor for every (5) spaces and spares indicated on panel schedules. Page 553 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 3 of 6 G. Panelboards serving as building mains shall be “service entrance rated” and UL Listed as “service equipment”. 2.2 CABINETS AND TRIMS A. Cabinets: 1. Provide galvanized steel cabinets to house panelboards. Cabinets for outdoor panels shall be factory primed and suitably treated with a corrosion-resisting paint finish meeting UL standard for outdoor applications. 2. All ventilated openings in panelboards and switchboards, shall be furnished with dust filters to prevent entrance of dust and debris. 3. Cabinets for panelboards may be of one piece formed steel or of formed sheet steel with end and side panels welded, riveted, or bolted as required. 4. Provide necessary hardware for "in" and "out" adjustment of panel interior. 5. Cabinets for two section panelboards shall be arranged side by side, and shall be the same height. Flush mounted cabinets should be 1 1/2" apart and coupled by conduit nipple if necessary. 6. Gutter size in panel boxes, on all sides, shall be in accordance with the CEC. Penetrations through gutter to live area of the panelboard shall incorporate approved non-metallic- grommet type of insulation to protect wire passing through. B. Trims: 1. Fabricate trim of sheet steel consisting of frame with door attached by concealed hinges. Provide flush or surface trim as shown on the drawings. 2. Flush trims shall overlap the box by at least 3/4" all around. 3. Surface trim shall have the same width and height as the box. 4. Flush or surface trims shall not have ventilating openings. 5. Secure trims to back boxes by indicating trim clamps. 6. Provide a welded angle on rear of trim to support and align trim to cabinet. 7. Provide separate trims for each section of multiple section panelboards. Trims and doors of sections shall be of the same height. C. Doors: 1. Provide doors with flush type latch and manufacturer's standard lock. Doors over 48 inches in height shall have a vault handle and a three-point catch, arranged to fasten door at top, bottom, and center. 2. In making switching devices accessible, doors shall not uncover any live parts. 3. Provide concealed hinges welded to the doors and trims. 4. For lighting or power contactors incorporated in panelboards, provide separate doors for the contactors. 5. Provide keyed alike system for all panelboards. 6. Provide a directory card, metal holder, and transparent cover. Permanently mount holders on inside of doors. D. Painting: 1. Thoroughly clean and paint trims and doors at the factory with primer and manufacturer's standard finish. E. Breaker features shall be as follows: 1. Integral housing of molded insulating material. Page 554 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 4 of 6 2. Silver alloy contacts. 3. Arc quenchers and phase barriers for each pole. 4. Quick-make, quick-break, operating mechanisms. 5. A trip element for each pole, thermal magnetic type with long time delay and instantaneous characteristics, a common trip bar for all poles and a single operator. 6. Electrically and mechanically trip free. 7. An operating handle which indicates ON, TRIPPED, and OFF positions. a. Line connections shall be bolted. b. Interrupting rating shall not be less than the maximum short circuit current available at the line terminals as indicated on the drawings, and as shown on the electrical system protective device study as required in Section 26 0573 OVERCURRENT PROTECTIVE DEVICE COORDINATION STUDY. The interrupting rating shall not be less than the minimum identified requirement. 8. An overload on one pole of a multipole breaker shall automatically cause all the poles of the breaker to open. 2.3 INSTALLATION A. Installation shall be in accordance with CEC, as shown on the drawings, and as specified. B. Locate panelboards so that the present and future conduits can be conveniently connected. Coordinate the sizes and layout of cabinets within the designated spaces. All equipment must be dimensioned in order to physically fit in the spaces provided and to comply with all code required clearances. C. Install a typewritten schedule of circuits in each panelboard. Include the room numbers (as finally described by the Owner) and items served on the cards. Obtain final room numbers from Architect prior to creating schedule. D. Mount the panelboard so that maximum height of the top circuit breaker above finished floor shall not exceed 78 inches. E. For panelboards located in areas accessible to the public, paint the exposed surfaces of the trims, doors, and boxes with finishes to match surrounding surfaces after the panelboards have been installed. F. Circuit numbers shall correspond to the approved panel schedule. Provide as-built drawings showing the actual circuit numbers being used for each device on each branch circuit if changes are required. G. Verify depth of all flushmounted enclosures in walls to be certain wall depth will accommodate panel depth prior to installation. H. All openings in switchgear and panelboards that are unused shall be sealed with bolts and washers. Use caulking where holes or openings cannot be sealed by way of a washer, or bolts or conduit seals. I. Contractor shall include the services of an independent testing company to test GFI circuit breakers in distribution and main panelboards. Page 555 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 5 of 6 END OF SECTION Page 556 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2416 26 2416 – Panelboards Page 6 of 6 THIS PAGE LEFT INTENTIONALLY BLANK Page 557 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2726 26 2726 – Wiring Devices Page 1 of 3 SECTION 26 2726 WIRING DEVICES PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Wiring devices. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS. 3. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES. 4. Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS. PART 2 - PRODUCTS 2.1 RECEPTACLES A. General: All receptacles shall be listed by Underwriters Laboratories, Inc. 1. Mounting straps shall be plated steel, with break-off plaster ears and shall include a self- grounding feature (this feature does not substitute for a grounding conductor terminated on grounding strap of device). Terminal screws shall be brass, brass plated or a copper alloy metal. 2. Receptacles shall be of a screw terminal type, “pressure type quick wire” terminations are not allowed. B. Duplex receptacles shall be Style Line/Decora single phase, 20 ampere, 120 volts, 2-pole, 3-wire, and conform to the NEMA 5-20R configuration in NEMA WD 6. The duplex type shall have bussing break-off feature for two-circuit operation. The ungrounded pole of each receptacle shall be provided with a separate terminal. 1. Bodies shall be white in color. Verify wiring device color selection to be provided by Architect. Contractor to verify device color with Architect prior to procurement. 2. Switched duplex receptacles shall be wired so that only the top receptacle is switched. The remaining receptacle shall be unswitched. 3. Ground Fault Interrupter Duplex Receptacles: Shall be an integral unit suitable for mounting in a standard outlet box. Page 558 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2726 26 2726 – Wiring Devices Page 2 of 3 a. Ground fault interrupter shall be commercial grade and consist of a differential current transformer, solid state sensing circuitry and a circuit interrupter switch. It shall be rated for operation on a 60 Hz, 120 volt, 20-ampere branch circuit. Device shall meet CEC requirements. Device shall have a minimum nominal tripping time of 1/30th of a second. Devices shall meet UL 943. C. Receptacles; 20, 30 and 50 ampere, 250 volts: Shall be complete and match with appropriate cord grip plug. Devices shall meet UL 231. D. Weatherproof Receptacles: Shall consist of a listed weather resistant duplex receptacle, mounted in box with a gasketed, while in use weatherproof, cast metal cover plate and cap receptacle opening. The cap shall be permanently attached to the cover plate by a spring-hinged flap. Approved manufacturers: Intermatic WP10 Series, Thomas & Betts/Red Dot 2CK Series, or engineer approved equal. 2.2 SWITCHES AND DIMMERS A. Style Line/Decora rocker switches shall be totally enclosed tumbler type with bodies of phenolic compound. Toggle handles color to match receptacle device color unless otherwise specified. 1. Shall be single unit toggle, butt contact, quiet AC type, heavy-duty general-purpose use with an integral self grounding mounting strap with break-off plasters ears and be of a screw terminal type. 2. Shall be color coded for current rating, listed by Underwriters Laboratories, Inc., and meet the requirements of NEMA WD 1, Heavy-Duty and UL 20. 3. Ratings: a. 120 volt circuits: 20 amperes at 120-277 volts AC. b. 277 volt circuits: 20 amperes at 277 volts AC. 4. The switches shall be mounted on the strike plate side of doors. 5. Incorporate barriers between switches with multi-gang outlet boxes where required by the CEC. 6. All toggle switches shall be of the same manufacturer. 2.3 WALL PLATES A. Wall plates for switches and receptacles shall be thermo plastic B. Standard NEMA design, so that products of different manufacturers will be interchangeable. Dimensions for openings in wall plates shall be accordance with NEMA WD1. C. For receptacles or switches ganged together, wall plates shall be a single ganged plate. D. Wall plates for data, telephone or other communication outlets shall be as specified in the associated specification. E. Surface mounted boxes, NEMA1, shall be industrial grade raised galvanized steel covers. In shop areas all receptacles shall be dust proof and or waterproof where applicable. Page 559 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 2726 26 2726 – Wiring Devices Page 3 of 3 F. Waterproof device covers shall be cast iron, 4-corner screw type, for FS and FD type mounting. Device covers shall be zinc galvanized finish. Weatherproof covers shall be lockable. PART 3 - EXECUTION 3.1 INSTALLATION A. Switches installed in hazardous areas shall be explosion proof type in accordance with the CEC and as shown on the drawings. B. Installation shall be in accordance with the CEC, NECA “Standard of Installation”, and as shown as on the drawings. C. Ground terminal of each receptacle shall be bonded to the outlet box with an approved green bonding jumper, and also be connected to the green equipment grounding conductor. D. General: Devices shall be of the type specified herein. All devices shall be installed with “pigtailed” leads from the outlet box. No device shall be used in the “feed through” application. Screw terminals shall be used to connect all devices to the circuit and shall be grounded by means of a ground wire where grounding terminals are provided in the device. E. Installation: Devices and plates shall be installed in a “plumb” condition and must be flush with the finish surface of the wall where boxes are recessed. F. Mounting heights: All control and convenience devices shall comply with California Code of Regulations Title 24 and ADA with respect to accessibility requirements. Mounting heights indicated on plans shall have precedence. G. Install switches with the off position down. H. Clean debris from outlet boxes. I. Provide extension rings as required to bring outlet boxes flush with finished surface or casework. J. Test each receptacle device for proper polarity. END OF SECTION Page 560 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 1 of 6 SECTION 26 5100 INTERIOR LIGHTING PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. Interior lighting systems, including luminaires, ballasts, lamps and emergency lighting equipment. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS: Conduits, fittings, and boxes for raceway systems. 3. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES (600 VOLTS AND BELOW): Low voltage power and lighting wiring. 4. Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS: Requirements for personnel safety and to provide a low impedance path for possible ground fault currents. 5. Section 26 5600, EXTERIOR LIGHTING. 6. Section 26 5670, LIGHTING ACCEPTANCE TESTING. 1.3 SUBMITTALS A. Submit in accordance with Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. B. Shop Drawings: 1. Sufficient information, clearly presented, shall be included to determine compliance with drawings and specifications. 2. Include electrical ratings, dimensions, mounting, details, materials, terminations, wiring and connection diagrams, photometric data, ballasts, luminaires, lamps and controls. 1.4 APPLICABLE PUBLICATIONS A. Publications listed below (including amendments, addenda, revisions, supplements) form a part of this specification to the extent referenced. Publications are referenced in the text by the basic designation only. Page 561 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 2 of 6 B. American Society for Testing and Materials (ASTM). C. American National Standards Institute (ANSI). D. Aluminum Association Inc. (AA). E. Illuminating Engineering Society of North America (IESNA). F. National Electrical Manufacturers Association (NEMA). G. National Fire Protection Association (NFPA). H. Underwriters Laboratories, Inc. (UL). 1.5 DEFINITIONS A. Lighting terminology used herein is defined in IES B. Exception: The term “driver” is used herein to cover both drivers and power supplies, where applicable. C. Clarification: The term “LED light source(s)” is used herein per IES to cover LED package(s), module(s), and array(s). PART 2 - PRODUCTS 2.1 MATERIALS AND EQUIPMENT A. Materials and equipment shall be in accordance with CEC, UL, ANSI, and as shown on the drawings and specified. 2.2 LIGHTING FIXTURES (LUMINAIRES) A. Shall be in accordance with NFPA 70, UL 1598 and shall be as shown on drawings and as specified. All luminaires shall have been certified to the California Energy Commission by its manufacturer to comply with the efficiency standards as per California Code of Regulations Title 24, Part 6, Section 111 referencing the Appliance Efficiency Regulations in Title 20. Post certification with building permit. B. Sheet Metal: 1. Shall be formed to prevent warping and sagging. Housing, trim and lens frame shall be true, straight (unless intentionally curved) and parallel to each other as designed. 2. Wireways and fittings shall be free of burrs and sharp edges and shall accommodate internal and branch circuit wiring without damage to the wiring. 3. When installed, any exposed fixture housing surface, trim frame, door frame and lens frame shall be free of light leaks; lens doors shall close in a light tight manner. Page 562 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 3 of 6 a. Hinged door closure frames shall operate smoothly without binding when the fixture is in the installed position, and latches shall function easily by finger action without the use of tools. C. Ballasts shall be serviceable while the fixture is in its normally installed position, and shall not be mounted to removable reflectors or wireway covers. D. Recessed fixtures shall be of the type approved for the ceiling and insulation conditions and appropriate for the installation location. Insulation must be held back from the fixture to provide manufacturers' recommended clearances for proper operation. Thermal tripping shall be the installer's responsibility to correct. Where installed in fire rated ceilings, coordinate installation of fire rated enclosures around the ceiling penetrations. Fixtures shall contain the proper through wiring capacity for that which is shown on the plans. E. Recessed fixtures shall be provided with the appropriate trims and hardware compatible with the ceiling type shown. Plaster frames are required where plaster or gypsum board ceilings are encountered. F. Mechanical Safety: Lighting fixture closures (lens doors, trim frame, hinged housings, etc.) shall be retained in a secure manner by captive screws, chains, captive hinges or fasteners such that they cannot be accidentally dislodged during normal operation or routine maintenance. G. Metal Finishes: 1. The manufacturer shall apply standard finish (unless otherwise specified) over a corrosion resistant primer, after cleaning to free the metal surfaces of rust, grease, dirt and other deposits. Edges of pre-finished sheet metal exposed during forming, stamping or shearing processes shall be finished in a similar corrosion resistant manner to match the adjacent surface(s). Fixture finish shall be free of stains or evidence of rusting, blistering, or flaking. 2. Interior light reflecting finishes shall be white with not less than 85 percent reflectances, except where otherwise specified on the drawing. 3. Exterior finishes shall be as shown on the drawings. H. Provide all lighting fixtures with a specific means for grounding metallic wireways and housings to an equipment grounding conductor. I. Light Transmitting Components for Fluorescent Fixtures: 1. Shall be 100 percent virgin acrylic plastic or water white, annealed, crystal glass. 2. Flat lens panels shall have not less than 1/8 inch of average thickness. The average thickness shall be determined by adding the maximum thickness to the minimum unpenetrated thickness and dividing the sum by 2. 3. Unless otherwise specified, lenses, diffusers and louvers shall be retained firmly in a metal frame by clips or clamping ring in such a manner as to allow expansion and contraction of the lens without distortion or cracking. J. Recessed LED fixtures shall be manufactured specifically for compact fluorescent or LED lamps with ballasts or drivers integral to the fixture. Assemblies designed to retrofit fixtures are prohibited except when described in this fashion. Fixtures shall be designed for lamps as specified. K. Provide fixtures with a U.L. listing for shower or shower rating above shower or tub areas. Page 563 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 4 of 6 2.3 LED LUMINAIRE REQUIREMENTS A. General Requirements: 1. Luminaire shall have an external label per ANSI C136.15 2. Luminaire shall have an internal label per ANSI C136.22. 3. Luminaires shall start and operate in -20°C to +40°C ambient. 4. LED light source(s) and driver(s) shall be RoHS compliant. 2.5 LED DRIVER A. Driver 1. Rated case temperature shall be suitable for operation in the luminaire operating in the ambient temperatures as indicated. 2. Shall accept the voltage or voltage range indicated, and shall operate normally for input voltage fluctuations of plus or minus 10 percent. Consistent with NEMA SSL 1. 3. Shall have a minimum Power Factor (PF) of 0.90 at full input power and across specified voltage range. B. Electromagnetic interference 1. Shall have a maximum Total Harmonic Distortion (THD) of 20% at full input power and across specified voltage range. 2. Shall comply with FCC 47 CFR part 15 non-consumer RFI/EMI standards. C. The following shall be in accordance with corresponding sections of ANSI C136.37 1. Wiring and grounding 2. All internal components shall be assembled and pre-wired using modular electrical connections. 3. Mounting provisions 4. Terminal blocks for incoming AC lines 5. Latching and hinging 6. Ingress protection 2.6 LAMPS A. Provide lamps for all luminaires. B. Lamps, coated or clear as recommended by luminaire manufacturer to provide for maximum luminaire efficiency in luminaire used. Provide coated lamps for all interior luminaires. C. For interior use, all metal halide lamps installed in a common area of building are of the same manufacturer’s production run. Color discontinuities after initial “burn in” are unacceptable and shall be replaced if deemed unacceptable to Owner. All indoor HID lamps shall be coated unless otherwise noted. D. Position oriented lamps shall be used in all horizontal mounted lamp position fixtures. Universal lamp is not acceptable in horizontal lamp position. E. LED LIGHT SOURCE 1. Minimum Color Rendering Index (CRI): 60. Page 564 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 5 of 6 2. Correlated Color Temperature (CCT) a. CCT shall be as listed in Table 1 below: Table 1. Allowable CCT Manufacturer-Rated Nominal CCT (K) Allowable LM-79 Chromaticity Values Measured CCT (K) 2700 2580 to 2870 3000 2870 to 3220 3500 3220 to 3710 4000 3710 to 4260 4500 4260 to 4746 5000 4745 to 5311 5700 5310 to 6020 6500 6020 to 7040 2.7 INSTALLATION A. Installation and furnishing of lighting fixtures shall be in accordance with the CEC, manufacturer's instructions and as shown on the drawings or specified. Fixtures damaged in transit and storage prior to completion shall be replaced at Contractor’s expense. B. Align, mount and level the lighting fixtures uniformly. C. Avoid interference with and provide clearance for equipment. Where the indicated locations for the lighting fixtures conflict with the locations for equipment, change the locations for the lighting fixtures by the minimum distances necessary as approved by the Architect. The Architectural reflected ceiling plan will take precedence over electrical plans. D. For suspended lighting fixtures, the mounting heights shall provide the clearances between the bottoms of the fixtures and the finished floors as shown on the drawings. E. Lighting Fixture Supports: 1. Contractor shall provide support for all of the fixtures independent of suspended ceilings. Supports may be anchored to channels of the ceiling construction, to the structural slab or to structural members within a partition, or above a suspended ceiling. 2. Shall maintain the fixture positions after cleaning and relamping. 3. Shall support the lighting fixtures without causing the ceiling or partition to deflect. 4. Hardware for recessed fluorescent fixtures: 5. Fixtures shall be supported as detailed on drawings and as required by DSA standards. 6. Installation: Fixtures shall be securely mounted on ceilings and walls with appropriate fastening devices. "Drop-in" type T-bar fixtures shall be secured with #12 gauge safety "earthquake wires" as described by California Code of Regulations Title 24 Part 2, Chapter 47. "Earthquake clips" will be required for fastening to the T-bar system in addition to safety wire. Surface mounted fluorescent fixtures shall be solidly screwed or clipped into framing above drywall with 4-#10 sheet metal screws into each fixture. Provide blocking for screw supports behind all surface mounted lighting fixtures weighing more than 15 lbs. 7. Surface mounted lighting fixtures: Page 565 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5100 26 5100 – Interior Lighting Page 6 of 6 a. Fixtures shall be bolted against the ceiling independent of the outlet box at four points spaced near the corners of each unit. The bolts shall be minimum ¼-20 bolt, secured to structural ceiling. Non-turning studs may be attached to the building structure by 12 gauge safety hangers. 8. Fixtures mounted in open construction shall be secured directly to the building structure with approved bolting and clamping devices. 9. Single or double pendent mounted lighting fixtures: a. Each stem shall be supported by an approved outlet box, mounted swivel joint and canopy which holds the stem captive and provides spring load (or approved equivalent) dampening of fixture oscillations. Outlet box shall be supported vertically from the building structure and be allowed to swing to a 45 degree angle. 10. Outlet boxes for support of lighting fixtures (where permitted) shall be secured directly to the building structure with approved devices or supported vertically in a hung ceiling from the building structure with a nine gauge wire hanger, and be secured by an approved device to a main ceiling runner or cross runner to prevent any horizontal movement relative to the ceiling. F. Furnish and install the specified lamps for all lighting fixtures as part of this project. G. Coordinate between the electrical and ceiling trades to ascertain that approved lighting fixtures are furnished in the proper sizes and installed with the proper devices (hangers, clips, trim frames, flanges), to match the ceiling system being installed. H. Bond lighting fixtures and metal accessories to the grounding system as specified in Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS. I. At completion of project, relamp all fixtures which have failed/burned-out lamps. Clean all fixtures, lenses, diffusers and louvers that have accumulated dust/dirt during construction. J. Provide unswitched leg of interior lighting branch circuit to integral emergency battery pack light fixtures, exit signs and night lights as applicable per lighting plans. K. Wallmount fixtures in walkway areas shall not project more than 4 inches from wall when projection occurs lower than 80 inches. END OF SECTION Page 566 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 1 of 6 SECTION 26 5600 EXTERIOR LIGHTING PART 1 - GENERAL 1.1 DESCRIPTION A. This section specifies the furnishing, installation, and connection of exterior luminaires, controls, poles and supports. 1.2 RELATED WORK A. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. B. Section 26 0533, RACEWAYS AND BOXES FOR ELECTRICAL SYSTEMS: Conduits, fittings, and boxes for raceway systems. C. Section 26 0519, LOW VOLTAGE ELECTRICAL POWER CONDUCTORS AND CABLES (600 VOLTS AND BELOW): Low voltage power and lighting wiring. D. Section 26 0546.13, ELECTRIC UTILITY SYSTEMS: Underground handholes and conduits. E. Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS: Requirements for personnel safety and to provide a low impedance path for possible ground fault currents. F. Section 26 5100, INTERIOR LIGHTING. G. Section 26 5670, LIGHTING ACCEPTANCE TESTING. 1.3 SUBMITTALS A. Submit in accordance with Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. B. Shop Drawings: 1. Sufficient information, clearly presented, shall be included to determine compliance with drawings and specifications. 2. Include electrical ratings, dimensions, mounting, details, materials, required clearances, terminations, wiring and connection diagrams, photometric data, ballasts, poles, luminaires, effective projected area (EPA), lamps and controls. Page 567 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 2 of 6 1.4 APPLICABLE PUBLICATIONS A. Publications listed below (including amendments, addenda, revisions, supplements) form a part of this specification to the extent referenced. Publications are referenced in the text by the basic designation only. B. American Society for Testing and Materials (ASTM). C. American Concrete Institute (ACI). D. American National Standards Institute (ANSI). E. Aluminum Association Inc. (AA). F. Illuminating Engineering Society of North America (IESNA). G. National Electrical Manufacturers Association (NEMA). H. National Fire Protection Association (NFPA). I. Underwriters Laboratories, Inc. (UL). 1.5 DELIVERY, STORAGE, AND HANDLING A. Poles: Do not store poles on ground. Store poles so they are at least one foot above ground level. Do not remove factory-applied pole wrappings until just prior to installation of pole. PART 2 - PRODUCTS 2.1 MATERIALS AND EQUIPMENT A. Materials and equipment shall be in accordance with CEC, UL, ANSI, as shown on the drawings and as specified. 2.2 POLES A. General: 1. Poles shall be steel or aluminum as specified in fixture schedule and as shown on the drawings. Finish shall be as approved by the Architect. Assume custom color for bidding. 2. The pole and arm assembly shall be designed for wind loading of 100 miles per hour, with an additional 30 percent gust factor, supporting luminaire(s) having the effective projected areas indicated as per manufacturer data. 3. Poles shall anchor-bolt type designed for use with underground supply conductors. Poles shall have gasketed handhole with a minimum clear opening of 2.5” x 5”. Handhole cover shall be secured by stainless steel captive screws. 4. Provide a steel grounding stud opposite hand hole openings. Page 568 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 3 of 6 B. Provide a base cover matching the pole in material and color to conceal the mounting hardware pole-base welds and anchor bolts. C. Hardware: All necessary hardware shall be 300 series tamperproof stainless steel. D. Types: 1. Aluminum: Provide aluminum poles manufactured of corrosion resistant AA AAH35.1 aluminum alloys conforming to AASHTO LTS-4 for Alloy 6063-T6 or Alloy 6005-T5 for wrought alloys, and Alloy 356-T4 (3,5) for ASTM B108-01 cast alloys. Poles shall be seamless extruded or spun seamless type. Provide a pole grounding connection designed to prevent electrolysis when used with copper ground wire. Base covers for aluminum poles shall be cast from 356-T6 aluminum alloy in accordance with ASTM B108-01. 2. Steel: Provide steel poles having minimum 11-gage steel with minimum yield/strength of 48,000 psi and iron-oxide primed factory finish. Base covers for steel poles shall be structural quality hot-rolled carbon steel plate having a minimum yield of 36,000 psi. 2.3 FOUNDATIONS FOR POLES A. Foundations shall be cast-in-place concrete. B. Foundations shall support the effective projected area of the specified pole, arm(s), luminaire(s), and all accessories specified under wind conditions as specified in this section. C. Place concrete in spirally wrapped treated paper forms for round foundations, and construct forms for square foundations. D. Rub-finish and round all above-grade concrete edges to approximately 1/4” radius unless otherwise detailed. E. Concrete shall have 3000 psi minimum 28 day compressive strength. F. Anchor bolt assemblies and reinforcing of concrete foundations shall be as shown on the drawings and meet ACI 318. Anchor bolts shall be in a welded cage or properly positioned by the tie wire to stirrups. G. Install a copperclad ground rod, not less than 5/8” diameter by 10’ long in pullbox adjacent to each fixture. Where rock or layered rock is present, drill a hole not less than 2” in diameter and 6’ deep, backfill with tamped fine sand and drive the rod into the hole. Bond the rod to the pole with not less than number 6 AWG bare copper wires. The method of bonding shall be approved for the purpose. H. After leveling of pole grout base solid between plate and footing with dry pack concrete for vibration reduction. 2.4 LUMINAIRES A. UL 1598 and ANSI C136.17. Luminaries shall be weatherproof, heavy duty, outdoor types designed for efficient light utilization, adequate dissipation of lamp and ballast heat and safe cleaning and relamping. Page 569 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 4 of 6 B. Light emitting diode (LED)-based solid state lighting (SSL) products shall be factory tested in accordance to the International Engineering Society (IES) LM-79 recommendations and meet ANSI C78.377-2008 standards. C. LED light sources shall be factory tested in accordance to IES LM-80 recommendations. D. LED-based SSL product shall incorporate an external heat sink, integral to the luminaire. E. IESNA HB-9 and RP-8 light distribution pattern types shall be as indicated on the drawings. F. Incorporate associated ballasts and drivers within the luminaire housing. G. Lenses shall be frame-mounted heat-resistant, borosilicate glass, prismatic refractors. Attach the frame to the luminaire housing by hinges or chain. H. Pre-wire internal components to terminal strips at the factory. I. Bracket mounted luminaries shall have leveling provisions and clamp type adjustable slip-fitters with locking screws. J. Materials shall be rustproof. Latches and fittings shall be non-ferrous metal. K. LED-based SSL luminaires shall be manufactured specifically for LED lamps with drivers integral to the luminaire housing. 2.5 LAMPS A. Luminaires shall be listed for the lamp specified on the associated electrical plans. Install the proper lamps in every luminaire installed. B. Lamps shall be clear or coated as recommended by luminaire manufacturer to provide for maximum luminaire efficiency in fixture used. 2.6 LED-BASED SOLID STATE DRIVERS A. Shall be listed by either U.L. or equal listing agency and comply with IEEE C.62.41-1991, Class A operation. B. Provide a minimum power factor of 0.9. C. Minimum operating temperature appropriate for outdoor environments. D. Shall operate at a frequency greater than or equal to 120Hz. Page 570 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 5 of 6 PART 3 - EXECUTION 3.1 INSTALLATION A. Install lighting in accordance with the CEC, as shown on the drawings, and in accordance with manufacturer’s recommendations. B. Poles: 1. Provide pole foundations with galvanized steel anchor bolts, threaded at the top end and bent 1.57 rad 90 degrees at the bottom end. Provide galvanized nuts, washers, and ornamental covers for anchor bolts. Thoroughly compact backfill with compacting arranged to prevent pressure between conductor, jacket, or sheath and the end of conduit elbow. Adjust poles as necessary to provide a permanent vertical position with the bracket arm in proper position for luminaire location. 2. After the poles have been installed, shimmed and plumbed, grout the spaces between the pole bases and the concrete base with non-shrink concrete grout material. Provide a plastic or copper tube, of not less than 3/8” inside diameter, through the grout tight to the top of the concrete base for moisture weeping. 3. Attach pole base cover to pole flange with set screws. C. Foundation Excavation: Depth shall be as indicated on drawings. Dig holes large enough to permit the proper use of tampers to the full depth of the hole. Place backfill in the hole in 6” maximum layers and thoroughly tamp. Place surplus earth around the pole in a conical shape and pack tightly to drain water away. D. Photocell Switch Aiming (where applicable): Aim switch according to manufacturer’s recommendations. Mount switch on or beside each luminaire when switch is provided in cast weatherproof aluminum housing with swivel arm or set adjustable window slide for proper footcandles photocell turn-on. 3.2 GROUNDING A. Ground noncurrent-carrying parts of equipment including metal poles, luminaries, mounting arms, brackets, and metallic enclosures as specified in Section 26 0526, GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS. Where copper grounding conductor is connected to a metal other than copper, provide specially treated or alloyed connectors suitable and listed for this purpose. END OF SECTION Page 571 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5600 26 5600 – Exterior Lighting Page 6 of 6 THIS PAGE INTENTIONALLY LEFT BLANK Page 572 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5670 26 5670 – Lighting Acceptance Testing Page 1 of 4 SECTION 26 5670 LIGHTING ACCEPTANCE TESTING PART 1 - GENERAL 1.1 RELATED DOCUMENTS A. Drawings and general provisions of this Contract, including General and Supplementary Conditions and Division 01 Specification Sections, apply to this Section. 1.2 SUMMARY A. This Section Includes: 1. The Contractor shall be responsible for the Certificate of Acceptance, but coordinate with the Certified California Lighting Controls Test Technician to assure that all required documents have been filed with and approved by the enforcement agency prior to receiving a final occupancy permit. The Certificate of Acceptance will indicate that the Contractor has demonstrated acceptance requirements of the plans and specifications, that current requirements for installation certificates are met, and that currently required operating and maintenance information (as well as the Certificate of Acceptance) were provided to the building Owner. 2. Testing, evaluation and calibration of lighting controls equipment provided, installed and connected in Division 26. 3. Documentation of test results, completion of “Certificate of Acceptance” and “Certificate of Installation” forms and filing with the enforcement agency for approval. 4. Specific Jobsite Conditions: a. Acceptance testing must be tailored for each specific design, job site, and climactic conditions. While the steps for conducting each test remain consistent, the application of the tests to a particular site may vary. The Contractor shall review the construction documents and include all required time, material, testing equipment, etc. as required to complete the requirements of this section. B. Related Work: 1. Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. 2. Section 26 5100, INTERIOR LIGHTING. 3. Section 26 5600, EXTERIOR LIGHTING. 4. Section 26 0926, LIGHTING CONTROL SYSTEM. 5. Section 26 0900, CONTROLS AND INSTRUMENTATION. 1.3 REFERENCES A. Acceptance Testing Criteria: 2019 Building Energy Efficiency Standards Non-Residential Compliance Manual. Page 573 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5670 26 5670 – Lighting Acceptance Testing Page 2 of 4 1.4 SYSTEM DESCRIPTION A. Performance Requirements: 1. All material, equipment, labor and technical supervision to perform tests, calibrations and documentation specified herein. B. Scope of Testing, Evaluation and Calibration (as applicable): 1. Automatic (master) time switches. 2. Occupancy sensors. 3. Automatic daylighting controls. 4. Photo electric sensors. 5. Daylighting controls. 6. Outdoor astronomical time switches. 7. Area controls. 1.5 SUBMITTALS A. Submit in accordance with Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL. B. Test Reports: 1. Written record of all tests and completion of forms included in this section. 2. At completion of project, assemble a final test report. Submit report to the enforcement agency and the Owner prior to final occupancy to include: a. Summary of project. b. Description of systems and equipment tested. c. Visual inspection report. d. Description of tests. e. Test results. f. Conclusions and recommendations. 3. Report shall be bound in booklet form, include on the Contractor’s letterhead the title of the report and the systems tested. C. Constructability Plan Review 1. The Contractor shall review the construction drawings and specifications to understand the scope of the acceptance tests and raise critical issues that might affect the success of the acceptance tests prior to starting construction. Any constructability issues associated with the lighting system should be forwarded to the design team for review/modifications prior to equipment procurement and installation. The Contractor shall submit on company letterhead, with the lighting control equipment required by Section 26 0500, COMMON WORK RESULTS FOR ELECTRICAL, 1.4B, a letter confirming that the constructability review has been completed and their company has reviewed and is prepared to complete the lighting acceptance testing required by this section. Page 574 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5670 26 5670 – Lighting Acceptance Testing Page 3 of 4 PART 2 - PRODUCTS 2.1 FORMS A. Lighting Installation forms and verification procedures for lighting systems that require acceptance testing can be downloaded from the following website: www.energy.ca.gov/2015publications/CEC-400-2015-033/appendices/forms/NRCI B. Lighting Acceptance forms are to be provided by a Certified California Lighting Controls Acceptance Test Technician. The California Energy Commission adopted changes to the California building Efficiency Standards (Title 24, Parts 1 and 6) that require lighting controls and devices to be certified as properly installed and operational, prior to issuance of occupancy permits. All Acceptance Technicians must be employed by an Acceptance Test employer that provides support as well as quality control. Certified California Lighting Controls Acceptance Test Technicians can be found at the following website: www.calctp.org/acceptance- technicians/contractors C. These completed forms will be the deliverable product to the enforcement agency and Owner as described in 1.4 of this section. PART 3 - EXECUTION 3.1 FIELD QUALITY CONTROL A. Tests: 1. Contractor's Responsibilities: a. Perform all required tests required by this section. b. Schedule testing with building Owner. c. Provide Installation forms d. Acceptance forms provided by California Certified Lighting Controls Technician hired by Contractor. e. Calibration of equipment such as light meters, photo electric controls, etc. f. Programming of time switches (interior/exterior lighting) for operations as directed by the Owner. 3.2 ADJUSTING A. Final Settings: The Contractor shall be responsible for implementing all final settings and adjustments on controls equipment as required for a complete and operating system. END OF SECTION Page 575 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 26 5670 26 5670 – Lighting Acceptance Testing Page 4 of 4 THIS PAGE INTENTIONALLY LEFT BLANK Page 576 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 1 of 8 Section 32 0190 Operation and Maintenance of Planting PART 1 GENERAL 1.01 SECTION INCLUDES A. Maintain plants in manner that promotes health, growth, color and appearance, to quality levels specified; replace dead, dying, and damaged plants at no extra cost to City. 1. It is Contractor's responsibility to determine type and quantity of soil amendments and fertilizer required. B. Maintain newly planted landscape plants, including turf (lawns), turf (playfields), trees, shrubs, hedges, vines, ground cover, perennials, flowering bulbs, and annuals. C. Maintain established landscape plants, including turf (lawns), turf (playfields), trees, shrubs, hedges, vines, ground cover, perennials, flowering bulbs, and naturalized wildflowers. D. Renovate the following established landscape plants within the project boundaries:turf (lawns). E. Operate permanent irrigation system. F. Clean up landscaped areas. G. Maintenance Period: The time frame covered by these requirements is 90 days: 1. Start Date: Project Date of Substantial Completion. 1.02 RELATED REQUIREMENTS A. Section 32 8423 - Irrigation System. B. Section 32 9223 - Sodding. C. Section 32 9300 - Plants 1.03 REFERENCE STANDARDS A. ANSI A300 Part 1 - American National Standard for Tree Care Operations - Tree, Shrub, and Other Woody Plant Management - Standard Practices (Pruning) 2017. B. ANSI Z133.1 - American National Standard for Arboricultural Operations - Safety Requirements 2017. C. ASTM D4972 - Standard Test Methods for pH of Soils 2019. 1.04 SUBMITTALS A. See Section 5 for submittal procedures. Page 577 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 2 of 8 B. Soil Tests and Analysis: Submit report showing number of samples, test results, and recommendations for soil amendments and fertilizer. C. Product Data: Manufacturer's data sheets on each fertilizer, herbicide, pesticide, and other chemical material to be used, showing trade name, chemical composition, mixing instructions, recommended application rate, storage and handling instructions, and application instructions. D. Certificates: Certification of composition of the following as delivered: 1. Fertilizer. 2. Mulch. 3. Pesticides. 4. Herbicides. 5. Other chemical materials. E. Installer Qualifications: As specified. 1.05 QUALITY ASSURANCE A. Installer Qualifications: 1. Maintenance Contractor: The contractual entity that performed the planting installation. 2. Pesticide Applicators: Certified by authorities having jurisdiction. 3. Herbicide Applicators: Certified by authorities having jurisdiction. 1.06 DELIVERY, STORAGE, AND HANDLING A. Deliver U.S. EPA-controlled materials to site in original containers with legible labels indicating registration number and registered uses. B. Deliver fertilizer and manufactured soil amendments to site in original containers bearing manufacturer's chemical analysis, name, trade name or trademark, and indication of compliance with applicable state and federal laws and regulations ; alternatively, bulk delivery with equivalent certificate is acceptable. C. Store fertilizer, soil amendments, and mulch in dry locations away from contaminants. D. Do not store pesticides, herbicides, or other chemical treatment materials in locations where they could damage seeds or plants. PART 2 PRODUCTS 2.01 FERTILIZERS AND SOIL AMENDMENTS A. Fertilizers: Free flowing granular organic type containing nitrogen, phosphorus, and potassium, plus trace minerals and micro-nutrients; controlled release type is preferred. 1. Determine type and quantity based on soil analysis. B. Soil Amendments: Type and quantity as required to achieve specified results, based on soil analysis. Page 578 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 3 of 8 C. Worm Castings: Commercially packaged, without worms or food source. 2.02 APPLIED MATERIALS A. Organic Mulch: Maintain general appearance of existing mulched areas; use one of the following types: 1. Wood chips ranging in size from 1/2 inch to one inch. PART 3 EXECUTION 3.01 EXAMINATION A. If soil analysis has not already been performed, take sufficient samples to obtain a comprehensive analysis; perform analysis in accordance with ASTM D4972. 3.02 LANDSCAPE MAINTENANCE - GENERAL A. Protect existing vegetation, pavements, and facilities from damage due to maintenance activities; restore damaged items to original condition or replace, at no extra cost to City. B. General Cleanup: Remove debris from all landscape areas at least once a week and from turf areas before each mowing. 1. Debris consists of trash, rubbish, dropped leaves, downed branches and limbs of all sizes, dead vegetation, rocks, and other material not belonging in landscaped areas. 2. Remove debris from site and dispose of properly. C. Watering, Soil Erosion, and Sedimentation Control: Comply with federal, state, local, and other regulations in force; prevent over-watering, run-off, erosion, puddling, and ponding. 1. Repair temporary erosion control mechanisms provided by others. 2. Repair eroded areas and replant, when caused by inadequate maintenance. 3. Prevent sediment from entering storm drains. D. Trees: Exercise care to avoid girdling trees; provide protective collars if necessary; remove protective collars at end of maintenance period. E. Fertilizing: Apply fertilizer only when necessary. F. Drainage Channels: Remove obstructions in gutters, catch basins, storm drain inlets, yard drains, swales, ditches, and overflows. 1. Remove grates from catch basins to clean. 2. Prevent encroachment of other vegetation on turfed surface drainage channels. G. Health Maintenance: Inspect all plants regularly for health: 1. Eradicate diseases and damaging pests, regardless of severity or speed of effect. 2. Treat accidental injuries and abrasions. 3. If a plant is unhealthy but not yet dead, according to specified definitions, determine reason(s) and take remedial action immediately. 4. Remove dead plants immediately upon determining that they are dead. Page 579 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 4 of 8 H. Pesticide and Herbicide Application: Comply with manufacturer's instructions and recommendations and applicable regulations. 1. Obtain City's approval prior to each application. 2. Apply in manner to prevent injury to personnel and damage to property due to either direct spray or drifting, both on and off City's property. 3. Use backflow preventers on hose bibbs used for mixing water; prevent spills. 4. Inspect equipment daily before application; repair leaks, clogs, wear, and damage. 5. Do not dispose of excess mixed material, unmixed material, containers, residue, rinse water, or contaminated articles on site; dispose of off site in legal manner. 6. Rinse water may be used as mix water for next batch of same formulation. 7. Contractor is responsible for all recordkeeping, submissions, and reports required by laws and regulations. I. Replanting: Perform replacement and replanting immediately upon removal of dead plant. 3.03 IRRIGATION A. Irrigation: Do not allow plants to wilt; apply water as required to supplement rainfall; do not waste water; do not water plants or areas not needing water; do not water during rainfall; shut off water flow when finished; repair leaks. 1. New automatic irrigation system may be used. 2. If no automatic irrigation system is available; provide hoses and other equipment as required. 3. City's water source may be used. 4. Do not drive water trucks over turf, seeded areas, or planting beds. 5. Provide backflow preventers on hose bibbs used for irrigation hoses. B. Automatic Irrigation System: Obtain and follow manufacturer's operating and maintenance instructions. 1. Adjust to water landscape areas only. 2. Adjust sprinkler heads, drippers, valves, pumps, and controllers as required for optimum operation. 3. Drain and prepare for freezing weather; prepare and start up in spring. 4. During system warranty period notify Architect and system installer promptly of defects and leaks that adversely affect irrigation performance. 5. After end of system warranty period, service and repair all defects and leaks. 3.04 RENOVATION OF ESTABLISHED TURF A. Eliminate undesirable grasses and weeds. Remove as much thatch as possible. B. Aerate established turf at least once every two years by coring and pulling out soil plugs 2 to 3 inches deep and not more than 2 inches apart. 1. Clean plugs from pavements immediately. C. Apply fertilizer over entire aerated area. D. Water as soon as possible after planting. Do not allow newly planted material to become dry. E. Begin normal mowing once grass reaches 1-1/2 times specified mowing height. Page 580 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 5 of 8 3.05 TURF MAINTENANCE A. Maintain turf in manner required to produce turf that is healthy, uniform in color and leaf texture, and free from weeds and other undesirable growth. 1. Grass Density - Lawns: 20 plants per square foot, minimum. 2. Bare Spots - Lawns: 2 percent of total area, maximum; 6 inches square, maximum. 3. Keep turf relatively free of thatch, woody plant roots, diseases, nematodes, soil-borne insects, stones larger than 1 inch in diameter, and other materials detrimental to grass growth. 4. Limit broadleaf weeds and patches of foreign grass to a maximum of 2 percent of the total area. B. Mowing: During growing season(s) mow turf to uniform height, in manner that prevents scalping, rutting, bruising, and uneven or rough cutting. 1. Prior to mowing clean all debris and leaves from turf surface. 2. Schedule frequency of mowing so that no more than one-quarter to one-third of grass leaf length is removed during a cutting. 3. Make each successive mowing at approximately 45 degrees to the previous mowing, if practical. 4. Cool Season Grasses: a. Reduce mowing height in fall and spring. b. Use rotary type mowers; mulcher type mowers may be used. 5. Warm Season Grasses: a. Increase mowing height slightly as fall approaches. b. Use reel type mowers; do not use mulcher mowers. C. Summer Mowing Height for Lawns: 1. Fescue, Fine: 2 inches. D. Trimming: Immediately after each mowing, neatly trim perimeter of each turf area and around obstructions within turf area; match height and appearance of adjacent turf. 1. Adjacent to Pavements: Cut edges of turf to form a distinct, uniform turf edge. 2. Adjacent to Planting Beds and Permanently Mulched Areas: Cut edges of turf to form a distinct, uniform turf edge. 3. Around Other Trees and Poles: Where no planting bed or mulched area exists, trimming with string trimmer is acceptable. 4. At Fences: Trim on both sides of fence. 5. Irrigation Heads and Valve Boxes: Trim neatly so grass doesn't interfere with operation. E. Fertilizer: Apply as recommended by manufacturer and at rate indicated by soil analysis. 1. Cool Season Grasses: Apply at least once, in Fall before first frost; do not apply high nitrogen fertilizer during Summer; Spring application is optional but must be reduced in quantity. 3.06 PLANTING BED MAINTENANCE A. Planting beds include all planted areas except turf. B. Begin maintenance immediately after plants have been installed; inspect at least once a week and perform needed maintenance promptly. Page 581 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 6 of 8 C. Keep planting beds free of pests; remove weeds and grass by hand before reaching 1 inch height. D. Do not allow climbing, twining, or creeping plants to encroach into other species. E. Flowering Plants: Remove dead flower heads; do not trim off leaves of flowering bulbs until they are brown. F. Replace mulch as required and remove debris. 3.07 TREE AND SHRUB MAINTENANCE A. Trees will be considered dead when main leader has died back or when 25 percent or more of crown has died ; except as otherwise indicated for palm trees. B. Shrubs will be considered dead when 25 percent or more of plant has died. C. Inspect woody plants for health by scraping up to 1/16 inch square area of bark; no green cambium layer below bark shall be evidence of death. D. Adjust stakes, guys and turnbuckles, ties, and trunk wrap as required to promote growth and avoid girdling. E. Fertilizing: Fertilize all trees at least once during maintenance period, preferably in the Fall; use accepted standards for determining type and method of fertilization. F. Pruning: Unless otherwise indicated, prune only to maintain balanced natural shape; follow recommendations of ANSI A300 and ANSI Z133.1 and best local practices for species involved. G. Shrubs: Prune at least once during maintenance period at best time to influence ultimate shape and size for the particular species. 1. Prune to balance the plant's form and according to its natural growth characteristics. 2. Remove water shoots, suckers, and branches not complying with desired shape and size. H. Large Box Trees: Prune under direction of Project Arborist. 3.08 CLEANING A. Remove fallen deciduous leaves in Fall; removal may wait until all leaves have fallen. B. Clean adjacent pavements of plant debris and other debris generated by maintenance activities. C. Remove and dispose of general cleanup debris and biodegradable debris in a proper manner; City's trash collection facilities may be used. D. Remove and dispose of general cleanup debris and biodegradable debris in a proper manner. 1. Biodegradable Debris: City will designate a compost pile on site where biodegradable debris may be deposited; branches and bark are not considered biodegradable. Page 582 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 7 of 8 2. Branches and Bark: City will designate a wood chip storage area; machine-chip all branch and bark debris. 3. Non-Biodegradable Debris: City's trash collection facilities may be used. END OF SECTION Page 583 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 0190 05-11-2023 32 0190 - Operation and Maintenance of Planting Page 8 of 8 This page intentionally left blank Page 584 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 1 of 6 Section 32 1416 Brick Unit Paving PART 1 GENERAL 1.01 SECTION INCLUDES A. Brick Pavers B. Brick Edge Band C. Brick Bullnose Pavers at Stairs D. Brick at Site Walls E. Sand Materials F. Reinforcement. G. Mixes. 1.02 RELATED REQUIREMENTS 1.03 REFERENCE STANDARDS A. ADA Standards - 2010 ADA Standards for Accessible Design 2010. B. ASTM A1064/A1064M - Standard Specification for Carbon-Steel Wire and Welded Wire Reinforcement, Plain and Deformed, for Concrete 2022. C. ASTM C33/C33M - Standard Specification for Concrete Aggregates 2018. D. ASTM C144 - Standard Specification for Aggregate for Masonry Mortar 2018. E. ASTM C270 - Standard Specification for Mortar for Unit Masonry 2019a, with Editorial Revision. F. ASTM C902 - Standard Specification for Pedestrian and Light Traffic Paving Brick 2022. 1.04 SUBMITTALS A. See Section 5for submittals procedures. 1.05 QUALITY ASSURANCE A. Paver Manufacturer Qualifications: Company specializing in manufacturing the Products specified in this section with minimum three years documented experience. Page 585 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 2 of 6 B. Installer Qualifications: Company specializing in performing the work of this section with 5 years documented experience. 1.06 MOCK-UP A. Install setting bed, brick pavers, curbs and border, and accessories to pattern indicated. B. Size: 100 sq ft. C. Mock-up may remain as part of the Work. 1.07 FIELD CONDITIONS A. Do not install mortar when surrounding air or substrate surface temperature is below 50 degrees F prior to, during, and 48 hours after completion of work. B. Do not install mortar when surrounding air or substrate surface temperature is above 90 degrees F during and 48 hours after completion of the work. C. Do not install mortar when wind velocity exceeds 15 mph or relative humidity exceeds 50 percent. D. At end of working day, or during rainy weather, cover work exposed to weather with waterproof coverings, securely anchored. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Brick Pavers: 1. HC Muddox www.hcmuddox.com 2.02 BRICK PAVERS A. Brick Paving Types 1-5 1. Commercial Standard Brick (solid). 2. Face Size: 3 3/4" x 8" inches. 3. Thickness: 2 1/2 inches. 4. Exposed Surface Texture: Wirecut. 5. Edges: Square. 6. Colors (Locations Indicated on Plans): a. Paving Type 1: Old Town Red b. Paving Type 2: Mountain Rose c. Paving Type 3: Dusty Rose d. Paving Type 4: Summer Wheat e. Paving Type 5: Sutter Gold B. Brick Edge Band 1. Smooth Backup Paver Page 586 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 3 of 6 2. Face Size: 3-5/8 by 7-5/8 inches. 3. Thickness: 2-1/4 inches. 4. Exposed Surface Texture: Smooth 5. Edges: Square. 6. Color: Burnt Rose C. Brick Bullnose Pavers at Stairs 1. Smooth 11 1/2in Bullnose Paver 2. Face Size: 3-5/8 by 11-5/8 inches. 3. Thickness: 2-1/4 inches. 4. Exposed Surface Texture: Wire Cut 5. Edges: Square. 6. Color: Burnt Rose D. Brick at Site Walls 1. Commericial Standard Brick (solid) 2. Face Size: 3 3/4" x 8" inches. 3. Thickness: 2 1/2 inches. 4. Exposed Surface Texture: Smooth/Wirecut depending on face used 5. Edges: Square. 6. Color: Spanish Moss 2.03 SAND MATERIALS A. Sand for Setting Bed: Clean washed concrete sand, free of fines, complying with gradation requirements of ASTM C33/C33M for fine aggregates. B. Polymeric Sand: Fine sand complying with ASTM C144 combined with polymer binders for creating semi-solid joints between pavers. 1. Color: Tan. 2.04 REINFORCEMENT A. Masonry Tie: Wire-Bond Dovetail Corrugated Tie, galvanized steel. 2.05 MIXES A. Mortar Setting Bed and Joint B. Joint Mortar: Type S Portland cement mix complying with the following: 1. Compressive Strength (28 day): 3000 psi. 2. Slump: 1 to 2 inches. 3. Air Entrained: 5 to 7 percent. PART 3 EXECUTION 3.01 EXAMINATION A. Verify substrate is ready to support pavers and imposed loads. Page 587 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 4 of 6 B. Verify gradients and elevations of substrate are correct. C. Verify dry weather forecast without rain for a minimum of 24 hours with temperatures above 55 degrees Fahrenheit. D. Verify that pavers are completely dry prior to polymeric sand installation. 3.02 INSTALLATION - SAND SETTING BED A. Spread sand evenly over prepared substrate surface to a nominal thickness of 1-1/2 inches. B. Dampen and roller compact sand to level surface. C. Screed and scarify top 1/2 inch of sand. D. Place paver units in herringbone pattern, from straight reference line. E. Place half units or special shaped units at edges and interruptions. Maintain tight joints. Machine saw partial units. F. Sprinkle sand over surface and sweep into joints. Moisten joints and recover with additional sand until firm joints are achieved. Remove excess sand. G. Tamp and level paver units with mechanical plate vibrator until units are firmly bedded, level, and to correct elevation and slope gradient. 3.03 CLEANING A. Do not clean pavers until pavers and mortar are dry. B. Clean soiled surfaces using cleaning solution. Do not harm pavers, joint materials, or adjacent surfaces. C. Use non-metallic tools in cleaning operations. D. Rinse surfaces with clean water. E. Broom clean paving surfaces. Dispose of excess sand. 3.04 PROTECTION A. Do not permit traffic over unprotected paver surface. B. Do not permit traffic for 48 hours after pavement placement. 3.05 MAINTENANCE A. See Section 01 7000 - Execution and Closeout Requirements, for additional requirements relating to maintenance service. Page 588 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 5 of 6 END OF SECTION Page 589 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1416 05-11-2023 32 1416 - Brick Unit Paving Page 6 of 6 This page intentionally left blank Page 590 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 1 of 8 Section 32 1600 Decomposed Granite Paving PART 1 GENERAL 1.01 SECTION INCLUDES A. GraniteCrete Paving B. Stabilized decomposed granite 1.02 REFERENCE STANDARDS A. ASTM C136 ±Sieve Analysis of Fine and Coarse Aggregates. B. ASTM D2419 ±Sand Equivalent Value of Soils and Fine Aggregates. C. CalTrans Standard Specifications for Public Works Construction. 1.03 SEQUENCING: A. Do not install work specified in this Section prior to acceptance of earth moving. B. Coordinate work specified in this Section with work specified in other Sections to minimize cutting of and operation of heavy equipment over installed decomposed granite surfacing. 1.04 SUBMITTALS A. Product Data: Manufacturer¶s product data sheet and installation instructions indicating that product complies with specifications for crushed aggregate blended with GraniteCrete admixture surfacing and specifications for stabilized decomposed granite surfacing. B. Installer's Qualification Statement. C. Warranty: Submit manufacturer warranty and ensure that forms have been completed in City's name and registered with manufacturer. D. Maintenance Materials: Furnish the following for City's use in maintenance of project. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Installations 500 square feet and over up to 3,000 square feet ± must be a recommended installer at a minimum. Installations 3,000 square feet and over ±must be an Approved Installer. B. An installer not approved, but with sufficient experience for the project as determined by Granitecrete, Inc., may fulfill this requirement by providing a current letter from Granitecrete, Inc. verifying their ability to complete a successful installation for this specific project. For Page 591 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 2 of 8 assistance, contact GraniteCrete, Inc. at (800) 670-0849. C. Porous Base Rock Testing: 1. Testing shall occur during installation at 1 ton increments of shipping for sieve conformance. Results shall be submitted prior to completion of the stone base installation. a. The stone field area shall have a permeable rate no less than 14´per hour. The testing shall be per Din 8035 Part 7, ASTM 2434 (constant head), or ASTM F2898 testing methods. b. In addition to the lab testing, after installation of any aggregate base cross-section, designed to conduct rainfall to the sub-soils and/or under-drain system, the finished aggregate base shall be tested,in situ for infiltration rate, using method ASTM F2898. The test shall be performed by a registered Geotechnical Engineer or certified agronomist. 2.The Contractor is responsible to meet this performance specification, before proceeding with installation, and shall bear the cost of the on-site testing and the cost of any additional work necessary to achieve compliance with the specification. 3. All test results shall be logged and documented by the Owner's Technical Representative or Geotechnical Engineer. If at any time the processed stone base does not meet specifications, it shall be the Contractor's responsibility to restore, at his expense, the processed stone base to the required grade, cross-section and density. 4. The compaction rate for porous base rock should be 88%. The compaction rate for non- porous base rock should be 95%. D. Installer Qualifications: Company specializing in performing the work of this section and approved by manufacturer. GraniteCrete recommends certified installers. 1.06 MOCK-UP A. Provide 1 mock-up, 4 feet long by 4 feet wide, illustrating Granitecrete permeability. B. Locate where directed. C. Mock-up may remain as part of the Work. 1.07 DELIVERY, STORAGE, AND HANDLING A. Deliver GraniteCrete Admixtures to project site in original, unopened packaging. Protect materials and aggregate from contamination with foreign matter. Store under waterproof cover and protect from dampness. . 1.08 FIELD CONDITIONS A. Field Measurements: Each bidder is required to visit the site of the Work to verify the existing conditions. No adjustments will be made to the Contract Sum for variations in the existing conditions. B. Do not install Granitecrete materials and decomposed granite surfacing when subbase is wet at saturated field capacity. C. Do not install GraniteCrete materials when rain will fall on it within 48 hours after the install, or when the temperature will go below freezing within the next five days following installation. Page 592 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 3 of 8 1.09 WARRANTY A. Warranty Period: Contractor shall provide warranty for performance of product. Contractor shall warranty installation of product for the time of one year from completion. B. Submit a written warranty executed by the installer agreeing to repair or replace components of Granitecrete that fail in materials or workmanship within the specified warranty period. C. Contractor shall provide, for a period of sixty days, unconditional maintenance and repairs as required. PART 2 PRODUCTS 2.01 GRANITECRETE A. Crushed aggregate blended with granitecrete admixture surfacing materials. B. GraniteCrete admixture is an all-natural product and does not contain oils, polymers, resins, or enzymes. C. Decomposed Granite (DG), crushed aggregate. 1. DG shall have a 3/8´maximum gradation, produced from naturally friable rock/granite with enough fines to produce a smooth walking surface. Materials should be free from clay lumps, organic matter, and deleterious material. Blends of coarse sand and rock dust are not acceptable. 2. Use a single supply source for the entire quantity required. 3. Gradation, in accordance with ASTM C136: 4. Color: Should have gold to yellow hues. To be selected by Landscape Architect from manufacturer's full range of colors. 5. Supplier: Vineyard Rock Products, Hollister, CA. - (831) 637-6443[Or equal]. 6. Aggregate binder: Provide GraniteCrete Admixture. Color: To be selected by Landscape Architect from manufacturer's full range of colors. 2.02 DECOMPOSED GRANITE A. Source from quarry not more than 500 miles from project site. B. Sand and crushed stone shall consist of inert materials that are hard and durable, with stone free from surface coatings and deleterious materials. Gradation requirements shall be as follows: C. Crushed Stone Sieve Analysis Percentage of Weight Passing a Square Mesh Sieve AASHTO T11-82 and T2782 Sieve Size Percent Passing 3/8"100 #4 90-100 #8 75-80 #16 55-65 #30 40-50 Page 593 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 4 of 8 #50 25-35 #100 15-20 #200 10-15 D. Sand Equivalent: 30 minimum in accordance with ASTM D2419. E. Color: To match GraniteCrete. 2.03 STABILIZED BINDER FOR STANDARD DG A. Stabilizer Solutions, Inc. 33 South 28th St., Phoenix, AZ 85034; phone (602) 225-5900, (800) 336-2468; fax (602) 225-5902; website stabilizersolutions.com; email info@stabilizersolutions.com 1. Stabilizer product for stabilizing pathways. 2. Patented, non-toxic, organic binder that is a colorless and odorless concentrated powder that binds decomposed granite or crushed 3/8´or 1/4" minus aggregate. 2.04 ACCESSORIES A. Water: Free from contaminants that would discolor or be deleterious to stabilized decomposed granite surfacing. B. Geosynthetic Fabric: Comply with Greenbook Section 213-2 ±³Geosynthetics´, Type N90. PART 3 EXECUTION 3.01 EXAMINATION A. Examine grading and subsoil conditions. Do not proceed until conditions are acceptable. 3.02 PREPARATION A. Excavation: Excavate to depth required so edges of crushed aggregate blended with GraniteCrete admixture surfacing will match adjacent grades and have a maximum cross slope of 1 percent. B. Sub-grade Preparation: Comply with Caltrans Standard Specifications Section 301-1 ±³Sub- grade Preparation.´ C. Base Course Installation: Class II permeable base rock at 90% compaction. D. Base shall be compacted layer of aggregate base in thickness as shown per the detail. Make any corrections necessary to base furnished and installed to bring base to the elevations shown on the drawing. E. Pre-soak base material with water and compact to 90% determined by Test Method ASTM D 1557 prior to installing Stabilized Aggregate. Compaction testing to be provided by project owner, one test per 2,000 square feet of base. Page 594 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 5 of 8 F. Although porous, it is recommended to have proper drainage available to ensure no standing water on surface or adjacent to Stabilized Aggregate, including downspouts when placed under roof overhang and surface drains. G. Before proceeding with installation, notify Owner¶s Representative in writing of unsuitable site/base conditions. 3.03 BLENDING STABILIZER FOR STANDARD DECOMPOSED GRANITE A. Stabilizer® shall be thoroughly pre-mixed with aggregate at the rate of 15-lbs of Stabilizer® per 1-ton of aggregate. Verify with manufacturer correct Stabilizer® rate for your project and climate. Drop spreading of Stabilizer® over pre-placed aggregate or mixing by rototilling is not acceptable. Stabilizer shall be mechanically pre-mixed per manufacturer¶s recommendations using an approved mechanical blending unit to adequately blend Stabilizer® with aggregate (Bucket blending is not an approved blending apparatus). Always blend Stabilizer® and aggregate DRY. 3.04 INSTALLATION A. After pre-blending, place Stabilized Decomposed Granite Aggregate directly on prepared sub- grade. Level to desired grade and cross section. Depth of pathways shall be 3´for heavy foot traffic and light vehicles. DO NOT place on filter fabric. Contact Stabilizer Solutions, Inc. for installation on slopes greater than 8%. B. Surface shall follow overall contours of landscape. Flat areas shall be crowned for drainage. Slope 1 percent minimum to drain away from structures. C. Completed surface shall be of consistent quality and free of deleterious materials such as organic materials, nails, stones, and loose material. Surface shall not have depressions or humps greater than 1/4 inch in ten feet. D. Install stabilizing binder in accordance with manufacturer's instructions. 3.05 WATERING A. Water heavily for full-depth moisture penetration of profile. Water activates Stabilizer®. Apply 25 to 45-gallons of water per 1-ton to achieve saturation. Randomly test for depth using a probing device, which reaches full depth. B. Contractor shall wait a minimum of 6 ±72 hours or until such time that the Stabilized Aggregate is able to accept compaction froma1to5tonrollerwithout separation, plowing or any other physical compromise of the aggregate. C. If surface aggregate dries significantly quicker than subsurface material, lightly mist surface before compaction. 3.06 COMPACTION A. Compact Stabilized Aggregate to 85% relative compaction by equipment such as; a 2 to 5-ton double drum roller making 3 to 4 passes. Do not begin compaction for 6 hours after placement Page 595 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 6 of 8 and up to 72 hours. DO NOT use a vibratory plate compactor or vibration feature on roller, as vibration separates large aggregate particles. If pumping or pancaking of surface occurs, surface is still too wet to roll. B. Take care in compacting surface when adjacent to planting and irrigation systems, use 8´or 10´ hand tamp. Installation of Stabilized Aggregate more than 3´thick shall be installed in lifts. If 4´thick compacted (2) 2´lifts. If 5´thick compacted (2) 2.5´lifts. If Stabilized Aggregate is pre-moistened before installation entire 4´or 5´lift may be installed. C. Lightly spray surface area following compaction. Do not disturb aggregate surface with spray action. 3.07 FIELD QUALITY CONTROL A. Finished surface shall be smooth, uniform and solid with no evidence of chipping or cracking. Cured and compacted pathway shall be firm throughout profile with no spongy areas. Loose material shall not be present on surface after installation, but may appear after use and according to environmental conditions. Pathway shall remain stable underneath loose granite on top with a ³natural´look. Any significant irregularities in path surface shall be repaired to the uniformity of entire installation. 3.08 CLEANING A. Clean excess Decomposed Granite away in areas not scheduled for installation. . 3.09 PROTECTION A. Contractor shall furnish and install construction fence around new surface to prevent public access. Fencing shall be maintained in place for a minimum of 12 - 72 hours after completion of installation, or as directed by the Owner¶Representative. Drying period may take longer due to weather conditions. B. Protect stabilized decomposed granite surfacing from damage until Project completion. Repair damaged areas to match specified requirements. C. Contractor shall notify Owner¶s Representative that landscape irrigation shall be restricted near Stabilized Aggregate surface until drying period is complete. Standing water on surface and adjacent to path shall be restricted at all times. 3.10 MAINTENANCE A. Loose aggregate will appear on the surface over time which is a natural occurrence. If excessive aggregate over 1/4 inches occurs, redistribute the stabilized decomposed granite over the entire surface, water thoroughly and re-compact with a minimum one ton drum roller. This process can be repeated as needed. B. To repair, excavate damaged area leaving a minimum one inch depth of existing stabilized decomposed granite, water and scarify. Scarifying existing stabilized decomposed granite will prevent a cold joint layer between the existing stabilized decomposed granite and the newly imported pre-blended stabilized decomposed granite. Page 596 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 7 of 8 C. Add water to the pre-blended stabilized decomposed granite to activate. Apply moistened pre- blended stabilized decomposed granite to excavated area at or above finished grade. D. Compact with a walk behind drum roller. Do not allow traffic on stabilized decomposed granite surfacing for one-two days after placement or until compacted stabilized decomposed granite has fully cured. 3.11 REPAIRS A. Excavate damaged area to the depth of the Stabilized Aggregate and square off sidewalls. B. If area is dry, moisten damaged portion lightly. C. Pre-blend the dry required amount of Stabilizer with the proper amount of aggregate in a concrete mixer. D. Add water to the pre-blended Stabilized Aggregate. Thoroughly moisten mix with 25 to 45 gallons per 1-ton of pre-blended material or to approximately 10% moisture content. E. Apply moistened pre-blended Stabilized Aggregate to excavated area to finish grade. F. Compact with an 8´to 10´hand tamp or 250 to 300 pound roller. Keep traffic off areas for 12 to 48 hours after repair has been completed. END OF SECTION Page 597 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 1600 05-11-2023 32 1600 - Decomposed Granite Paving Page 8 of 8 This page intentionally left blank Page 598 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 3300 05-11-2023 32 3300 - Site Furnishings Page 1 of 4 Section 32 3300 Site Furnishings PART 1 GENERAL 1.01 SECTION INCLUDES A. Bench B. Triple Stream Waste Receptacle C. Moveable Bistro Table D. Planter Pots E. Bike Rack F. Drinking Fountain G. String Light Post 1.02 RELATED REQUIREMENTS A. Section 03 3000 - Cast-in-Place Concrete: Bollard infill and underground encasement. 1.03 REFERENCE STANDARDS A. ADA Standards - 2010 ADA Standards for Accessible Design 2010. 1.04 SUBMITTALS A. See Section 5 for submittal procedures. B. Product Data: Provide manufacturer's specifications and descriptive literature, installation instructions, and maintenance information. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Company specializing in manufacturing products specified in this section, with at least three years of documented experience. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Bench 1. Model per City Standard 9040. Page 599 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 3300 05-11-2023 32 3300 - Site Furnishings Page 2 of 4 2. Color: Black B. Triple Stream Waste Receptacle 1. Manufacturer: Big Belly a. Product: HC5/SC.5/SC.5.5 Solar Powered Triple Station b. Options: 1) Enclosed Hopper for Landfill Waste, Recycling and Compost 2) Foot Pedal 3) Graphic Wrap C. Moveable Bistro Table - Owner Furnished (Not in Contract) 1. Manufacturer: webstaurantstore.com 2. Product: Lancaster Table & Seating Alloy Series 36´x36´Dining Height Outdoor Table with 4 Industrial Café Chairs 3. Color: Copper D. Planter Pot 1. Manufacturer: Tournesol Siteworks 2. Product: Florence Lightweight GFRC Planter a. Type A: FCR-482424 b. Type B: FCR-3024 E. Bike Rack 1. Manufacturer: Peak Racks 2. Product: 4-bike single sided bike rack 3. 16´wheel spacing 4. Color: Black Powdercoat F. Drinking Fountain 1. Manufacturer: Most Dependable Fountains 2. Product: 10145 SMSSFA 3. Options: Safe stream bubbler 4. Color: To be selected from the manufacturer's full range of colors. G. String Light Post 1. Manufacturer: lightpolesplus.com 2. Product:HP-RTAAVS-12-4030-C-AB-FP. 12ft tall x 4´base OD x 3´top OD x .125´ thick, 3. Color: Black powder coat 4. No light fixture for top mounting. 5. Pole should be ordered with hand hole cut out for receptacle on poles with receptacles per Electrical Site Plan 6. Aluminum acorn post cap for 3´post, black powdercoat finish available from www.signaturestreetscapes.com 7. Pole base: polebasecovers.net a. MAINZ 15 Decorative Base Cover for 4Ǝ Round Poles ±PAA-DRMZ15-XX PART 3 EXECUTION 3.01 EXAMINATION Page 600 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 3300 05-11-2023 32 3300 - Site Furnishings Page 3 of 4 A. Verify proper installation of mounting surfaces, preinstalled anchor bolts, and other mounting devices; and ready to receive site furnishing items. 3.02 INSTALLATION A. Install site furnishings in accordance with approved shop drawings, and manufacturer's installation instructions. B. Provide level mounting surfaces for site furnishing items. END OF SECTION Page 601 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 3300 05-11-2023 32 3300 - Site Furnishings Page 4 of 4 This page intentionally left blank Page 602 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9219 05-11-2023 32 9219 - Seeding Page 1 of 4 Section 32 9219 Seeding PART 1 GENERAL 1.01 SECTION INCLUDES A. Seeding, mulching and fertilizer. 1.02 RELATED REQUIREMENTS A. Section 32 0190 - Operation and Maintenance of Planting: Post-occupancy maintenance. 1.03 DEFINITIONS A. Weeds: Include Dandelion, Jimsonweed, Quackgrass, Horsetail, Morning Glory, Rush Grass, Mustard, Lambsquarter, Chickweed, Cress, Crabgrass, Canadian Thistle, Nutgrass, Poison Oak, Blackberry, Tansy Ragwort, Bermuda Grass, Johnson Grass, Poison Ivy, Nut Sedge, Nimble Will, Bindweed, Bent Grass, Wild Garlic, Perennial Sorrel, and Brome Grass. 1.04 SUBMITTALS A. Certificate: Certify seed mixture approval by City. B. Maintenance Data: Include maintenance instructions, cutting method and maximum grass height; types, application frequency, and recommended coverage of fertilizer . 1.05 DELIVERY, STORAGE, AND HANDLING A. Deliver grass seed mixture in sealed containers. Seed in damaged packaging is not acceptable. Deliver seed mixture in containers showing percentage of seed mix, year of production, net weight, date of packaging, and location of packaging. PART 2 PRODUCTS 2.01 SEED MIXTURE A. Seed Mixture: 1. Perennial Rye: 100% 2.02 SOIL MATERIALS A. Topsoil: Fertile, agricultural soil, typical for locality, capable of sustaining vigorous plant growth, taken from drained site; free of subsoil, clay or impurities, plants, weeds and roots; pH value of minimum 5.4 and maximum 7.0. 2.03 ACCESSORIES Page 603 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9219 05-11-2023 32 9219 - Seeding Page 2 of 4 A. Mulching Material: Wood cellulose fiber, dust form, free of growth or germination inhibiting ingredients. 1. Manufacturers: a. Profile Products; ProGanics Biotic Soil Media: www.profileevs.com/#sle. B. Fertilizer: Recommended for grass, with 50 percent of the elements derived from organic sources; of proportion necessary to eliminate deficiencies of topsoil, as indicated by analysis. 1. Manufacturers: a. Profile Products; BioPrime: www.profileevs.com/#sle. C. Water: Clean, fresh and free of substances or matter that could inhibit vigorous growth of grass. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that prepared soil base is ready to receive the work of this Section. 3.02 FERTILIZING A. Apply fertilizer in accordance with manufacturer's instructions. B. Apply after smooth raking of topsoil and prior to roller compaction. C. Do not apply fertilizer at same time or with same machine as will be used to apply seed. D. Mix thoroughly into upper 2 inches of topsoil. E. Lightly water to aid the dissipation of fertilizer. 3.03 SEEDING A. Apply seed at a rate of 10-12 lbs per 1000 sq ft , or as recommended by seed supplier evenly in two intersecting directions. Rake in lightly. B. Do not seed areas in excess of that which can be mulched on same day. C. Do not sow immediately following rain, when ground is too dry, or during windy periods. D. Immediately following seeding and compacting, apply mulch to a thickness of 1/8 inches. Maintain clear of shrubs and trees. E. Apply water with a fine spray immediately after each area has been mulched. Saturate to 4 inches of soil. F. Following germination, immediately re-seed areas without germinated seeds that are larger than 4by4inches. Page 604 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9219 05-11-2023 32 9219 - Seeding Page 3 of 4 3.04 PROTECTION A. Identify seeded areas with stakes and string around area periphery. Set string height to 42 inches. Space stakes at 48 inches. 3.05 MAINTENANCE A. See Section 32 0190 - Operation and Maintenance of Planting for post-occupancy maintenance. B. Provide maintenance of seeded areas for three months from Date of Substantial Completion. C. Maintain seeded areas immediately after placement until grass is well established and exhibits a vigorous growing condition. D. Mow grass at regular intervals to maintain at a maximum height of 2-1/2 inches. Do not cut more than 1/3 of grass blade at any one mowing. E. Neatly trim edges and hand clip where necessary. F. Water to prevent grass and soil from drying out. G. Immediately reseed areas that show bare spots. H. Protect seeded areas with warning signs during maintenance period. END OF SECTION Page 605 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9219 05-11-2023 32 9219 - Seeding Page 4 of 4 This page intentionally left blank Page 606 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 1 of 14 Section 32 9300 Plants PART 1 GENERAL 1.01 SECTION INCLUDES A. Preparation of subsoil and topsoil. B. Topsoil bedding. C. New trees, plants, and ground cover. D. Relocated trees, plants, and ground cover. E. Mulch and Fertilizer. F. Plants in pots/containers G. Warranty Replacement H. Tree Pruning. 1.02 RELATED REQUIREMENTS A. Section 32 8200 - Irrigation B. Section 32 0190 - Operation and Maintenance of Planting: Post-occupancy maintenance. 1.03 DEFINITIONS A. Weeds: Any plant life not specified or scheduled. B. Plants: Living trees, plants, and ground cover specified in this Section , and described in ANSI Z60.1. 1.04 REFERENCE STANDARDS A. ANSI/AHIA Z60.1 - American National Standard for Nursery Stock 2014. B. ANSI A300 Part 1 - American National Standard for Tree Care Operations - Tree, Shrub, and Other Woody Plant Management - Standard Practices (Pruning) 2017. 1.05 SUBMITTALS A. See Section 5 for submittal procedures. Page 607 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 2 of 14 B. Certificate: Submit certificate for plants free of disease or hazardous insects; certified by federal department of agriculture; free of disease or hazardous insects. C. Submit list of plant life sources. D. Submit purchase invoices from nurseries for review. E. Samples: Submit the following to the City for acceptance: 1. Soil Separator: One square foot minimum, accompanied by product data. 2. Drain Rock: One-half cubic foot. 3. Wood Bark Mulch: One-half cubic foot. F. Product Data: Submit the following product information to the City for acceptance: 1. Tree Staking Materials: Manufacturer's literature. 2. Herbicides: Schedule for application of herbicides must be approved by the City. G. Test Reports: Soil tests shall be performed by a certified soils analyst by the state of California. Provide the following tests and submit the results to the City: 1. Existing Site Soil: Provide two separate tests at distinctly separate on-site locations, for agricultural suitability, fertility, particle size analysis; including recommendations for soil amendment, and fertilization during the maintenance period. 2. Import Soil: Submit test reports of representative sample(s) for approval prior to delivery and for every 100 yards delivered to the site. Test for agricultural suitability, fertility, particle size analysis; including recommendations for soil amendment, and fertilization during the maintenance period. 3. Organic Amendments, Fir Bark: Test for partial organic amendment evaluation. 4. All Other Fertilizers and Amendments: For standard products, submit manufacturer's analysis. For all other products, submit analysis by testing laboratory. H. Soil Mix - Planters: Submit cut-sheets of each accepted planter soil mix component and one- ounce samples of the fertilizers to the Inspector. 1.06 QUALITY ASSURANCE A. Nursery Qualifications: Company specializing in growing and cultivating the plants with three years documented experience. B. Installer Qualifications: Company specializing in installing and planting the plants with five years experience. C. Testing Laboratory: Recognized laboratory for soil and plant disease analysis for ornamental horticulture, approved by the Inspector. Testing laboratory is to perform all work in accordance with the current methods of the Association of Official Agricultural Chemists. 1.07 DELIVERY, STORAGE, AND HANDLING A. Deliver fertilizer in waterproof bags showing weight, chemical analysis, and name of manufacturer. Store fertilizers and amendments, bark mulch, soil mixes, and other materials which could stain concrete and similar surfaces in such a manner that staining does not occur. Page 608 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 3 of 14 B. Plants: Maintain all plant material in a healthy growing condition prior to and during planting operations. Protect plants at all times from sun and drying winds. Plants that cannot be planted immediately upon delivery shall be kept in the shade, well protected and watered. Plant material delivered to the site must be planted within 3 days of site delivery. Plants that cannot be installed on this work schedule shall be returned to the grower until installation requirements can be met. 1.08 SUBSTITUTIONS, ADDITIONS, DELETIONS A. General: Submit proposals for substitutions in accordance with the requirements of Division 1 Specification Sections. Acceptance by the Inspector is required prior to proceeding with the work under this Section. B. The Architect reserves the right to substitute plant material of sizes equal to material specified, as the work progresses, at no additional cost to the City. C. When requesting substitutions for plant material, the Contractor shall provide the Architect with the following: 1. Contact information for nurseries Contractor was unable to obtain plant material. Minimum of three are required. 2. Three (3) alternate plant suggestions as part of the initial request. Provide foliage/flower color, growth habit, and sunset zone of each. 3. Substitution requests which do not include the above requirements will be denied until requirements have been met. 1.09 FIELD CONDITIONS A. General: Become familiar with the anticipated growing conditions prior to commencement of work. Notify the Inspector immediately in writing of any conditions, which will prevent the proper execution of the warranty responsibilities specified. Failure to so notify the Inspector constitutes acceptance of the growing conditions. Any removal, repair or replacement of plant material required by unsuitable conditions found after work has begun shall be done at no additional cost to the City. B. Do not install plant life when ambient temperatures may drop below 35 degrees F or rise above 90 degrees F. C. Do not install plant life when wind velocity exceeds 30 mph. 1.10 WARRANTY A. Plant Material: Warrant that all trees under this Contract will be vigorous, healthy, free of dead or dying branches and branch tips, bearing foliage of normal density and color, and will otherwise comply with the requirements of this Section, for a period of one year from date of Final Acceptance. Any delay in completion of planting operations which extends the planting into more than one growing season shall extend the warranty period correspondingly. B. Replacements: Without cost to the City, in a timely manner and as directed by the Inspector, replace all plants not meeting the requirements above throughout the course of the warranty period. Replacements shall closely match adjacent specimens of the same species in size and Page 609 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 4 of 14 shall comply with all requirements of this specification. C. Species: Replace all plant material determined by the City within two years following the final acceptance of the project, to be untrue to the species, clone and/or variety specified, to the equal condition of adjacent plants at the time of replacement, at no additional cost to the City. PART 2 PRODUCTS 2.01 PLANTS A. Any requests for plant material substitutions must be accompanied by documentation of inability to locate plants, including a list of plant nurseries contacted (minimum of three). B. Substitutions may be denied if plant material is available at regional wholesale nurseries. C. Trees, Plants, and Ground Cover: Species and size identifiable in plant schedule, grown in climatic conditions similar to those in locality of the Work. 1. Size: a. Plants shall conform to measurements specified. Measure plants when branches are in their normal position. Height and spread dimensions specified refer to the main body of plant and not branch tip to tip. Take caliper measurements at a point on the trunk 6 inches above natural ground line for trees up to 4 inches in caliper, and at a point 12 inches above the natural ground line for trees over 4 inches in caliper. b. The measurements specified are the measurements after pruning, where pruning is required. Plants that meet the measurements specified, but do not possess a normal balance between height, spread, and caliper, shall be rejected. c. Plants larger than specified may be used if approved by the City, and if provided at no additional cost to the City. If larger plants are approved, the root ball shall be increased in proportion to the size of the plant; irrigation system shall also be adjusted as required to accommodate larger plants. D. Acclimatization: The General Contractor is responsible for supplying plant material that has been properly acclimated and conditioned, in accordance with good horticultural practices, for the exposure, wind and humidity levels, soil conditions, etc., encountered at the project site and in the proposed plant location. E. Coordination: The Contractor shall coordinate his acclimatization schedule with the City as to allow an adequate conditioning period for the plant material prior to the approved date of planting commencement. Notify the City in writing prior to proceeding with any acclimatization work if approved work schedule allows insufficient time to acclimate the material. F. Quality: Plants shall be superior in form, compactness and symmetry; sound, healthy and vigorous, well branched and densely foliated when in leaf; free of disease, insect pests, eggs or larvae, and free from physical damage or adverse conditions that would prevent thriving growth. G. Species: Tag one of each plant prior to delivery to the site; label with genus, species and variety. Any plants not so identified will be subject to rejection by the City. Plants may be cross referenced with nurseries invoice at the discretion of the Architect. Page 610 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 5 of 14 H. Root Ball: 1. Do not supply any bare root or ball and burlapped stock unless approved by the City. 2. Sizes: As specified on the plans. Where no root ball dimensions have been specified, supply material in container sizes specified. 3. Material: Root ball shall consist of a soil or soil mix that is compatible with the soil or soil mix into which the plant will be planted, and that provides for thorough drainage, aeration, and adequate moisture and nutrient retention. Having sufficient density and firmness that when planted, the plant will stand upright and stable without need for additional support. 4. Containers: All plant material shall have been grown in the containers in which delivered for at least six months, but not over two years. Stock appearing to not have been in their containers for this term shall be rejected. 5. Root Pruning: Where root pruning is required to provide material of the specified size, or for planting in the sloped containers, the pruning is to be done under the direction of a Certified Arborist. No root pruning is to be done within one year of installation unless approved by the City. I. Trunks and Branches: Do not prune plants before delivery. All trunks are to be straight and of uniform taper, larger at the bottom unless otherwise specified. Plants with damaged or crooked leaders, or multiple leaders, unless specified, will be rejected. Plants with abrasions of the bark, sun scalds, disfiguring knots, or fresh cuts of limbs over 3/4 inch, which have not completely callused, will be rejected. Any plant unable to stand upright without support will be rejected. 2.02 SOIL MATERIALS A. General: All soils to be used in areas to be planted on the project shall be free of rocks over one inch in diameter, and free of foreign debris. Soil shall be free from sub-base/aggregate, refuse, plants or roots, clods, weeds, viable weed seeds, sticks, solvents, petroleum products, concrete, base rock, or other deleterious or extraneous material. Soil shall be free of soil-borne diseases, and capable of sustaining healthy plant life. B. Imported Topsoil: 1. Topsoil shall be fertile, friable soil of loamy character, containing an amount of organic matter normal to the region. All imported topsoil used on the job shall be from the same source. a. Make all arrangements for obtaining and testing imported topsoil. Submit test reports of a representative sample of the proposed supply for approval by the City well in advance of its scheduled delivery to the site. The approved sample will establish the standards to which all imported topsoil used on the job must conform. b. Transport imported topsoil directly from source to final position. If stockpiling is required, locations and amounts of stockpiles will be designated by the City. c. The City reserves the right to take additional samples of imported topsoil at the site. If subsequent testing proves material to be at variance with the approved sample, remove rejected soil from the site and replace immediately at no additional cost to the City. C. Imported Planter Pot Soil Mix: For use in planters and planter pots. The following ingredients, thoroughly blended into a homogeneous mix: Amount Ingredient 0.5 cubic yards 1/8 inch Fine Fir Bark as Specified Page 611 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 6 of 14 0.5 cubic yards Fine Sand as Specified 3 pounds Single Superphosphate 0-20-0 1 pound Calcium Nitrate 15.5-0-0 1 pound Iron Sulfate 8 pounds Kaiser 65 Dolomite Lime D. Existing On-Site Soils: Existing site soils shall be amended per the recommendations of the approved soils testing laboratory. The following soil amendments and fertilizers are to be used FOR BIDDING PURPOSES ONLY. 1. Site Soil: Top 6 inches of site soil shall be amended with following blend of amendments per 1000 square feet. Amount Ingredient 6 cubic yards Nitrogen Stabilized 0´-1/4´Fir Bark 15 lbs 12-12-12 Commercial Fertilizer as approved 15 lbs Soil Sulfur 100 lbs Agricultural Gypsum 2. Backfill Mix (on-grade locations): Amend site soil as follows per cubic yard. Amount Ingredient 3/5 cubic yard Surface Soil 2/5 cubic yard Nitrogen Stabilized 0´to 1/4´Fir Bark 1lb 12-12-12 Commercial Fertilizer as Specified 2lbs Iron Sulfate as Specified 10 lbs Agricultural Gypsum 3. Additional Amendments: Soil amendment recommendations will vary for planting areas if imported topsoil is required to establish finish grade. Provide all additional amendments as may be required by subsequent soil testing of approved imported topsoil and as directed by the Inspector. 2.03 SOIL AMENDMENT MATERIALS A. Nitrogen Stabilized Fir Bark On-Grade: Meeting the following specifications: 1. Particle Size (dry weight basis): Sieve Size Percent Passing 6.35 mm (1/4 inch)95 - 100 2.38 mm (No. 8, 8 mesh)50-80 500 micron (No. 35, 32 mesh)0-25 2. Organic Content: Determined by ash analysis. Minimum 92% based on dry weight. 3. Nitrogen: Minimum 0.8% nitrogen based on dry weight. 4. Salinity: Maximum saturation extract conductivity 3.5 millimhos per cm at 25 degrees centigrade. 5. Iron: Minimum 0.08% dilute acid soluble Fe based dry weight, if iron treated. 6. Bulk Density: 400 pounds per cubic yard. B. FINE COMPOST 1. Compost facility and compost material must meet the following requirements: Page 612 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 7 of 14 a. Inspected and regulated by the local enforcement agency for calrecycle. The past 3 inspection reports to be submitted verifying compliance with title14 requirements of the process to further reduce pathogens (pfrp), fecal coliform and salmonella testing and pathogen and epa, 40 cfr 503 regulations. b. Certified through the uscc seal of testing assurance (sta) program (a compost testing and information disclosure program). c. Analyzed by a laboratory that is enrolled in the us composting council¶s compost analysis proficiency (cap) program and using approved test methods for the evaluation of composting and compost (tmecc). d. Facility must provide proof of compost testing within 120 calendar days prior to delivery of material to project site. e. Apply a four-inch lift of compost during cultivation. 2. AMENDMENTS AND MYCORRHIZAL FUNGI INOCULANT a. Apply to all new planting holes: 1) Granular Tri-c myco Revival Plus applied at the manufacturer¶s recommended rates based on plant material container size. C. Fertilizer: Containing fifty percent of the elements derived from organic sources; of proportion necessary to eliminate any deficiencies of topsoil, as indicated in analysis. 1. Fertilizers shall be approved by the Organic Materials Review Institute (OMRI). 2. Contractor shall obtain City's written approval of proposed fertilizer(s) prior to use. D. Water: Clean, fresh, and free of substances or matter that could inhibit vigorous growth of plants. E. Pre-Emergent Herbicide: 1. Do not apply pre-emergent herbicide for weed control. 2. Contractor to carry out manual removal of weeds prior to planting. 2.04 MULCH MATERIALS A. Planter Mulching Material:Cedar species wood shavings, free of growth or germination inhibiting ingredients. Mulch shall have been baked to remove unwanted seed growth. 1. Type: Walk On Bark, 1" pieces and smaller a. Submit samples for approval. 2.05 ACCESSORIES A. Drain Rock: 3/4" diameter river rock or approved equal. B. Soil Separator: Soil Separator: "Mirafi 140N", as manufactured by Mirafi, Charlotte, NC, "Trevira Spunbond 1120", as manufactured by Hoechst Fibers Industries, Spartanburg, SC, or approved equal. C. Stakes:Softwood lumber, pointed end. 1. Lodgepole stakes. Length as required to meet dimensions required per plans. D. Root Control Barrier: "Deep Root Control Barrier", stock number UB24-2 as manufactured by Deep Root Corp., 15040 Golden West Circle, Westminister, CA 92683 (714) 898-0563, or approved equal. Page 613 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 8 of 14 2.06 SOURCE QUALITY CONTROL A. Analyze to ascertain percentage of nitrogen, phosphorus, potash, soluble salt and organic matter; pH value and any deficincies. B. Submit minimum 10 oz sample of topsoil proposed. Forward sample to testing laboratory in sealed containers to prevent contamination. C. Testing is not required if recent tests are available for imported topsoil. Submit these test results to the testing laboratory for approval. Indicate, by test results, information necessary to determine suitability. PART 3 EXECUTION 3.01 ORDERING, REVIEW AND ACCEPTANCE OF PLANT MATERIAL A. Ordering: 1. Within 30 days after award of contract, submit written certification to the City of the quantity and species of plant material ordered, and the nursery(s) supplying the material. 2. The Contractor is responsible for providing all plant material in the quantities and sizes specified on the drawings, and for making all arrangements in advance that may be required to obtain these materials. If any material specified will be unavailable at the time of planting, submit written verification to the City along with the bid. B. Review of Plant Material: Before planting operations begin, all plant materials shall be reviewed for conformance to the design intent of the Contract Documents by the City. Submit written request for review of plant material at least 10 days prior to commencement of planting operations. Review by the City does not waive the right of rejection during planting or any time thereafter. C. Rejection of Material: The City reserves the right to review and reject plant material at any time, and at the place of growth, for nonconformance to the Specifications. Do not install plant material, which has not been reviewed at the project site by the City. 3.02 EXAMINATION A. Verify that prepared subsoil and planters are ready to receive work. B. Saturate soil with water to test drainage. C. Verify that required underground utilities are available, in proper location, and ready for use. 3.03 GRADING A. General: All areas to be planted on the project shall be free of rocks over one inch in diameter to a depth of 8´minimum below finish grade, and free of foreign debris, subsoil, refuse, plants or roots, clods, weeds, sticks, solvents, petroleum products, concrete, base rock, or other deleterious or extraneous material. Areas to be planted shall be free of soil-borne diseases and capable of sustaining healthy plant life. Do all work necessary to bring site soil, import soil and Page 614 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 9 of 14 planter backfill to compliance with these requirements. Remove from the project site and dispose of in a legal manner any soils and material not meeting these requirements. Subject to acceptance of the City, all soil and material not meeting these requirements shall be the property of the Contractor. 1. Surface Drainage: Contractor is responsible for proper surface drainage of planted areas. Report in writing to the City any discrepancies in the Contract Documents, obstructions on the site, or any other conditions, which the Contractor feels prevent establishing proper drainage, and obtain the Inspector's instructions prior to proceeding with the work affected. 2. Final Contouring: a. Handle and place the soil to depths required. Remove all rocks and clods over one inch in diameter. Provide for surface drainage and cut all necessary drain swales. b. Work soil sufficiently so that after rolling and after full settlement has occurred, the site will be graded to within ±0.10 of a foot from the lines, grades and elevations shown, and as may be directed by the Inspector. Finished surface shall be smooth and uniform and shall be free of depressions that retain standing water or any surface irregularities that would impede proper drainage. Unless otherwise noted, all soil finish grades shall be 1-1/2 inches below finish grade of adjacent walks, pavements and curbs, and top of wall elevations. 3. Erosion Repair: Repair all erosion damage that occurs until Final Acceptance. Take all measures necessary to prevent erosion occurring during work under this Section. Provide and amend replacement soil in accordance with this Section. 3.04 PREPARATION OF SUBSOIL A. Amend subsoil as indicated in analysis. B. Prepare subsoil to eliminate uneven areas. Maintain profiles and contours. Make changes in grade gradual. Blend slopes into level areas. C. Remove foreign materials, weeds and undesirable plants and their roots. Remove contaminated subsoil. D. Scarify subsoil to a depth of 3 inches where plants are to be placed. Repeat cultivation in areas where equipment, used for hauling and spreading topsoil, has compacted subsoil. E. All planting areas to be cultivated. F. Repeat cultivation until the soil is loose to a minimum depth of 12 inches. G. Add: Remove native soil as needed prior to adding amendments, to allow for addition of compost amendment and mulch to achieve final grades. H. Place compost amendment and till to a depth of twelve eight inches. Provide additional amendments or adjust soil preparation if directed per the soil analysis recommendations and approved by owner/owner¶s representative. Roll compact soil to achieve compaction of 85% of dry weight density in areas where plantings are located. I. After natural settlement and light rolling, the complete work to conform strictly to the lines, grades and elevation indicated, under the contract without additional cost to the owner. Page 615 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 10 of 14 J. Finish grading of landscape areas: fine grade all prepared planting areas to lines and grades shown on plans and as specified within this section. Finish grade to account for placement of specified mulch. K. Top of finished mulch surface to be 1/2´below adjacent pedestrian or bicycle paths unless otherwise specified on civil grading plans. Intent is to minimize tripping hazards at pedestrian interface from grade changes after minor settlement of prepared planting soils and mulch. L. Dig plant pits and beds twice the size of the rootball as directed per the drawings. 3.05 PLACING TOPSOIL - NON BIOSWALE PLANTERS A. Spread topsoil to a minimum depth of 6 inches over area to be planted. Rake smooth. B. Place topsoil during dry weather and on dry unfrozen subgrade. C. Remove vegetable matter and foreign non-organic material from topsoil while spreading. D. Grade topsoil to eliminate rough, low or soft areas, and to ensure positive drainage. E. Install topsoil into pits and beds intended for plant root balls, to a minimum thickness of 6 inches. F. Place topsoil mix to the depths specified to obtain finish grades shown on the drawings. Soil mix shall be handled in a manner so as to prevent segregation of ingredients. Thoroughly water planter backfill mix after placement to compact and settle mix. 3.06 PLACING TOPSOIL - BIOSWALE PLANTERS A. Spread bioswale soil mix over permeable rock subbase to depths indicated within limits shown per plans. 18" depth of bioswale mix shall be utilized if no detail is provided. B. Verify permeability of soil media meets a minimum of 5 ft/second by running flood test through media. C. Remove vegetable matter and foreign debris from topsoil D. Grade topsoil to match grades provided on plans. 3.07 FERTILIZING A. Apply fertilizer in accordance with manufacturer's instructions. B. Apply after initial raking of topsoil. C. Mix thoroughly into upper 2 inches of topsoil. D. Lightly water to aid the dissipation of fertilizer. 3.08 EXCAVATION OF PLANTING PITS ON-GRADE Page 616 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 11 of 14 A. General: Excavate plant pits by hand or with a backhoe; use of augers will not be permitted. Prior to planting and backfill, scarify the sides and bottom of the pit as required to eliminate any glazed surfaces. Excavate container-grown tree, shrub, and vine holes to the following dimensions: 1. 1, 5, and 15 gallon containers: Two times the size of the root ball in width and depth. 2. 24-inch boxes and larger: Large enough to allow one foot of space around the ball in all directions. 3. Holes on mounds: Dig plant holes on mounds deeper than normal. 4. Excess Soil: Transport and dispose of off-site in a legal manner any excess excavated soil. 5. Obstructions: If rocks, underground construction work, tree roots or other unknown obstructions are encountered in the excavation of plant holes, alternate locations may be selected by City. Report all such conditions in writing to the City. If a change in the location of the planting pit is unacceptable to the City, the original planting pit shall be over-excavated to remove the obstructions to a minimum dimension of 12´beyond the sides and bottom of the tree pit as typically specified. Obtain the City's instructions prior to proceeding with the work affected. 3.09 DETRIMENTAL SOILS AND DRAINAGE A. General: Prior to planting, test drain all planting areas as follows: 1. On-Grade Plant Pits: Fill with 12 inches of water. Water should drain completely in 48 hours. 2. Plant Beds: Irrigate until soil is saturated. Saturated condition should not remain after 24 hours. B. Drainage Chimneys: 1. General: For plant pits failing the initial drainage test, provide drainage chimneys as shown on the drawings and as directed by the City. 2. Neatly auger drainage chimneys to a depth directed by the City. Remove loose soil from hole and plant pit. Locate chimneys at perimeter of plant pit. Repeat test for proper drainage. 3. Once required drainage test has been passed, backfill chimneys with drain rock, flush with bottom of pit. Cover chimneys with soil separator. C. Failure of Drainage Test: report in writing to the City all areas not passing these tests and all soil conditions that the Contractor considers detrimental to growth of plant material. State condition and proposal and cost estimate for correcting the condition. Obtain the City's instructions prior to proceeding with the work affected. Repeat drainage testing and correction of conditions in this manner as necessary until tests are passed. Failure to perform drainage tests and/or to notify the City in writing of the conditions specified above renders the Contractor responsible for all plant failure that occurs as a result of inadequate drainage or detrimental soil conditions, as determined by the City. 3.10 PLANTING A. General: Do not plant any material that has not been reviewed by the Inspector upon delivery to the project site or that has been rejected for any reason. Do not plant under unfavorable weather conditions. Page 617 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 12 of 14 B. Place plants for best appearance. C. Place trees for best appearance for review and final orientation by Architect. D. Set plants vertical. E. Remove non-biodegradable root containers. After removing plants from their containers, disentangle any small roots that encircle the container. Do not cut or otherwise disturb the root ball. Inspect all plants for rootbound condition; do not install rootbound plants or plants found to have cracked or broken root balls when taken from the container. F. Care should be exercised to prevent damage or breakage to limbs, and ropes or other lines should not be allowed to damage bark. 1. Container Stock: a. General: Do not lift or handle container plants by tops, stems, or trunks at any time. b. Boxed Stock: Remove bottom of box prior to placement of plant in planting pit. Cut bands and remove box sides just prior to backfilling. c. Canned Stock: Remove canned stock carefully after cans have been cut on two sides with acceptable cutter. Do not use spade to cut cans. d. Ball and Burlap Stock: Dig ball and burlap (B & B) plants with firm balls of earth of diameter not less than that recommended by the American Standard for Nursery Stock, and of sufficient depth to include the fibrous and feeder roots. Plants moved with ball will not be accepted if the ball is cracked or broken before or during planting operations. G. Set plants in pits or beds, partly filled with prepared plant mix, at a minimum depth of 6 inches under each plant. Remove burlap, ropes, and wires, from the root ball. H. Place bare root plant materials so roots lie in a natural position. Backfill soil mixture in 6 inch layers. Maintain plant life in vertical position. I. Saturate soil with water when the pit or bed is half full of topsoil and again when full. J. Top-dress Fertilizing On-Grade: When plant installation is complete, fertilize all planting areas (excluding lawn areas) with top-dress fertilizer at the rate of 4 lbs. per 100 square feet. K. Anti-Desiccant: At Contractor's option, spray all evergreen and deciduous plant material in full leaf with anti-desiccant, in accordance with manufacturer's instructions. Apply an adequate film over trunks, branches, twigs and foliage. Take precautions as necessary to prevent damage, particularly from sun scald. L. Mulching: Mulch all planting areas (excluding lawn areas) with 3 inch layer of wood bark mulch unless otherwise shown. Spread mulch uniformly to form a smooth cover free of bare spots and mounds. 1. Settlement: As shown on the drawings, the crowns of all plants shall be at least 1/2 inch above the surrounding grade after all settlement has occurred. 2. Watering Basins On-Grade: Form a watering basin, an excavated ring around the root ball of the plant for each tree and shrub. Do not form watering basins in lawn areas. 3.11 GROUND COVER PLANTING Page 618 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 13 of 14 A. Pre-emergent herbicide Application On-Grade Only: Apply pre-emergent herbicide, Surflan A.S. at the rate of 5-1/3 pounds per acre applied in 25 gallons of water to all on-grade locations. Apply before wood bark mulch application. B. Planting: Plant ground cover plants through wood bark mulch at the specified triangular spacings. Make planting hole with a hand mattock avoiding mixing surface applied herbicide into planting hole. 1. Activation of Herbicide On-Grade Only: After planting, irrigate with at least one inch of water to activate the herbicide. Water areas carefully taking care to avoid erosion. Repair erosion occurring from careless watering immediately. Remove, repair and replace adjacent planting and soil damaged by careless watering and translocation of herbicide. 3.12 LAYOUT OF PLANT MATERIAL A. General: The City will review for conformance to the design intent of the Contract Documents locations of all plants in the field prior to planting. Notify the City and schedule layout review sufficiently in advance of planting to allow for review and adjustment without disrupting construction schedule. B. Adjustments: The City reserves the right to make minor adjustments in the layout of all plant material; adjust irrigation system as necessary. 3.13 PLANT RELOCATION AND RE-PLANTING A. Relocate trees as indicated by Architect and Project Arborist. B. Replant plants in pits or beds, partly filled with prepared topsoil mixture, at a minimum depth of 6 inches under each plant. Remove burlap, ropes, and wires, from the root ball. C. Place bare root plant materials so roots lie in a natural position. Backfill soil mixture in 6 inch layers. Maintain plant materials in vertical position. D. Saturate soil with water when the pit or bed is half full of topsoil and again when full. 3.14 PLANT SUPPORT A. General: Complete staking and guying immediately after planting. Perform in accordance with reference standards, unless otherwise shown on the drawings or directed by the City. Securely stake or guy all trees planted on the site using staking or guying type shown on the drawings. The City reserves the right to make modifications to staking and guying procedures as required to accommodate field conditions at no additional cost to the City. 1. Staking: Stake trees as shown on the drawings. 3.15 PRUNING A. Prune plants only at the direction of the City and according to reference standards to preserve the natural character of the plant. Remove all dead wood, suckers and broken or badly bruised branches. Remove sucker basal and lateral growth to prevent resprouting; retain normal side branching. Use only disinfected, sharp tools. Improperly pruned trees will be subject to rejection by the City. Apply tree seal to cuts over one inch diameter in accordance with Page 619 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 Section 32 9300 05-11-2023 32 9300 - Plants Page 14 of 14 manufacturer's instructions. B. Prune trees as recommended in ANSI A300 Part 1. C. Prune newly planted trees as required to remove dead, broken, and split branches. 3.16 FIELD QUALITY CONTROL A. Plants will be rejected if a ball of earth surrounding roots has been disturbed or damaged prior to or during planting. B. Deficient Soils: Remove all soils determined by the City to be deficient and provide all additional amendments as directed to modify deficient soils at no additional cost to the City. 3.17 MAINTENANCE A. See Section 32 0190 - Operation and Maintenance of Planting for post-occupancy maintenance. B. Remove dead or broken branches and treat pruned areas or other wounds. 3.18 CLEANUP A. Sweep site clean of all excess materials used in these operations. Excess soils shall be swept up and removed off site. Do not wash excess materials into adjacent drainage facilities. END OF SECTION Page 620 of 802 Job Name: Mission Plaza Improvements Job Number: 0256-03-CU20 APPENDIX C - TECHNICAL SPECIFICATIONSAPPENDIX C - MURRAY ADOBE RECOMMENDATIONS FOR PHASE 1 OF MISSION PLAZA CONCEPT PLAN Page 621 of 802 This page intentionally left blank Page 622 of 802 811 El Capitan Way, Suite 100 San Luis Obispo, CA 93401-8943 O: (805) 594-1590 | F: (805) 594-1577 www.appliedearthworks.com CULTURAL RESOURCE MANAGEMENT | ARCHAEOLOGY | ARCHITECTURAL HISTORY | PALEONTOLOGY | GIS May 1, 2023 Brian Nelson City of San Luis Obispo 919 Palm Street San Luis Obispo, CA 93401 RE: Murray Adobe Recommendations for Phase 1 of the Mission Plaza Concept Plan Dear Mr. Nelson: At the request of RRM Design Group, Applied EarthWorks, Inc. (Æ) is pleased to present the following recommendations for appropriate treatment of the Murray Adobe during implementation of Phase 1 of the Mission Plaza Concept Plan (Plan). Phase 1 of the Plan includes removal of the trellis adjacent to the adobe, removal and replacement of landscaping and hardscaping, and extending the existing patio along the southwest wall to the southeast. Other actions include removal of existing public restrooms, planters, mature trees, and hardscape near Murray Adobe within Mission Plaza; construction of new public restrooms; and installation of new hardscape, planters, and trees. Murray Adobe is on the City of San Luis Obispo Master List of Historic Resources and is considered a historical resource under the California Environmental Quality Act (CEQA). Projects that are consistent with the Secretary of the Interior’s (SOI) Standards will not result in a significant impact under CEQA. On December 20, 2022, Æ Senior Architectural Historian Amber Long met with Mark Sauer, owner of Mark Sauer Construction, Debbie Rudd, Principal at RRM Design Group, and representatives from the City of San Luis Obispo (City) in Mission Plaza to tour Murray Adobe. During the site visit Mr. Sauer visually inspected the interior and exterior of the adobe, while discussing the project with the team. Mr. Sauer has worked extensively with historic adobe buildings around California and has successfully implemented protection measures that have been successful over decades of monitoring. The following information is summarized from Mr. Sauer’s report, subsequent email (see attached), and team calls. All recommendations are consistent with the SOI Standards for the Treatment of Historic Places (Grimmer 2017). Existing Condition The adobe is in fairly good condition except for the exposed adobe wall. The existing cement-based plaster is not the correct application for the adobe. Adobe bricks expand and contract, while the cement- based plaster is rigid, which can create structural issues. Sections of the plaster are delaminating from the interior and exterior of the adobe. Phase 1 Recommendations. The following recommendations should be followed during Phase 1 of the Plan. x Demolition of the pavement adjacent to the adobe should start with a cut 3 to 4 feet away from the adobe. The pavement will then be removed by hand, limiting the potential for damage to the adobe. Where new paving will abut the adobe, some form of masonry protection board should be Page 623 of 802 2 Murray Adobe Recommendations for Phase 1 of the Mission Plaza Concept Plan installed. This process should also be followed where the patio will be extended along the adobe, to the southeast. x The existing flashing, trellis, and patio cover can be replaced or removed. If replaced, a new ledger should be installed directly to the adobe wall using epoxy anchors to support a small patio cover over the exposed adobe wall. A structural engineer should be consulted regarding the size, depth, and frequency of the anchors. Existing plaster should be cut away to allow direct anchoring of the ledger to the adobe wall. Enough plaster should be removed so the top of the new flashing is covered. Copper flashing is preferable. Expanded metal lath with 3-inch exterior grade screws and fender washers are recommended. Plaster around the ledger and new flashing will need to be repaired. New lime plaster should not contain cement. x If the patio cover is not replaced, the plaster where the old ledger and flashing is removed will need to be repaired. New lime plaster should not contain cement. x The exposed area of the adobe wall should be completely covered with lime plaster to protect the exposed wall. New lime plaster should not contain cement. An approximately 12-square-foot area can remain exposed or be exposed later for use as a viewing panel with a wood frame and laminate glass. A patio cover is not required above the viewing panel; however, copper flashing should be installed above the viewing panel in the manner described above. Recommendations for Additional Work. After completion of Phase 1, the following recommendations should be followed to address ongoing condition issues. x All cement-based plaster should be removed from the interior and exterior adobe walls and a new lime-based plaster applied. Additional information can be found at www.limes.us. x Proper site drainage is critical to preserving Murray Adobe. All mulch should be removed within 12 to 18 inches of the adobe walls. Irrigation must be altered so that no water hits the walls or pools at the base of the walls. Based on the direction of the slope, water will continue to flow from Mission San Luis Obispo de Tolosa towards the adobe to San Luis Creek. French drains could be installed to route the flow of water around the adobe. x All existing wood windows need repairs. Windows can be salvaged by repairing the glass and glazing. Wood repairs should include “dutchman” repairs and the addition of wood consolidating products. Additional information can be found at www.abatron.com. x The roof needs to be replaced; however, it is currently holding out water. A new roof will require new ply sheathing. x A seismic retrofit should be considered for the adobe as part of a structural upgrade. Secretary of the Interior’s Standards Until a new use is proposed for Murray Adobe, the SOI Standard for Preservation should be followed to preserve the adobe in its current configuration. The recommendations above, including proper lime Page 624 of 802 3 Murray Adobe Recommendations for Phase 1 of the Mission Plaza Concept Plan plaster coatings, reducing the exposed area of the adobe, improving drainage and window repairs, are consistent with the Standard for Preservation, which is: “… the act or process of applying measures necessary to sustain existing form, integrity, and materials of an historic property. Work, including preliminary measures to protect and stabilize the property, generally focuses upon the ongoing maintenance and repair of historic materials and features rather than extensive replacements and new construction.” (Grimmer 2017:2) The following National Park Service Preservation Briefs and Preservation Tech Notes provide further guidance on the recommendations above. They can be found at www.nps.gov. x Preservation Brief 4: Roofing for Historic Buildings ((Sweetser 1978) x Preservation Brief 5: The Preservation of Historic Adobe Buildings ((Tiller and Look 1978) x Preservation Brief 9: The Repair of Historic Wooden Windows (Myers 1981) x Preservation Brief 10: Exterior Paint Problems on Historic Woodwork (Weeks and Look 1982) x Preservation Brief 41: The Seismic Rehabilitation of Historic Buildings (Aguilar 2016) x Temporary Protection 3: Protecting a Historic Structure During Adjacent Construction (Randl 2001) x Windows 1: Planning Approaches to Window Preservation (Fisher 1984) x Windows 4: Replacement Wooden Frames and Sashes (Feist 1984) x Windows 14: Reinforcing Deteriorated Wooden Windows (Stumes 1986) The preceding recommendations are intended to limit or eliminate any unintended damage to Murray Adobe from implementation of Phase 1 of the Plan. In the event of unintended damage, including but not limited to new cracking or chipping plaster, or crumbling adobe bricks, work in the area around Murray Adobe should stop and a structural engineer and/or adobe specialist consulted. Æ appreciates the opportunity to provide this guidance. If you have further questions, please contact Managing Principal Erin Enright at (805) 594-1590, extension 316, or eenright@appliedearthworks.com. Sincerely, Amber Long, M.A. Senior Architectural Historian Applied EarthWorks, Inc. Attachments: Site Visit Report 1.12.23; Email from Mark Sauer 2.7.2023; and C. Ledger With Flashing Simple Sketch Page 625 of 802 4 Murray Adobe Recommendations for Phase 1 of the Mission Plaza Concept Plan REFERENCES CITED Aguilar, Antonio 2016 The Seismic Rehabilitation of Historic Buildings. Preservation Briefs No. 41. U.S. Department of the Interior, National Park Service, Technical Preservation Services, Washington, D.C. Feist, William C. 1984 Replacement Wooden Frames and Sash, Protecting Woodwork against Decay. Windows, No. 4. Preservation Tech Notes. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Fisher, Charles E. 1984 Planning Approaches to Window Preservation. Windows, No. 1. Preservation Tech Notes. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Grimmer, Anne E. 2017 The Secretary of the Interior’s Standards for the Treatment of Historic Properties with Guidelines for Preserving, Rehabilitating, Restoring, & Reconstructing Historic Buildings. Rev. ed. U.S. Department of the Interior, National Park Service, Technical Preservation Services, Washington, D.C. Myers, John H. 1981 The Repair of Historic Wooden Windows. Preservation Brief No. 9. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Randl, Chad 2001 Protecting a Historic Structure During Adjacent Construction. Temporary Protection, No. 3. Preservation Tech Notes. U.S. Department of the Interior, National Park Service, Heritage Preservation Services, Washington, D.C. Stumes, Paul 1986 Reinforcing Deteriorated Wooden Windows. Windows, No. 14. Preservation Tech Notes. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Sweetser, Sara M. 1978 Roofing for Historic Buildings. Preservation Brief No. 4. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Tiller, de Teel Patterson, and David W. Look 1978 Preservation of Historic Adobe Buildings. Preservation Briefs No. 5. U.S. Department of the Interior, National Park Service, Heritage Preservation Services, Washington, D.C. Weeks, Kay D., and David W. Look 1982 Exterior Paint Problems on Historic Woodwork. Preservation Brief No. 10. U.S. Department of the Interior, National Park Service, Preservation Assistance Division, Washington, D.C. Page 626 of 802 Page 627 of 802 Page 628 of 802 Page 629 of 802 Page 630 of 802 Page 631 of 802 Page 632 of 802 City of San Luis Obispo Sole Source Justification Form Steven Handelman Studios Light Fixtures The City of San Luis Obispo (SLO) policy is to solicit quotations or bids for purchases for tier two (2) through five (5) price levels (See Purchasing Policy section 202A; 203A). Under SLO Municipal Code 3.24.060, bid procedures may be waived and procurement obtained from a single sole‐ source if it meets the criteria in Municipal Code 3.24.060. (See p. 2 for relevant criteria). Staff must justify waiving the bid procedures in this form and tie the justification to one of the Municipal Code subsections. (See p. 2 for relevant criteria) The justification should provide enough detail so that anyone in the public with no background on the purchase can understand the justification. 1. What product or service is being requested? Why is it necessary? City staff is requesting to sole source the purchase of Steven Handelman Studios light fixtures including both building exterior wall fixtures and pedestrian pole mounted light fixtures within the Mission Plaza. The City hired RRM Design Group in 2018 through the use of an on‐call architectural design services agreement created from a public competitive selection process. In order to complete the full design, RRM sub‐consulted with Steven Handelman Studios to design custom light fixtures that complemented the architectural design of the new buildings as well as compliments the history of Mission Plaza. In order to construct the project per the design, custom light fixtures will need to be purchased by the Contractor from Steven Handelman Studios. 2. Is this “brand” of product or services offered the only one that meets the City’s requirements? If yes, what is unique about the product/services? These custom products (light fixtures) are required to complete the current project design. These products are unique because they are custom designed and specifically planned to reflect and complement the historic district with key elements from the Mission Era. 3. Is the product or service proprietary or is it available from various dealers? Have you verified this? These custom light fixtures are not available from other dealers. 4. Have other products/vendors been considered? If yes, which products/vendors have been considered and how did they fail to meet the City’s requirements? No other products have been considered because this product was selected during the design process when RRM sub consulted with Steven Handelman Studios. The products were reviewed by City staff and design professionals for complementing the architecture of the project and the Mission. 5. Is the purchase an upgrade or addition to an existing system or brand of products adopted citywide? If so, will purchase of this product avoid other costs as opposed to purchasing another product or service (e.g., additional training required; data conversion; implementation of a new system; etc.)? Page 633 of 802 City of San Luis Obispo Sole Source Justification Form These lights will replace old pedestrian lights throughout Mission Plaza and be a significant upgrade to the current light fixtures. These lights will be specific to the Mission Plaza area due to their unique features. 6. Is this a request for services by a contractor with necessary, unique and critical knowledge of established City systems or programs? If so, will using the contractor’s services avoid other costs (e.g.: significant staff time in compiling information, data transfers, etc.)? This request is not for services by a contractor with necessary, unique and critical knowledge of established City systems or programs. 7. What is the quoted price for the product or services and is it reasonable (based on other products or services in the same field or based on historical pricing for the City for similar products or services)? The quoted price for the products to be purchased by the awarded contractor are approximately $7000 for each pedestrian light pole fixture and $1000 for each wall mounted fixture. These fees are reasonable for the quality of products provided. The City plans to install 6 wall mounted fixtures and up to 20 pedestrian light poles with this project for a cost of approximately $160,000. Approved: Dan Clancy /s/ 6/6/2023 Daniel Clancy Date Purchasing Analyst Page 634 of 802 City of San Luis Obispo Sole Source Justification Form 3.24.060 Bidding procedures—Use of not required when. Purchase of those items listed in Section 3.24.010 shall be by bid procedures set forth in this chapter. Such procedures may be dispensed with, at the discretion and judgment of the purchasing authority as to the best interests of the city, as follows: A. When the amount to be expended is less than the bid requirement amount which shall be specified by resolution of the council; B. When an emergency purchase is made to address a situation that creates an immediate and serious need for equipment, supplies, or services that cannot be met through normal purchasing procedures and where the lack of such equipment, supplies or services would seriously threaten the functioning of city government, the preservation of property, or the health or safety of any person; C. When the item(s) to be purchased can be obtained from only one vendor or supplier; D. When supplies or equipment have been uniformly adopted in the city or otherwise standardized; E. When the purchase will be made cooperatively with one, or more, other units of government, or from a local dealer within the city limits that can provide the same brand, model and configuration of item(s) identified in cooperative purchase agreement(s) at or below the cooperative purchasing net cost within the same terms and conditions; F. When reasonably necessary for the preservation or protection of public peace, health, safety or welfare of persons or property; or G. When, given the indeterminate nature of the city’s need, a request for proposal will result in a more favorable and efficient comparison of supplies, equipment and/or services. (Ord. 1618 § 1 (Exh. A (part)), 2015: Ord. 1608 § 1, 2014; Ord. 954 § 2 (part), 1983: prior code § 2950.6). Page 635 of 802 Page 636 of 802