Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2001057 Higuera Complete Street Special Provisions 2026-02-09
SPECIAL PROVISIONS FOR CITY OF SAN LUIS OBISPO Higuera Corridor Complete Streets Project Specification No. 2001057 February 2026 PUBLIC WORKS DEPARTMENT ENGINEERING DIVISION 919 Palm Street San Luis Obispo, CA 93401 (805) 781-7200 Higuera Corridor Complete Streets Project Specification No. 2001057 Approval Date: February 17, 2026 Hai Nguyen February xx, 2026 Brian Nelson February xx, 2026 TABLE OF CONTENTS NOTICE TO BIDDERS ..................................................................................................... I BID SUBMISSION ...................................................................................................................................... I BID DOCUMENTS .................................................................................................................................... II PROJECT INFORMATION....................................................................................................................... III QUALIFICATIONS .................................................................................................................................... III AWARD ..................................................................................................................................................... V ACCOMMODATION ................................................................................................................................. VI BID FORMS .................................................................................................................... A BID ITEM LIST FOR HIGUERA CORRIDOR COMPLETE STREETS PROJECT, SPECIFICATION NO. 2001057 ..................................................................................................................................................... A LIST OF SUBCONTRACTORS ................................................................................................................ H LABOR CODE SECTION 1725.5 STATEMENTS ..................................................................................... I NONCOLLUSION DECLARATION ........................................................................................................... J BIDDER ACKNOWLEDGEMENTS ........................................................................................................... K QUALIFICATIONS ..................................................................................................................................... L ATTACH BIDDER'S BOND TO ACCOMPANY BID ................................................................................. M SPECIAL PROVISIONS .................................................................................................. 1 DIVISION I GENERAL PROVISIONS ....................................................................................................... 1 1 GENERAL ........................................................................................................................................... 1 3 CONTRACT AWARD AND EXECUTION ........................................................................................... 1 4 SCOPE OF WORK ............................................................................................................................. 2 5 CONTROL OF WORK ........................................................................................................................ 2 6 CONTROL OF MATERIALS ............................................................................................................... 3 7 LEGAL RELATIONS AND RESPONSIBILITY TO THE PUBLIC ....................................................... 3 8 PROSECUTION AND PROGRESS ................................................................................................... 5 DIVISION II GENERAL CONSTRUCTION ............................................................................................... 8 12 TEMPORARY TRAFFIC CONTROL ................................................................................................ 8 13 WATER POLLUTION CONTROL ..................................................................................................... 8 15 EXISTING FACILITIES ..................................................................................................................... 9 DIVISION V SURFACINGS AND PAVEMENTS ..................................................................................... 11 37 BITUMINOUS SEALS ..................................................................................................................... 11 39 ASPHALT CONCRETE .................................................................................................................. 12 DIVISION VIII MISCELLANEOUS CONSTRUCTION ............................................................................ 12 73 CONCRETE CURBS AND SIDEWALKS ....................................................................................... 12 DIVISION IX TRAFFIC CONTROL DEVICES......................................................................................... 14 84 MARKINGS ..................................................................................................................................... 14 DIVISION X ELECTRICAL WORK .......................................................................................................... 15 86 ELECTRICAL SYSTEMS ............................................................................................................... 15 DIVISION XIII APPENDICES .................................................................................................................. 16 ADD SECTION 100 APPENDICES ..................................................................................................... 16 APPENDIX A - FORM OF AGREEMENT ....................................................................... 0 APPENDIX B – MADONNA ROAD & US 101 RAMPS TEMPORARY TRAFFIC SIGNAL DETECTION PLANS ....................................................................................................... 4 APPENDIX C – SEALMASTER SAFE RIDE DATA SHEET ........................................... 5 APPENDIX D – CALTRANS ENCROACHMENT PERMIT ............................................. 6 APPENDIX E – PG&E CONSTRUCTION DRAWING FOR HIGUERA & ELKS SIGNAL SERVICE ........................................................................................................................ 7 APPENDIX F – PAVEMENT EVALUATION REPORT .................................................... 8 NOTICE TO BIDDERS i NOTICE TO BIDDERS BID SUBMISSION Sealed bids will be received by the City of San Luis Obispo at the Public Works Administration Office located at 919 Palm Street, San Luis Obispo, California 93401, until 11:00 a.m. on April xx, 2026 at which time they will be publicly opened and read aloud. Public bid opening may also be viewed via Microsoft Teams video conference and conference call. Use the following link: https://teams.microsoft.com/l/meetup- join/19%3ameeting_YWJmZTY5ZjctNjQxOC00ODk3LWFhMjctODkyOGI2NjkzODRi%4 0thread.v2/0?context=%7b%22Tid%22%3a%22a78b182d-94e4-4507-a9a9- 330dcb148164%22%2c%22Oid%22%3a%22eec32d58-d6a8-4d68-8923- 9cce58e6b2a9%22%7d or join by phone with this number: 1 (209) 645-4165 with Conference ID: 438 062 902# Submit bid in a sealed envelope plainly marked: Higuera Corridor Complete Streets Project, Specification No. 2001057 Any bid received after the time and date specified will not be considered and will be returned to the bidder unopened. Bids received by Fax or Email will not be considered. By submission of bid you agree to comply with all instruction and requirements in this notice and the contract documents. All bids must be submitted on the Bid Item List form(s) provided and submitted with all other Bid Forms included in these Special Provisions. Each bid must be accompanied by either a: 1. certified check 2. cashier's check 3. bidder's bond made payable to the City of San Luis Obispo for an amount equal to ten percent of the bid amount as a guaranty. Guaranty will be forfeited to the City San Luis Obispo if the bidder, to whom the contract is awarded, fails to enter into the contract. The City of San Luis Obispo reserves the right to accept or reject any or all bids or waive any immaterial irregularities in a bid. All bids are to be compared based on the City Engineer's estimate of the quantities of work to be done, as shown on the Bid Item List. NOTICE TO BIDDERS NOTICE TO BIDDERS ii Bids will only be accepted from bidders that are licensed in compliance with the provisions of Chapter 9, Division III of Business and Professions Code. The award of the contract, if awarded, will be to the lowest responsive bid submitted by a responsible contractor whose bid complies with the requirements prescribed. If the contract is awarded, the contract will be awarded within 60 calendar days after the opening of the bids. Failure to raise defects in the notice to bidders or bid forms prior to bid opening constitute a waiver of those defects. BID DOCUMENTS A copy of the plans and special provisions may be downloaded, free of charge, from the City’s website at: www.slocity.org/government/department-directory/public-works/public-works-bids- proposals No printed copies are available for purchase at the City office. Request must include Specification Number. The office of the City Engineer is located at: 919 Palm Street San Luis Obispo, CA 93401 Standard Specifications and Engineering Standards referenced in the Special Provisions may be downloaded, free of charge, from the City’s website at: www.slocity.org/government/department-directory/public-works/documents- online/construction-documents You are responsible to obtain all issued addenda prior to bid opening. Addenda will be available to download at the City’s website listed above or at the office of the City Engineer. All questions must be submitted through BidNet and if the City determines that a response is required, the City will post an addendum on BidNet. Contact the project manager, Hai Nguyen at 805-781-7108 / hnguyen@slocity.org or the Public Works Department at (805) 781-7200 prior to bid opening to verify the number of addenda issued. You are responsible to verify your contact information is correct on the plan holders list located on the City’s website at: www.slocity.org/government/department-directory/public-works/public-works-bids- proposals. NOTICE TO BIDDERS NOTICE TO BIDDERS iii PROJECT INFORMATION In general, the project consists of curb ramp construction, application of slurry seal, striping, pavement markings, and signage to various streets as identified in the project plans. The project estimated construction cost and contract time established for the project is a follows: BASE BID: $12,635,200 160 working days ADDITIVE ALTERNATIVE “A” $325,500 15 working days TOTAL PROJECT BID (BASE BID + ADD ALT. “A”): $12,960,700 Additional working days specified for Additive Alternatives “A” will be added to the total contract duration if the respective alternative is awarded. The fixed liquidated damages amount is established at $1,500 per day for failure to complete the work within the contract time. Pursuant to Labor Code section 1720 et seq., the project is subject to the prevailing wage requirements applicable to the locality in which the work is to be performed for each craft, classification or type of worker needed to perform the work, including employer payments for health and welfare, pension, vacation, apprenticeship and similar purposes. In compliance with section 1773 of the Labor Code, the State of California Department of Industrial Relations (“DIR”) has established prevailing hourly wage rates for each type of workman. Current wage rates are on file with the City and may also be obtained from the DIR’s website at: https://www.dir.ca.gov/oprl/DPreWageDetermination.htm Each contractor and subcontractor must pay no less than the specified rates to all workers employed to work on the project. The schedule of per diem wages is based upon a working day of eight hours. The rate for holiday and overtime work must be at least time and one-half. This project is subject to compliance monitoring and enforcement by the DIR. QUALIFICATIONS You must possess a valid Class A or C12 Contractor's License at the time of the bid opening. You and any subcontractors must be registered with the DIR pursuant to section 1725.5 of the Labor Code. Subject to limited legal exceptions for joint venture bids and federally-funded projects, City may not accept a bid from a bidder without proof that the bidder is registered with the DIR to perform public work under Labor Code section 1725.5. NOTICE TO BIDDERS NOTICE TO BIDDERS iv You must have experience constructing projects similar to the work specified for this project. Provide three similar reference projects completed as either the prime or subcontractor. All referenced projects must have been completed within the last five years from this project’s bid opening date. One of the three reference projects must have been completed as prime contractor under contract with a city, county, state or federal government agency. All referenced projects must be for roadway construction/reconstruction or roadway maintenance by slurry sealing within the public right of way. Failure to provide reference projects as specified in this section and as required on the qualification form may be cause to reject a bid. The City reserves the right to reject any bid based on non-responsiveness if a bidder fails to provide a bid that complies with all bidding instructions. The City reserves the right to reject a responsive bid based on the non-responsibility of the bidder if the Director of Public Works and Utilities or Designee finds, after providing notice and a hearing to the bidder, that the bidder lacks the 1. knowledge 2. experience, 3. or is otherwise not responsible as defined in Section 3.24 of the San Luis Obispo Municipal Code to complete the project in the best interest of the City. Rejected bidders may appeal this determination. Appeal must comply with the requirements in this Notice to Bidders. It is the City of San Luis Obispo’s intent to award the contract to the lowest responsive bid submitted by a responsible bidder. If in the bidder’s opinion the contract may be improperly awarded, the bidder may protest the contract award. Only a bidder who has actually submitted a bid is eligible to submit a bid protest against another bidder. Subcontractors are not eligible to submit bid protests. A bidder may not rely on the bid protest submitted by another bidder, but must timely pursue its own protest. Protests must be filed no later than five working days after the bid opening date. Protest must be in writing and received by the project manager located at: 919 Palm Street San Luis Obispo, CA 93401. Valid protests must contain the following information: NOTICE TO BIDDERS NOTICE TO BIDDERS v 1. basis for the protest. The protest must refer to the specific portion or portions of the Contract Documents upon which the protest is based 2. all supporting documentation 3. the ruling expected by the City to remedy the protest. Any protest not containing all required information will be deemed invalid and rejected. The City will consider additional documentation or other supporting information regarding the protest if submitted in compliance with the specified time limits. Anything submitted after the specified time limit may not be considered. The Director of Public Works and Utilities or Designee may request additional information to be submitted, unless otherwise specified, and will notify the protester of ruling. If the protester is not satisfied with ruling, the protester may appeal the ruling to the City Council in compliance with Chapter 1.20 of the City of San Luis Obispo Municipal Code. The procedure and time limits set forth in this Section are mandatory and are the bidder’s sole and exclusive remedy in the event of a bid protest. A bidder’s failure to comply with these procedures will constitute a waiver of any right to further pursue a bid protest, including appeal of the ruling to the City Council, filing a Government Code Claim, or initiation of legal proceedings. City reserves the right, acting in its sole discretion, to reject any bid protest that it determines lacks merit, to award the Contract to the bidder it has determined to be the responsible bidder submitting the lowest responsive bid, and to issue a Notice to Proceed with the Work notwithstanding any pending or continuing challenge to its determination. Pursuant to the Public Records Act (Government Code § 7920.000 et seq.), the City will make public records available upon request. AWARD The lowest bidder will be determined in compliance with Public Contract Code Section 20103.8(c) with the Publicly Disclosed Funding Amount of $12,960,700 using either: TOTAL PROJECT BID, if bid for Base Bid + Add. Alt. “A” is less than $12,960,700 or BASE BID, if Base Bid is less than $12,960,700 and Base Bid + Add. Alt. “A” is greater than $12,960,700. As a condition to executing a contract with the City, a payment bond and performance bond each equal to one hundred percent of the total contract price are required in compliance with Section 3-1.05 of the Standard Specifications. Each bond must be issued and executed by a surety admitted in California. NOTICE TO BIDDERS NOTICE TO BIDDERS vi You may substitute securities in lieu of retention under the contract in compliance with the provisions of the Public Contract Code § 22300. ACCOMMODATION If any accommodations are needed to participate in the bid process, please contact Kelly Paonessa at (805) 781-7274 or by Telecommunications Device for the Deaf at (805) 781- 7107. Requests should be made as early as possible in the bidding process to allow time for accommodation. BID FORMS A BID FORMS All bid forms must be completed and submitted with your bid. Failure to submit these forms and required bid guaranty (bid bond, cashier’s check, or certified check) may be cause to reject the bid as nonresponsive. Staple all bid forms together. THE UNDERSIGNED, agrees that they have carefully examined: 1. the location of the proposed work 2. the plans and specifications 3. read the accompanying instructions to bidders and propose to furnish all: 1. materials 2. labor to complete all the required work satisfactorily in compliance with 3. plans 4. specifications 5. special provisions for the prices set forth in the bid item list: BID ITEM LIST FOR HIGUERA CORRIDOR COMPLETE STREETS PROJECT, SPECIFICATION NO. 2001057 Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) BASE BID ITEMS 1 7,12 TEMPORARY TRAFFIC CONTROL PLAN AND IMPLEMENTATION LS 1 ---------- 2 5,19 CONSTRUCTION SURVEYING AND SITE GRADING LS 1 ---------- 3 12 TEMPORARY STRIPING AND PAVEMENT MARKINGS LS 1 ---------- 4 20 LANDSCAPE REPLACEMENT AND IRRIGATION RESTORATION LS 1 ---------- 5 7 COMPLY WITH NIGHT WORK PERMIT LS 1 ---------- 6 3 COMPLY WITH CALTRANS ENCROACHMENT PERMIT LS 1 ---------- 7 7 CONTRUCTION PHASING PLAN (HIGUERA/MADONNA & HIGUERA/LOVR INTERSECTIONS) LS 1 ---------- 8 20 TREE TRIMMING LS 1 ---------- 9 37 TYPE II SLURRY SEAL SQYD 106,316 10 15 BIKE LANE EDGE GRIND LS 1 ---------- 11 37 STREET SWEEPING IN SLURRY AREAS (1 DAY) LS 1 ---------- BID FORMS BID FORMS B Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 12 37 STREET SWEEPING IN SLURRY AREAS (30 DAYS) LS 1 ---------- 13 39 HOT MIX ASPHALT (3/8", 1/2" AND 3/4") TON 7,185 14 15,39 3" COLD PLANE SQYD 28,299 15 15,39 10" COLD PLANE SQYD 3,177 16 39, 96 PAVING GRID SQYD 31,476 17 39,73 CONCRETE BASE REPAIR SQFT 1,470 18 73 CONSTRUCT CONCRETE MEDIAN SQFT 47 19 73 CONSTRUCT CURB TYPE B1‐6 LF 287 20 73 CONSTRUCT CURB AND GUTTER LF 1,034 21 73 CONSTRUCT MODIFIED CURB TYPE D‐6 WITH 2' GUTTER LF 154 22 73 CONSTRUCT CURB LF 2,074 23 73 CONSTRUCT CONCRETE SIDEWALK SQFT 12,766 24 73 PARTIALLY RECONSTRUCT DRIVEWAY SQFT 190 25 73 CONSTRUCT MODIFIED EXPANDED GUTTER AREA SQFT 480 26 73 CURB RAMP EA 60 27 73 BIKE RAMP EA 5 28 77 GUTTER UNDERDRAIN SQFT 106 29 73 CONSTRUCT CROSS GUTTER AND SPANDREL SQFT 7,938 30 73 INSTALL COBBLE SQFT 1,837 31 73 STAMPED CONCRETE (AT NONWALKABLE AREAS OF CURB RAMPS) SQFT 197 32 39 INSTALL AC ROAD BUMP EA 6 33 39 CONSTRUCT SPEED TABLE CROSSING EA 1 34 86 INSTALL SOLAR PATH LIGHTING EA 2 35 15 REPLACE DETECTABLE WARNING SURFACE SQFT 691 36 77 RELOCATE FIRE HYDRANT EA 4 37 77 RECONSTRUCT SIDEWALK DRAIN EA 2 38 15 ADJUST TO GRADE TS PULL BOX EA 12 BID FORMS BID FORMS C Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 39 15 ADJUST TO GRADE COMM PULL BOX EA 4 40 15 ADJUST TO GRADE ELECTRICAL PULL BOX EA 7 41 15 RELOCATE ELECTRICAL PULL BOX EA 1 42 15 ADJUST TO GRADE VALVE EA 51 43 15 ADJUST TO GRADE MANHOLE EA 15 44 77 REPLACE WATER METER EA 6 45 5,15 RESET MONUMENT EA 3 46 5,15 RESET BENCHMARK EA 1 47 15 REMOVE TS PULL BOX EA 3 48 86 TRAFFIC SIGNAL MODIFICATIONS @ LOS OSOS VALLEY RD LS 1 ---------- 49 86 TRAFFIC SIGNAL MODIFICATIONS @ SUBURBAN RD LS 1 ---------- 50 86 TRAFFIC SIGNAL MODIFICATIONS @ GRANADA DR LS 1 ---------- 51 86 TRAFFIC SIGNAL MODIFICATIONS @ MARGARITA AVE LS 1 ---------- 52 86 TRAFFIC SIGNAL MODIFICATIONS @ MADONNA/HIGUERA LS 1 ---------- 53 86 TRAFFIC SIGNAL MODIFICATIONS @ SOUTH ST LS 1 ---------- 54 86 TRAFFIC SIGNAL MODIFICATIONS @ HIGH ST/PISMO ST LS 1 ---------- 55 86 TRAFFIC SIGNAL MODIFICATIONS @ MARSH ST LS 1 ---------- 56 86 TRAFFIC SIGNAL MODIFICATIONS @ MADONNA NB ON/OFF RAMP LS 1 ---------- 57 86 TRAFFIC SIGNAL MODIFICATIONS @ MADONNA SB ON/ OFF RAMP LS 1 ---------- 58 8,86 INSTALL RRFB AT EXPOSITION DRIVE LS 1 ---------- BID FORMS BID FORMS D Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 59 8,86 INSTALL RRFB AT HIGUERA/PACIFIC LS 1 ---------- 60 86 TRAFFIC SIGNAL INSTALLATION @ ELKS/ HIGUERA LS 1 ---------- 61 84 BIKE LANE PAVEMENT MARKING WITH ARROW SQFT 819 62 84 GREEN‐BACKED SHARROW PAVEMENT MARKING EA 10 63 84 "STOP" PAVEMENT MARKING SQFT 264 64 84 "CLEAR" PAVEMENT MARKING SQFT 135 65 84 "KEEP" PAVEMENT MARKING SQFT 120 66 84 "HUMP" PAVEMENT MARKING SQFT 350 67 84 "NORTH" PAVEMENT MARKING SQFT 31 68 84 12" STOP LINE PAVEMENT MARKING LF 1,150 69 84 YIELD LINE SQFT 36 70 84 HIGH VISIBILITY CROSSWALK SQFT 19,069 71 84 BIKE BUFFER LF 14,862 72 84 8" YELLOW STRIPE AT 45 ANGLE WITHIN LIMITS OF PAINTED MEDIAN,15' O.C. LF 1,379 73 84 6" WHITE STRIPE LF 133 74 84 4" WHITE STRIPE LF 2,028 75 84 DETAIL 9 LF 15,069 76 84 DETAIL 22 LF 5,751 77 84 DETAIL 25 LF 1,520 78 84 DETAIL 29 LF 3,768 79 84 DETAIL 32 LF 10,159 80 84 DETAIL 37B LF 683 81 84 DETAIL 38 LF 7,322 82 84 DETAIL 39 LF 299 83 84 DETAIL 39A LF 224 84 84 DETAIL 40 LF 886 85 84 DETAIL 40A LF 494 86 84 DETAIL 41 LF 155 87 84 DETAIL 41A LF 195 BID FORMS BID FORMS E Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 88 84 GREEN BIKE LANE MARKINGS CASE 1 SQFT 25,088 89 84 GREEN BIKE LANE MARKINGS CASE 2 LF 2,799 90 84 GREEN BIKE LANE MARKINGS CASE 3 LF 6,373 91 84 TWO‐STAGE BICYCLE TURN BOX EA 7 92 84 REFRESH BIKE LOOP LEGEND SQFT 4 93 84 GREENWAY PAVEMENT MARKING EA 24 94 84 SPEED HUMP PAVEMENT MARKING SQFT 336 95 84 BIKE DIRECTIONAL SYMBOL EA 4 96 84 ARROW PAVEMENT MARKING SQFT 3,130 97 84 RED CURB LF 727 98 84 YELLOW CURB LF 30 99 84 CHEVRON MARKING LF 72 100 84 6" YELLOW DIRECTIONAL GUIDE STRIP LF 83 101 82 TYPE K‐1 OBJECT MARKER EA 1 102 82 YELLOW PEXCO CITY POST MODEL EAC, 36" WITH TWO YELLOW RETROREFLECTIVE WRAPS, 5' O.C. EA 29 103 82 WHITE PEXCO CITY POST MODEL EAC, 36" WITH TWO GRAY RETROREFLECTIVE WRAPS EA 631 104 82 REMOVABLE BOLLARD EA 18 105 82 OFFSET BRICK PATTERN AT HIGUERA ST/WALKER ST (COLOR PER PLANS) SQFT 1,641 106 82 STRIPING REMOVAL ON PCC SURFACE AND TREATED WITH METHACRYLATE SQFT 20,793 107 82 GREENWAY DIRECTIONAL PLAQUE EA 4 108 82 SPEED FEEDBACK SIGN EA 3 109 82 INSTALL (N) 12' PUNCH POST EA 120 110 82 INSTALL (N) 14' PUNCH POST EA 3 111 82 GREENWAY SIGN EA 22 BID FORMS BID FORMS F Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 112 82 REMOVE AND REINSTALL (E) R1‐ 1 SIGN (N POST) EA 2 113 82 REMOVE AND REINSTALL (E) STREET NAME SIGNS (N POST) EA 16 114 82 REMOVE AND REINSTALL (E) R1‐ 1 AND STREET NAME SIGNS (N POST) EA 1 115 82 REMOVE AND REINSTALL (E) W4‐2 SIGN (N POST) EA 2 116 82 R1‐1 (TRAIL) SIGN EA 3 117 82 R1‐1 SIGN EA 3 118 82 R1‐5 SIGN EA 2 119 82 R3‐2 SIGN EA 3 120 82 R3‐7R SIGN EA 2 121 82 R4‐1 SIGN EA 1 122 82 R4‐4 SIGN EA 3 123 82 R4‐7 SIGN EA 6 124 82 R5‐1 SIGN EA 4 125 82 R5‐3 SIGN EA 2 126 82 R10‐6 SIGN EA 2 127 82 R26(CA) SIGN EA 5 128 82 R26(S) SIGN EA 1 129 82 R81(CA) SIGN EA 15 130 82 W4‐2 SIGN EA 1 131 82 W9‐1 SIGN EA 1 132 82 W11‐2 SIGN EA 4 133 82 W11‐15 SIGN EA 2 134 82 W14‐1 SIGN EA 1 135 82 W17‐1 SIGN EA 14 136 82 N‐2(CA) SIGN EA 8 137 82 R2‐1(30) SIGN EA 1 138 82 R6‐1R SIGN EA 1 139 82 TYPE K‐1 SIGN EA 6 140 82 W16‐7P SIGN EA 6 141 82 R2‐1(35) SIGN EA 2 142 82 R2‐1(40) SIGN EA 1 BID FORMS BID FORMS G Item Item Unit of Estimated Item Price Total No. SS(1) Description Measure Quantity (in figures) (in figures) 143 82 REMOVE AND REINSTALL (E) R1‐ 1 SIGN (EX POST) EA 11 144 82 REMOVE AND REINSTALL (E) R2‐ 1 SIGN (EX POST) EA 1 145 82 REMOVE AND REINSTALL (E) 14‐ 1 SIGN (EX POST) EA 1 146 82 REMOVE AND REINSTALL (E) R26(CA) SIGN (EX POST) EA 4 147 82 REMOVE AND REINSTALL (E) R26(S) SIGN (EX POST) EA 1 148 82 REMOVE AND REINSTALL (E) STREET NAME SIGNS (EX POST) EA 2 149 82 REMOVE AND REINSTALL (E) W4‐2 SIGN (EX POST) EA 2 150 82 STREET NAME SIGN (SIGNAL PLANS) EA 2 151 82 R10‐11 SIGN (SIGNAL PLANS) EA 2 152 82 R10‐15C SIGN (SIGNAL PLANS) EA 2 153 82 R49 (SIGNAL PLANS) EA 1 154 82 R3‐2 SIGN (SIGNAL PLANS) EA 1 155 82 REMOVE AND REINSTALL (E) STREET NAME SIGNS (SIGNAL PLANS) EA 2 156 82 REMOVE AND REINSTALL (E) REGULATORY SIGNS (SIGNAL PLANS) EA 1 Base Bid $ ADDITIVE ALTERNATIVE A BID ITEMS 157 7,12 TEMPORARY TRAFFIC CONTROL PLAN AND IMPLEMENTATION LS 1 ---------- 158 73 PRECAST CONCRETE CURB LF 2,368 159 82 WHITE PEXCO CITY POST MODEL EAC, 36" WITH TWO GRAY RETROREFLECTIVE WRAPS EA 59 160 82 OMIT BASE BID WHITE PEXCO POSTS EA ‐119 Additive Alternative A $ Total Project Bid = (Base Bid + Add. Alternative A) $ Company Name: (1) refers to section in the Standard Specifications, with modifications in the Special Provisions, that describe required work. BID FORMS BID FORMS H LIST OF SUBCONTRACTORS Pursuant to Section 4100 of the Public Contract Code and section 2-1.33C of the standard specifications, the Bidder is required to furnish the following information for each Subcontractor performing more than 1/2 percent (0.5%) of the total base bid. Do not list alternative subcontractors for the same work. Subcontracting must not total more than fifty percent (50%) of the submitted bid except as allowed in section 5-1.13 of the standard specifications. For Streets & Highways projects, subcontractors performing less than ten thousand dollars ($10,000) worth of work need not be mentioned. Subcontractors must be registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5 to be listed. NOTE: If there are no subcontractors, write “NONE” and submit with bid. Name Under Which Subcontractor is Licensed License Number DIR Public Works Registration Number Address and Phone Number of Office, Mill or Shop Specific Description of Subcontract % of Total Base Bid Attach additional sheets as needed. BID FORMS BID FORMS I LABOR CODE SECTION 1725.5 STATEMENTS The bidder has delinquent liability to an employee or the state for any assessment of back wages or related damages, interest, fines, or penalties pursuant to any final judgment, order, or determination by a court or any federal, state, or local administrative agency, including a confirmed arbitration award. Any judgment, order, or determination that is under appeal is excluded, provided that the contractor has secured the payment of any amount eventually found due through a bond or other appropriate means. Yes No The bidder is currently debarred under Section 1777.1 or under any other federal or state law providing for the debarment of contractors from public works. Yes No NOTE: The above Statements are part of the Bid. Signing this Bid on the signature portion constitute signature of this Statement. Bidders are cautioned that making a false certification may subject the certifier to criminal prosecution. BID FORMS BID FORMS J NONCOLLUSION DECLARATION TO BE EXECUTED BY BIDDER AND SUBMITTED WITH BID The undersigned declares: I am the ____________________ [title] of _____________________________________ [business name], the party making the foregoing bid. The bid is not made in the interest of, or on behalf of, any undisclosed person, partnership, company, association, organization, or corporation. The bid is genuine and not collusive or sham. The bidder has not directly or indirectly induced or solicited any other bidder to put in a false or sham bid. The bidder has not directly or indirectly colluded, conspired, connived, or agreed with any bidder or anyone else to put in a sham bid, or to refrain from bidding. The bidder has not in any manner, directly or indirectly, sought by agreement, communication, or conference with anyone to fix the bid price of the bidder or any other bidder, or to fix any overhead, profit, or cost element of the bid price, or of that of any other bidder. All statements contained in the bid are true. The bidder has not, directly or indirectly, submitted his or her bid price or any breakdown thereof, or the contents thereof, or divulged information or data relative thereto, to any corporation, partnership, company, association, `organization, bid depository, or to any member or agent thereof, to effectuate a collusive or sham bid, and has not paid, and will not pay, any person or entity for such purpose. Any person executing this declaration on behalf of a bidder that is a corporation, partnership, joint venture, limited liability company, limited liability partnership, or any other entity, hereby represents that he or she has full power to execute, and does execute, this declaration on behalf of the bidder. I declare under penalty of perjury under the laws of the State of California that the foregoing is true and correct and that this declaration is executed on _______________ [date], at __________________________________ [city], _______ [state]. s/________________________________________ __________________________________________ Name [print] BID FORMS BID FORMS K BIDDER ACKNOWLEDGEMENTS By signing below, the bidder acknowledges and confirms that this bid is based on the information contained in all contract documents, including the notice to bidders, plans, specifications, special provisions, and addendum number(s) . (Note: You are responsible to verify the number of addenda prior to the bid opening.) The undersigned further agrees that in case of default in executing the required contract, with necessary bonds, within ten days, (not including Saturdays, Sundays, and legal holidays), after having received a mailed notice that the contract is ready for signature, the proceeds of the check or bond accompanying his bid will become the property of the City of San Luis Obispo. Licensed in accordance with an act providing for the registration of contractors, License No. , Expiration Date . The above statement is made under penalty of perjury, and any bid not containing this information may be considered non-responsive and may be rejected by the City. Signature of Bidder (Print Name and Title of Bidder) DIR– Public Works Registration No: Business Name (DBA): Owner/Legal Name: Indicate One: Sole-proprietor Partnership Corporation List Partners/Corporate Officers: Name Title Name Title Name Title Business Address Street Address Mailing Address City, State, Zip Code Phone Number Fax Number Email Address Date BID FORMS BID FORMS L QUALIFICATIONS Failure to furnish complete reference information ON THIS FORM, as specified in this project’s Notice to Bidders and indicated below, may be cause to reject the bid. Additional information may be attached but is not a substitute for this form. Reference Number 1 Customer Name & Contact Individual Telephone & Email Project Name (Site Address): Did this project include roadway construction or roadway maintenance by slurry sealing within public ROW? Yes □ No □ Describe the services provided and how this project is similar to that which is being bid: Date project completed: Was this contract for a public agency? Yes □ No □ Reference Number 2 Customer Name & Contact Individual Telephone & Email Project Name (Site Address): Did this project include roadway construction or roadway maintenance by slurry sealing within public ROW? Yes □ No □ Describe the services provided and how this project is similar to that which is being bid: Date project completed: Was this contract for a public agency? Yes □ No □ Reference Number 3 Customer Name & Contact Individual Telephone & Email Project Name (Site Address): Did this project include roadway construction or roadway maintenance by slurry sealing within public ROW? Yes □ No □ Describe the services provided and how this project is similar to that which is being bid: Date project completed: Was this contract for a public agency? Yes □ No □ BID FORMS BID FORMS M ATTACH BIDDER'S BOND TO ACCOMPANY BID Know all men by these presents: That we ____________________________________________, AS PRINCIPAL, and _______________________________________________________, AS SURETY, are held and firmly bound unto the City of San Luis Obispo in the sum of: ____________________________________________________ Dollars (_____________) to be paid to said City or its certain attorney, its successors and assigns; for which payment, well and truly to be made, we bind ourselves, our heirs, executors and administrators, successors or assigns, jointly and severally, firmly by these presents: THE CONDITION OF THIS OBLIGATION IS SUCH, that if the certain bid of the above bounden ______________________________________________________________________ to construct ___________________________________________________________________ (insert name of street and limits to be improved or project) dated _____________________ is accepted by the City of San Luis Obispo, and if the above bounden _______________________________________________________, his heirs, executors, administrators, successors, and assigns shall duly enter into and execute a contract for such construction and shall execute and deliver the two bonds described within ten (10) days (not including Saturdays, Sundays, or legal holidays) after the above bounden, ______________________________________________________, has received notice by and from the said City of San Luis Obispo that said contract is ready for execution, then this obligation shall become null and void; otherwise, it shall be and remain in full force and virtue. IN WITNESS WHEREOF, we hereunto set our hands and seals this ___ day of ______, 20____. Bidder Principal: Signature Date Title: Surety: Bidder's signature is not required to be notarized. Surety's signature must be notarized. Equivalent form may be substituted (Rev. 6-30-14) SPECIAL PROVISIONS 1 SPECIAL PROVISIONS ORGANIZATION Special provisions are under headings that correspond with the main section heading of the Standard Specifications. Each special provision begins with a revision clause that describes or introduces a revision to the Standard Specifications. Any paragraph added or deleted by a revision clause does not change the paragraph number of the Standard Specifications for any other reference to a paragraph of the Standard Specifications. DIVISION I GENERAL PROVISIONS 1 GENERAL Add to Section 1-1.01 GENERAL: The work must be done in compliance with the City of San Luis Obispo, Department of Public Works and Utilities: 1. Higuera Corridor Complete Streets Project Special Provisions 2. City of San Luis Obispo Standard Specifications and Engineering Standards – 2025 edition 3. State of California, Department of Transportation Standard Specifications and Standard Plans – 2024 edition In case of conflict between documents, governing ranking must comply with section 5- 1.02 of the City of San Luis Obispo’s Standard Specifications. Failure to comply with any obligation under the contract documents constitutes a breach of contract. Add to Section 1-1.07 DEFINITIONS, Glossary: Contract Documents: The executed Contract, including the component parts listed in Article III of the Agreement. 3 CONTRACT AWARD AND EXECUTION Add Section 3-1.18B CONTRACT EXECUTION, Caltrans Encroachment Permit: The City applied for an encroachment permit from the State of California, Department of Transportation for work within and affecting Caltrans public right of way along Madonna Road. The Contractor is required to obtain a rider permit, comply with all conditions, and pay all associated fees. See Caltrans encroachment permit requirements (Appendix D) and General Notes on Sheet 2 of Construction plans for additional requirements within the State Right of Way. Compliance with Caltrans Encroachment permit and traffic control shall conform to the provisions of Section 12 “Temporary Traffic Control”, of the Standard Specifications and these Special Provisions. SPECIAL PROVISIONS SPECIAL PROVISIONS 2 Note that Caltrans does not participate in underground service alerts. Contractor must coordinate with Caltrans to locate existing underground facilities within the Caltrans right- of-way. Measurement and Payment The lump sum contract price paid to comply with Caltrans Encroachment Permit shall include full compensation for furnishing all labor, materials, tools, equipment, personnel, and for doing all the work involved to comply with all Caltrans encroachment permit requirements. 4 SCOPE OF WORK Add to Section 4-1.03 WORK DESCRIPTION: Comply with the provisions of Sections 3, 5, 7, 9, 12, 13, 15, 19, 20, 26, 37, 39, 73, 82, 84,and 86 for general, material, construction, and payment specifics. Add Section 4-1.03A WORK DESCRIPTION, Project Specific Signage: Maintain Revenue Enhancement Funding (“Sales Tax”) signage in work area. Return Sales Tax signs at the end of the project or upon the Engineer’s request. The Engineer will furnish Sales Tax signs mounted to moveable Barricades. Maintain Sales Tax signage in work area. Return Sales Tax signs at the end of the project or upon the Engineer’s request. Sales Tax signs are stored at the City’s corporation Yard at Prado Road. The Contractor is responsible to load and transport from City Corporation Yard to job site and return them when the project is completed under direction of project inspector. 5 CONTROL OF WORK Add to Section 5-1.24A CONSTRUCTION SURVEYS, General: The Contractor shall retain a licensed land surveyor to research record maps and locate all existing survey monuments within the limits of work and all areas to be disturbed. Work shall include identification and verification of property corners, right-of-way monuments, control monuments, and benchmarks. Special attention shall be given to existing benchmarks and property corners. All located monuments shall be documented, referenced, and protected from disturbance during construction. Any monument disturbed or removed shall be reset by a licensed land surveyor in accordance with applicable regulations and with prior approval of the Engineer. Payment for this work is included in the lump sum item for Construction Survey. No separate or additional compensation will be allowed. SPECIAL PROVISIONS SPECIAL PROVISIONS 3 6 CONTROL OF MATERIALS Add to Section 6-2.03A DEPARTMENT ACCEPTANCE, General: The Engineer will furnish one (1) GREEN WAY SYMBOL stencil as detailed in the project plans. Contractor can obtain additional stencil(s) at its own discretion and must be approved by the Engineer prior to use for this project. 7 LEGAL RELATIONS AND RESPONSIBILITY TO THE PUBLIC Add to Section 7-1.03B PUBLIC CONVENIENCE, Traffic Control Plan WORK HOUR RESTRICTIONS Unless stated otherwise below, work hours are 7:00 a.m. to 4:00 p.m. (Monday through Friday) at all the affected streets. WORK IN CALTRANS RIGHT-OF-WAY Unless otherwise approved by Caltrans and the Engineer, work within Caltrans right-of- way that restricts or closes any traffic lane or shoulder/bike lane must be performed during nighttime work hours. See further below for Night Work requirements. Work that does not restrict or close any traffic lane or shoulder within Caltrans right-of- way may be performed between the hours of 9:00 a.m. to 3:00 p.m. (Monday through Thursday) and 9:00 a.m. to 2:00 p.m. on Fridays. WORK ON HIGUERA STREET AND MADONNA ROAD Unless otherwise approved by the Engineer, the Contractor shall assume that the following work must be performed during nighttime work hours: Work that requires traffic lane closures for two consecutive hours or more on Higuera Street between Los Osos Valley Road and Tank Farm Road, or on Madonna Road outside of Caltrans right-of-way Work that requires signalized intersections to operate in red flash for one hour or more on Higuera Street or Madonna Road Turn-on for the new traffic signal at the Higuera Street/Elks Lane intersection. See further below for Night Work requirements. CONSTRUCTION PHASING PLAN The Contractor must provide a high-level Construction Phasing Plan for the full project, showing general order of work and anticipated schedule for each phase of construction. SPECIAL PROVISIONS SPECIAL PROVISIONS 4 A detailed Construction Phasing Plan must be provided for work at (a) the Madonna Road/Higuera Street intersection and (b) the Los Osos Road/Higuera Street intersection. The plan must describe each construction phase, including sequencing, limits of work, and duration, traffic signal modification sequencing, and must explain how vehicle traffic, pedestrians, and bicycles will be safely maintained through the intersection. The plan must show any lane closures, detours, temporary striping, temporary traffic signal systems needed, access provisions, ADA-compliant pedestrian routing, and coordination needs with businesses, transit, utilities, and emergency services. It must be consistent with the Contractor’s Traffic Control Plans and the California MUTCD. The Contractor must update the plan when conditions change, obtain approval before implementing revisions, and adhere to the approved phasing throughout construction. Unless otherwise approved, the Contractor must submit the Construction Phasing Plans to the Engineer at the preconstruction meeting. CURB RAMPS Where curb ramp improvements are proposed at multiple corners of the intersection, the contractor shall provide a phasing plan showing schedule for demolition and construction of ramps in a manner that retains pedestrian access on at least one side of the street at all times. The construction phasing approach for these ramps shall be approved to the satisfaction of the Engineer. CHANGEABLE MESSAGE SIGNS For each roadway segment (Madonna and Higuera), two (2) changeable message signs (CMS) must be installed and operational 1 week prior to the start of construction and be maintained throughout the duration of the project at locations approved by the Engineer upon review of the submitted Traffic Control Plan. Changeable message sign shall be programmed for two flashes with the messages to be approved by the Engineer. NIGHT WORK Night work is permitted separately. Night work shall comply with the restrictions set forth in the permit by the City of San Luis Obispo Community Development. It is the Contractor’s responsibility to monitor the Night Work Permit expiration date. Requests to extend the Night Work Permit must be submitted to the Engineer at least 5 weeks before the permit expires. Failure by the contractor to request an extension in time, resulting in delays, will be the contractor’s responsibility, and no additional compensation or extra working days will be granted. Night work is defined as work on Monday through Thursday between the hours of 9:00 p.m. to 6:00 a.m. The Contractor must not work two consecutive shifts, day and night, unless approved by the Engineer. SPECIAL PROVISIONS SPECIAL PROVISIONS 5 Prior to commencing the project, the Contractor must notify businesses and residences within 300 feet of the worksite about proposed night work. Any portable or fixed equipment that produces noise (such as generators, concrete saws, jack hammers, etc.) must be equipped with sound blankets, temporary sound barriers, or other attenuating devices so as to limit impacts to adjoining properties. When not in use, equipment must be kept in its lowest (quietest) idling state or switched off to limit noise impacts. Any portable lighting must be shielded and/or directed away from adjacent properties. Loudspeakers or other similar forms of communication is prohibited. Contractor will provide lighting for all operations, no exceptions are to be made. Any contractor personnel working outside the lights will be directed to return to a lighted area or the operation must be stopped. All contractor work vehicles, including heavy equipment, backhoes, trenching machines must have two working headlights and taillights. Vehicles without appropriate lighting will be kept from working until they are brought to compliance. Illumination level of 10-foot candles is required for all nighttime operations, which will normally be achieved with light plants or balloon lights. All lighting fixtures must be mounted and directed in manner precluding glare to approaching traffic. TRAFFIC CONTROL PLAN Provide traffic control plan and traffic control application at or before the preconstruction meeting. Traffic control plan must be drawn to scale. Traffic control application may be obtained on the City’s website: www.slocity.org/government/department-directory/public-works/documents- online/construction-documents Upon approval of the traffic control plan, the City will issue a no-fee Encroachment Permit. Permittee is responsible to comply with all conditions of the traffic control plan. Complete work using due diligence to restore free flowing of traffic. 8 PROSECUTION AND PROGRESS Add Section 8-1.01A GENERAL, Order of Work: TRAFFIC SIGNAL INSTALLATION Below is the method for procurement and installation of traffic signal equipment, unless otherwise approved by the Engineer. SPECIAL PROVISIONS SPECIAL PROVISIONS 6 1. Contractor will provide traffic signal equipment submittals for City approval at the time of the preconstruction meeting. 2. As the first order of work, Contractor will pothole at locations of all new traffic signal poles in the field to confirm any underground utility conflicts. Contractor will provide potholing findings to the Engineer to identify any existing underground utilities that would conflict with proposed new signal pole/foundations. 3. Following review of potholing results, the City will provide any comments on traffic signal equipment submittals. Following City approval of equipment submittals, Contractor will place order for signal equipment and provide documentation to City verifying estimated delivery date. 4. To accelerate the opportunity for PG&E scheduling for new electrical service to the traffic signal at Higuera Street/Elks Lane, as the next order of work, Contractor will install electrical service enclosure and related substructure between service pedestal and PG&E point of service. Contractor will use City-furnished service pedestal for this installation. See Appendix E for PG&E Construction Drawing. Contractor remains responsible for purchasing new service enclosure to deliver to City signal shop (25 Prado Road) to replenish inventory. Payment for the new service enclosure is included in the lump sum item for traffic signal installation at Elks and Higuera. 5. If the Contractor has completed all work that can be reasonably completed without receipt of traffic signal equipment to the satisfaction of the Engineer, the project will be placed on suspension. Contract time will restart on the manufacturer- provided delivery date of traffic signal equipment. 6. Contractor must provide new traffic signal controller(s) to City for programming and provide 3 weeks minimum notice prior to scheduling new controller installation and/or turn-on for the new Higuera Street/Elks Lane traffic signal. Contractor must arrange to have the traffic controller manufacturer’s (McCain/SWARCO) representative present at the time of traffic controller installation and system turn-on. Contractor is responsible for coordinating City staff, vendors, manufacturers, and Utilities representatives as needed. New traffic signal system turn-on and testing must be conducted on Tuesday, Wednesday or Thursday as night work (see hours above). If new traffic signal system is malfunctioning or not yet functioning under intended operations by 7:00 a.m. vehicle and pedestrian signal indicators and push buttons must be bagged until system is operational, unless otherwise approved by the Engineer. SPECIAL PROVISIONS SPECIAL PROVISIONS 7 7. Contractor must install Accessible Pedestrian Signal (APS) pedestrian push buttons (PPB) on the signal poles as shown on the Construction Plans and specified in these Special Provisions. Contractor must fill out order forms and audible message forms and submit to City as a submittal with all other signal equipment. Contractor will allow up to ten (10) working days for audible message order forms to be processed/verified by the City. New pedestrian push buttons must be covered until operational, unless otherwise approved. 8. Following new traffic signal system turn-on, install radio and CCTV camera and establish wireless video service and wireless signal interconnect per Construction Plans. Contractor must obtain an IP Address from the City and program said radio antenna(s). Contractor must verify communications between traffic signal controller and City’s Transparity signal management system. Contact vendors for necessary support and test connections to each radio antenna. 9. Install Battery Backup Systems (BBS) at the electrical service pedestal UPS system at the new Higuera Street/Elks Lane traffic signal. Contractor must confirm with City that all batteries are charged and connected to BBS. 10. Unless otherwise approved, contractor must arrange to have the emergency vehicle preemption system manufacturer’s (Miovision/Opticom) representative available to assist with installing, programming, and testing emergency vehicle preemption equipment. RECTANGULAR RAPID FLASHING BEACON (RRFB) INSTALLATION Below is the required sequence of work for installation of Rapid Rectangular Flashing Beacon systems, signs and striping, unless otherwise approved by the Engineer. 1. All new pedestrian/bicycle crossing signage installed with RRFB systems shall remain covered until beacon systems are installed and operational, and crosswalk markings have been installed. 2. Unless otherwise approved by the Engineer, crossing pavement markings, including crosswalks and advance yield markings, shall not be installed until beacon system(s) are installed and operational. 3. Contractor must furnish and install all equipment needed for intended operation of RRFB system. Contractor shall provide beacon system equipment submittals for City review and approval prior to procurement. 4. Contractor is responsible for coordination with beacon system manufacturer’s representative(s) as needed to provide intended operation of beacon systems. VERTICAL ELEMENTS FOR BIKEWAY SEPARATION Unless otherwise approved by the Engineer, all vertical elements used for on-street bike lane separation, including flex posts and/or raised concrete medians, must be install after SPECIAL PROVISIONS SPECIAL PROVISIONS 8 final roadway pavement markings have been installed. Vertical bikeway elements must be marked in the field and approved by the Engineer prior to installation. Replace the 1st paragraph in Section 8-1.02A SCHEDULE, General with: Provide a Level 1 schedule for this work. A one week look ahead schedule shall be provided to the Engineer before commencing the following week’s work. This requirement shall be completed in order to continue construction work. Add to Section 8-1.04B START OF JOB SITE ACTIVITIES, Standard Start: Contractor must provide traffic signal equipment submittals for City review at pre- construction meeting. No more than 10 working days following City approval of equipment submittals, Contractor will place order for equipment and provide documentation to City verifying purchase and estimated delivery date. DIVISION II GENERAL CONSTRUCTION 12 TEMPORARY TRAFFIC CONTROL Add to Section 12-6.01 TEMPORARY PAVEMENT DELINEATION, General: You will be assessed Liquidated Damages in the amount of $500 per calendar day for each day’s failure to complete temporary striping and pavement markings. Prior to removal of existing pavement markings, Contractor shall confirm with the Engineer if temporary pavement delineation must conform with existing roadway lane configurations or with proposed new roadway lane configurations (where applicable). Replace Section 12-6.04 PAYMENT with: The lump sum price paid for “Temporary Striping and Pavement Markings” include payment for the following: Removal of traffic stripes and pavement markings Temporary striping and pavement markings to match existing/proposed lane configuration after existing traffic stripes and pavement markings have been removed. Temporary striping and pavement markings to match existing/proposed lane configuration after the application of slurry sealing or new asphalt pavement until permanent pavement markings are installed. 13 WATER POLLUTION CONTROL Add to Section 13-7.02C STREET SWEEPING, Construction: Street sweeping shall be performed 24 hours and 30 days after application of Type II slurry seal. The Contractor must post streets for no parking in advance and during the 24 hour and 30-day street sweeping. The Contractor must submit a street sweeping schedule for approval by the Engineer. Street sweeping must be done in a manner that street parking is available within 600 ft from affected addresses, unless approved by the Engineer. SPECIAL PROVISIONS SPECIAL PROVISIONS 9 Replace Section 13-7.02D STREET SWEEPING, Payment with: The lump sum item price for Street Sweeping shall include full compensation for furnishing all labor, materials, tools, equipment, personnel, “No Parking” notices, door hangers, and incidentals, and for doing all the work involved with Street Sweeping and no additional compensation therefor. 15 EXISTING FACILITIES Add Section 15-1.03D CONSTRUCTION, Edge Grind: Contractor must edge grind the existing bike lane pavement adjacent to the gutter and at all existing curb ramps where slurry treatment occurs. Edge grinding must be performed using micro-milling machines or approved equal. Grinding must remove vertical lips and eliminate height differentials between adjacent surfaces, producing a smooth, flush transition. Edge grinding at curb ramps must be the greater of the following: From beginning to end of curve return and bulbouts. Extend 10 feet, measured perpendicularly beyond the curb ramp landing in both directions. Micro-milling machines shall: Be equipped with a micro-milling drum with tungsten-carbide-tipped cutting teeth spaced no greater than ¼ inch apart on center. The configuration of the teeth shall be such that the deviation in elevation between any 2 teeth does not exceed 1/16 inch. Be capable of removing asphalt concrete pavement to a tolerance of +/- 1/8 inch. Be equipped with an automatic grade control system operating in “profile” mode. Micro-milling shall result in a grid-patterned textured pavement surface with longitudinal ridges approximately the same distance apart as the cutting teeth. The ridges shall be consistent in depth, width, and profile. The distance between the top of the ridge and the adjacent valleys shall not exceed 1/8 inch. Add Section 15-1.03E CONSTRUCTION, Loop Detectors: Existing traffic signal detection loops will be affected during construction—traffic signal conduits are also often very shallow, do not sawcut over conduits. Loops must be located and replaced per State Standard ES-5A & ES-5B as shown on the plans. Loop Detectors must be replaced “in-kind”, unless otherwise shown on the plans. Traffic loop detectors shown on the plans are only a schematic representation. It is the Contractor’s responsibility to verify the actual locations. For intersections under the City’s jurisdiction, the Contractor must coordinate with the City Traffic Signal Technician to temporarily modify the traffic signal controller programming to place traffic signal phases on “recall” as needed prior to damaging any existing loop detectors. Contractor must notify the City Traffic Signal Technician following replacement of damaged detection loops. SPECIAL PROVISIONS SPECIAL PROVISIONS 10 Prior to initiating paving work on Madonna Road, the Contractor must coordinate with Caltrans to confirm logistics for providing temporary traffic signal detection. As noted in the plans, the constructor must furnish and install a temporary traffic signal video detection system for the Madonna Road/US 101 SB Ramps and Madonna Road/US 101 NB Ramps intersections to maintain functional signal detection during pavement reconstruction on Madonna Road, which will damage the existing loop detectors. Following completion of paving operations and replacement of permanent signal loop detectors, the temporary video detection equipment must be salvaged and delivered to the City Traffic Signal Shop at 25 Prado Road. See Appendix B for Madonna Road & US 101 Ramps Temporary Traffic Signal Detection Plans. Add Section 15-1.03F CONSTRUCTION, HMA Surface Repair: The outline of the asphalt concrete pavement area to be removed must be cut on a neat line with a power driven diamond saw to a minimum depth of the existing asphalt concrete before removing all existing asphalt. As an alternative, the Contractor may use a grinding device such as a “zipper” to remove the AC base repair area. All areas of removal must be cut as marked in the field and must be uniform in pattern (square, rectangle). Paving is not to be done without the inspection of the Engineer. A mechanical tamp is to be used for compacting the base or subgrade and bottom lifts of the AC. A roller is to be used for the top lift of AC. Vibrating Plates are not allowed. Any PCC to be used for pavement must be Class 1 mix per Engineering Standard 6040 General Note B to allow same day AC pave out and immediate traffic use. At each location of roadway repair activity, removal and replacement of existing pavement materials are to be performed on the same working day. Additional AC base repair areas and extents may be identified by the Engineer. Pavement repair locations must be field verified by the Engineer before the start of work. Pavement restoration must comply with section 19 and 77. Add to Section 15-1.04 PAYMENT The lump sum price for Edge Grind shall include full compensation for furnishing all labor, materials, tools, equipment, personnel, and incidentals, and for doing all the work involved with edge grinds and no additional compensation therefore. The contract price paid per square yard of Cold Plane shall be based on the actual area of surface cold planed irrespective of the number of passes required to obtain the required depth of the grind as shown on the Plans and shall include full compensation for furnishing all labor, materials, tools, equipment, and incidentals, and doing all work involved in cold planning asphalt concrete surfacing and disposing of planed material as specified in the Standard Specification and these special provisions and as shown on the Plans, and no additional compensation will be allowed therefore. SPECIAL PROVISIONS SPECIAL PROVISIONS 11 The lump sum contract price paid for Temporary Traffic Control Plan & Implementation shall include full compensation for furnishing all labor, materials, tools, equipment, personnel, and for doing all the work involved with installation and removal of the temporary traffic signal video detection systems at the Madonna Road/US 101 Ramp intersections. DIVISION V SURFACINGS AND PAVEMENTS 37 BITUMINOUS SEALS Add to Section 37-3.02A MATERIALS, General: Slurry seal must be Type II. Use Polymer Modified Asphaltic Emulsion with 2% latex additive. Water to be used in the slurry seal emulsion must be potable water. The City will provide a hydrant location for the slurry mix. The Contractor will be responsible to pay for the potable water. Add to Section 37-3.03A CONSTRUCTION, General: Not all frames, covers, grates, or manholes are shown on the Plans. The Contractor is responsible for examining the site of work. A submission of a bid is conclusive evidence that the bidder has investigated the local conditions to be encountered. Cover all utility covers and surrounding collars prior to the application of the seal per Section 15-1.03D. Add to Section 37-3.03D(4)(a)(i) CONSTRUCTION, Placement, General: A coverage must consist of the number of passes a roller needs to cover the roadway width. A pass must be 1 roller movement parallel to the slurry seal application in either direction. Overlapping passes are part of the coverage being made and are not part of a subsequent coverage. Do not start a coverage until completing the previous coverage. Failure to roll any of the streets sealed for a given day, will result in a $1,000 Liquidated Damage penalty for that day and will not be prorated. Add to Section 37-3.03D(4)(b) CONSTRUCTION, Placement, Slurry Seal: Thru-traffic lanes must be spread in full lane widths only. Slurry seal must be spread at a rate within the ranges shown in the following table for pounds of dry aggregate per square yard: Slurry Seal Type Location Spread Rate Type II1 Full Lane Width 14+/-1 Notes: 1. For slurry seal over asphalt concrete pavement. During slurry seal operations, You are responsible for: 1. Verifying that the slurry seal emulsion being used will allow for rolling within the specified time frame. SPECIAL PROVISIONS SPECIAL PROVISIONS 12 2. Adjusting the mixture for changes in weather conditions, as appropriate. 3. Sweeping the surface approximately 24 hours and 30 days after placement and as directed by the Engineer. See section 13-7.02 Street Sweeping. 4. Sweeping in such a manner as to remove loosened or shed aggregate particles without damaging the new surface. 39 ASPHALT CONCRETE Add to Section 39-2.01C(1) CONSTRUCTION, General: Contractor must phase milling and pavement operations such that public traffic is not directed to traverse milled surfaces, including remaining asphalt or base material. Contractor must submit phasing plan for review and approval. DIVISION VIII MISCELLANEOUS CONSTRUCTION 73 CONCRETE CURBS AND SIDEWALKS Add to Section 73-1.03A CONSTRUCTION, General: You must meet with the Engineer for an average of 1.5 hours total per ramp to complete the following coordination tasks: 1. Before saw-cutting to agree on the limits of demolition and removal. 2. After formwork is set, to verify that grades meet those stated on the Plans. 3. Upon completion of new curb ramp installation to verify finished grades. Curb ramps have been designed to comply with the current Caltrans Standard Plan detail RSP A88A and City Std. 4440. Field modifications to the design plans, if approved by the Engineer, must meet the dimensional and slope requirements of Standard Plan RSP A88A. When measuring the ADA facility’s dimensions and slopes, consider the required dimension or slope to have been met if the recorded individual measurements comply with the following: Dimensional measurement does not exceed ½-inch from the dimension shown, i.e. ½-inch less than a minimum dimension, or ½-inch greater than a maximum dimension. Slope measurement does not exceed 0.2 percent from the slope shown. You must give the City a 24-hour notice for inspection of formwork before pouring the concrete. You must calibrate all levels used in construction at the beginning of each work day. You must ensure that new ramp flowlines do not create any "ponding" areas. You cannot saw-cut and demolish more than 2 corners at any given intersection in order to allow pedestrian travel. SPECIAL PROVISIONS SPECIAL PROVISIONS 13 Curb ramp spandrel design may vary from Engineering Standards, as directed by the Engineer, in order to accommodate ramp landing. You are responsible for storing existing signs and boxes for reuse. Add to Section 73-1.04 GENERAL, Payment: As shown on the bid item list, each new Curb Ramp and Bike Ramp will be paid in lump sum for all work shown on the plans for the individual corner/section. The lump sum price includes all work within the limits shown on the Plans, as specified in the Standard Specifications and these Special Provisions. It also includes work for: 1. public notices 2. layout 3. elevation control 4. saw-cutting 5. demolition 6. removal and disposal of demolished material 7. formwork 8. installation of ramps, driveway, sidewalk, pavers, curb and gutter 9. installation of detectable warning surfaces 10. furnishing and installation of new signs, post and sleeves 11. furnishing and installation of guide rail edge protection 12. temporary cold mix 13. adjustment of existing utility boxes, covers, vaults, etc. 14. removal of existing traffic signal detector boxes 15. removal of existing and installation of new traffic signal pull boxes 16. removal of existing and installation of new water meter boxes 17. removal of existing and installation of new sidewalk underdrain 18. tree protection and tree well installation 19. repair of existing irrigation systems, if damaged & modifications as needed 20. landscape replacement, if applicable 21. protection of existing utilities and restoration of existing improvements 22. protection and restoration of existing benchmarks and survey monuments 23. cleanup Payment for 'AC paveouts / AC plug' of varying widths, as shown on the plans, will be made based on the weight and aggregate size of the asphalt placed and is included in the Hot Mix Asphalt Bid Item. Concrete streets must be restored with AC/PCC. All concrete base repair/restoration will be paid on a square footage basis within the “Concrete Base Repair” bid item. The Contractor must complete all paveouts/plugs concurrently with the roadway paving operations to ensure a smooth, continuous, and uniform finish. Paveouts/plugs must not be placed in isolated sections or performed out of sequence with the primary paving work. All transitions between the mainline paving and paveouts/plugs must be seamless, with consistent compaction and surface texture. SPECIAL PROVISIONS SPECIAL PROVISIONS 14 The lump sum bid item for Curb Ramp and Bike Ramp do not apply to corners where the work is limited to only the replacement of detectable warning surfaces (DWS). Replacement of DWS in such cases will be paid by the square foot separately. DIVISION IX TRAFFIC CONTROL DEVICES 84 MARKINGS Add to Section 84-2.01A GENERAL, Summary: See Section 84-2.04 of the City Standard Specifications for payment of traffic striping. Contractor shall layout all temporary and permanent striping and get approval from the engineer prior to installing. Contractor shall install temporary reflective tape to any existing crosswalk prior to opening to traffic. New crosswalk markings shall not be installed until all crosswalk warning signage, pedestrian signals and/or flashing beacon systems (if applicable) are installed and operational. Otherwise, temporary signage must be installed to convey “CROSSWALK CLOSED” to the satisfaction of the Engineer. Add to Section 84-2.03B CONSTRUCTION, Application of Stripes and Markings: Preformed thermoplastic may only be considered for green-backed shared lane markings (“sharrows”) or dashed green bike lanes through high-traffic intersections and must have prior approval from Engineer before implementation. All striping requiring pavement markers (i.e. Detail 9, Detail 37B, etc.) on one-way streets shall be Type C RED-CLEAR RETROREFLECTIVE. Add to Section 84-2.04 Payment: Bike lane buffer and daylighting buffer are measured along the linear foot and accounts for all striping and cross hatching regardless of width of buffer. Details containing white pavement markings and green pavement paint (bicycle turn box, greenback sharrow, etc.) will be paid per detail and no additional compensation will be allowed. Green bike lane markings (Case 1) paid by the square foot include bike lane symbol, green pavement coating, white markings and striping and no additional compensation will be allowed. Green bike lane markings (Case 2, & 3) paid by the linear foot include bike lane symbol, green pavement coating, white markings and striping and no additional compensation will be allowed. SPECIAL PROVISIONS SPECIAL PROVISIONS 15 Unless otherwise mentioned above, green bike lane coating is measured by the square foot for the area applied. Payment for crosswalk striping shall be made on a per square foot basis for all stripes applied and no additional compensation will be allowed. Add Section 84-6 BIKE LANE MARKINGS Add Section 84-6.01 Bike Lane Coatings: Green bike lane coating must be SealMaster Safe Ride (Appendix C) or City-approved equal. Prior to installation of green bike lane coating, the contractor shall submit a color sample and manufacturer specifications to the City for approval. Per manufacturer's specifications, SealMaster Safe Ride installation must include application of two coats minimum, with three coats provided at high traffic/wear locations (at intersection conflict areas). Add to Section 84-9.03A EXISITNG MARKINGS, CONSTRUCTION, General: Remove all traffic stripes and pavement markings before application of new traffic stripes and pavement markings. Except for PCC structures and approach slabs, remove contrast treatment, traffic stripes and pavement markings, including any paint in the gaps, by methods that do not remove pavement to a depth of more than 1/8 inch. For PCC structures and approach slabs, stripe removal methods must be by means that will not remove or damage the existing surfacing and must be authorized prior to use. Submit traffic stripe and pavement marking removal methods to the Engineer for approval prior to removal operations. DIVISION X ELECTRICAL WORK 86 ELECTRICAL SYSTEMS Add Section 86-1.05 RRFB PAYMENT: As shown on the bid item list, installation of the Rapid Rectangular Flashing Beacon (RRFB) systems will be paid by Lump Sum per the limits shown on the plans at each intersection. The lump sum unit price must include furnishing and installation of all equipment needed for the operation of beacon system as shown on the plans and specified in the Standard Specifications and these Special Provisions. Unless otherwise indicated on plans, each beacon system includes, but is not limited to: 1. Solar engine kit 2. Beacon light bars 3. Battery system 4. Pushbuttons 5. Pushbutton frame and sign placards SPECIAL PROVISIONS SPECIAL PROVISIONS 16 6. Mounting hardware 7. Electrical conductors/wiring Punch posts and signage to be installed at each beacon location are included as individual bid items. DIVISION XIII APPENDICES ADD SECTION 100 APPENDICES Add Section 100-1.01 GENERAL: 1. Appendix A – Form of Agreement 2. Appendix B – Madonna Road & US 101 Ramps Temporary Traffic Signal Detection Plans 3. Appendix C – SealMaster Safe Ride Data Sheet 4. Appendix D – Caltrans Encroachment Permit 5. Appendix E – PG&E Construction Drawing for Higuera & Elks Signal Service 6. Appendix F – Pavement Evaluation Report APPENDIX APPENDIX 0 APPENDIX A - FORM OF AGREEMENT THIS AGREEMENT, made on _____________, by and between the City of San Luis Obispo, a municipal corporation and charter city, San Luis Obispo County, California (hereinafter called the City) and COMPANY NAME (hereinafter called the Contractor). WITNESSETH: That the City and the Contractor for the consideration stated herein agree as follows: ARTICLE 1, SCOPE OF WORK: The Contractor shall perform everything required to be performed, shall provide and furnish all of the labor, materials, necessary tools, expendable equipment, and all utility and transportation services required to complete all the work of construction of NAME OF PROJECT, SPEC NO. in strict compliance with the plans and specifications therefor, including any and all Addenda, adopted by the City, in strict compliance with the Contract Documents hereinafter enumerated. It is agreed that said labor, materials, tools, equipment, and services shall be furnished and said work performed and completed under the direction and supervision and subject to the approval of the City or its authorized representatives. ARTICLE II, CONTRACT PRICE: The City shall pay the Contractor as full consideration for the faithful performance of this Contract, subject to any additions or deductions as provided in the Contract Documents, the contract prices as follows: Item No. Item Unit of Measure Estimated Quantity Item Price (in figures) Total (in figures) 1. 2. 3. BID TOTAL: $ .00 Payments are to be made to the Contractor in compliance with and subject to the provisions embodied in the documents made a part of this Contract. If any dispute arises regarding the work or contract price, Contractor must follow the procedures in the contract documents, including the requirements on change order requests and dispute resolution. APPENDIX APPENDIX 1 ARTICLE III, COMPONENT PARTS OF THIS CONTRACT: The Contract consists of the following documents, all of which are as fully a part thereof as if herein set out in full, and if not attached, as if hereto attached: 1. Notice to Bidders and Information for Bidders 2. Standard Specifications and Engineering Standards 3. Special Provisions, any Addenda, Plans and Contract Change Orders 4. Caltrans Standard Specifications and Standard Plans 2024 5. Accepted Bid and Bid Bond 6. List of Subcontractors 7. Labor Code Section 1725.5 Statements 8. Bidder Acknowledgements 9. Qualifications 10. Noncollusion Declaration 11. Agreement and Bonds 12. Insurance Requirements and Forms ARTICLE IV INDEMNIFICATION: The Contractor shall indemnify, defend with legal counsel approved by City, and hold harmless City, its officers, officials, employees and volunteers from and against all liability, loss, damage, expense, cost (including without limitation reasonable legal counsel fees, expert fees and all other costs and fees of litigation) of every nature arising out of or in connection with the acts or omissions of Contractor, its employees, subcontractors, representatives, or agents, in bidding or performing the work or in failing to comply with any obligation of Contractor under this Agreement, except such loss or damage which is caused by the sole or active negligence or willful misconduct of the City. Should conflict of interest principles preclude a single legal counsel from representing both the City and the Contractor, or should the City otherwise find the Contractor’s legal counsel unacceptable, then the Contractor shall reimburse the City its costs of defense, including without limitation reasonable legal counsel fees, expert fees and all other costs and fees of litigation. The Contractor shall promptly pay any final judgment rendered against the City (and its officers, officials, employees and volunteers) with respect to claims determined by a trier of fact to have been the result of the Contractor’s acts or omissions in bidding or performing the work or in failing to comply with any obligation of Contractor under this Agreement. It is expressly understood and agreed that the foregoing provisions are intended to be as broad and inclusive as is permitted by the law of the State of California and will survive termination of this Agreement. The Contractor obligations under this section apply regardless of whether such claim, charge, damage, demand, action, proceeding, loss, stop notice, cost, expense, judgment, civil fine or penalty, or liability was caused in part or contributed to by an Indemnitee. However, without affecting the rights of the City under any provision of this agreement, the Contractor shall not be required to indemnify and hold harmless the City for liability attributable to the active negligence of City, provided such active negligence is determined by agreement between the parties or by the findings of a court of competent jurisdiction. In instances where the City is shown to have been actively negligent and where the City’s active negligence accounts for only a percentage of the liability involved, the obligation of APPENDIX APPENDIX 2 the Contractor will be for that entire portion or percentage of liability not attributable to the active negligence of the City. ARTICLE V: It is further expressly agreed by and between the parties hereto that should there be any conflict between the terms of this instrument and the bid of said Contractor, then this instrument shall control and nothing herein shall be considered as an acceptance of the said terms of said bid conflicting herewith. ARTICLE VI LABOR CODE COMPLIANCE: This Agreement is subject to all applicable requirements of Chapter 1 of Part 7 of Division 2 of the Labor Code, including requirements pertaining to wages, working hours and workers’ compensation insurance, as further specified in the contract documents. The project is subject to the prevailing wage requirements applicable to the locality in which the work is to be performed for each craft, classification or type of worker needed to perform the work, including employer payments for health and welfare, pension, vacation, apprenticeship and similar purposes. Copies of these prevailing rates are on file with the City and are available online at http://www.dir.ca.gov/DLSR. City may not enter into the Agreement with a bidder without proof that the bidder and its subcontractors are registered with the DIR to perform public work pursuant to Labor Code section 1725.5, subject to limited legal exceptions. Pursuant to Labor Code § 1861, by signing this Agreement, Contractor certifies as follows: “I am aware of the provisions of Labor Code § 3700 which require every employer to be insured against liability for workers’ compensation or to undertake self-insurance in accordance with the provisions of that code, and I will comply with such provisions before commencing the performance of the work on this contract.” IN WITNESS WHEREOF, the parties to these presents have hereunto set their hands this year and date first above written. CITY OF SAN LUIS OBISPO A Municipal Corporation __________________________________ Whitney McDonald, City Manager APPROVED AS TO FORM CONTRACTOR: Name of Company ________________________________ By:________________________________ J. Christine Dietrick City Attorney Name of CAO/President Its: CAO/PRESIDENT APPENDIX APPENDIX 3 (2nd signature required if Corporation): By:________________________________ Name of Corporate Officer Its: ____________________ APPENDIX APPENDIX 4 APPENDIX B – MADONNA ROAD & US 101 RAMPS TEMPORARY TRAFFIC SIGNAL DETECTION PLANS MADONNA RD US 101 CITY R / WCALT R A N S R / W US 1 0 1 N B O N R A M P US 1 0 1 N B O F F R A M P CI T Y R / W CA L T R A N S R / W 5' 12 ' 11 ' 11 ' 11 ' 11 ' 5. 2 ' 5. 0 ' 5' 4' 11 ' 6' 11 ' 2' 3' 5' 12 ' 11 ' 12 ' ADVANCED DETECTION TO MATCH (E) LOOP PLACEMENT, 230' FROM LIMIT LINE CITY SPECIFICATION NO. DATE: PR O J E C T T I T L E : SH E E T T I T L E : of SHEET NO. DESIGNED BY: DRAWN BY: CHECKED BY: APPROVED BY: SCALE: PLAN FILE NO. / LOCATION 2 R Know what's below. Call before you dig.SCALE PLAN SCALE FEET 020 2010 40 2001057 HI G U E R A C O R R I D O R CO M P L E T E S T R E E T S DE DE HN December 25 1" = 20' 1 1 TR A F F I C S I G N A L T E M P O R A R Y D E T E C T I O N P L A N MA D O N N A R O A D & U S 1 0 1 N B R A M P S 1 1 GENERAL NOTES: 1. THIS PLAN IS ACCURATE FOR SIGNAL WORK ONLY. 2. THE LOCATION OF ALL EXISTING UNDERGROUND UTILITIES IS APPROXIMATE ONLY. THE CONTRACTOR SHALL BE RESPONSIBLE FOR VERIFYING THE EXACT LOCATION AND DEPTH OF ALL UTILITIES INCLUDING THOSE NOT SHOWN ON THE PLAN PRIOR TO START OF WORK. CONTACT UNDERGROUND SERVICE ALERT AT 811 AT LEAST 48 HOURS IN ADVANCE. IF DAMAGED, THE CONTRACTOR SHALL RESTORE ANY UTILITY PER CITY ENGINEER'S REQUIREMENT. 3. INSTALLATION AND MATERIALS SHALL CONFORM WITH THE LATEST EDITIONS OF THE CITY STANDARD SPECIFICATIONS AND ENGINEERING STANDARDS, CALTRANS STANDARD PLANS AND STANDARD SPECIFICATIONS, THE CALIFORNIA MUTCD, AND THE PROJECT SPECIAL PROVISIONS. 4. PULL BOX AND POLE LOCATIONS SHOWN HEREIN ARE APPROXIMATE. FOR NEW INSTALLATIONS, PRECISE LOCATIONS SHALL BE ESTABLISHED IN THE FIELD AND VERIFIED BY THE ENGINEER PRIOR TO INSTALLATION. 5. ALL MATERIALS AND EQUIPMENT SHALL BE FURNISHED AND INSTALLED BY THE CONTRACTOR, UNLESS OTHERWISE NOTED HEREIN. 6. ALL TRAFFIC SIGNAL EQUIPMENT SUBMITTALS SHALL BE APPROVED BY THE CITY PRIOR TO PROCUREMENT. 7. ALL SIGNAL EQUIPMENT SHALL BE WIRED IN ACCORDANCE WITH THE PHASE DIAGRAM. 8. ALL NEW CONDUCTORS/CABLES SHALL BE LABELED IN THE CONTROLLER CABINET AND EACH PULL BOX TO IDENTIFY PHASE OPERATION. 9. TEMPORARY VIDEO DETECTION SYSTEM SHALL BE FURNISHED AND INSTALLED BY THE CONTRACTOR PER THESE PLANS. SALVAGE AND DELIVER TEMPORARY VIDEO DETECTION EQUIPMENT TO CITY SIGNAL SHOP AT 25 PRADO ROAD AFTER REMOVAL. DELIVERY OF SALVAGED EQUIPMENT TO BE COORDINATED AND APPROVED BY THE CITY'S SIGNAL TECHNICIAN (805) 781-7032. ALL EQUIPMENT THE CITY CHOOSES NOT TO RETAIN SHALL BE DISPOSED OF BY THE CONTRACTOR. 10. CONTRACTOR SHALL PROVIDE 10 WORKING DAYS NOTICE TO THE CITY PRIOR TO IMPLEMENTING ANY SIGNAL PHASING MODIFICATIONS TO ALLOW FOR ADVANCE PLANNING AND TIME FOR CITY TO PREPARE CONTROLLER PROGRAMMING, AS NEEDED. 11. CONTRACTOR SHALL ARRANGE AND PAY TO HAVE THE MANUFACTURER'S REPRESENTATIVE AVAILABLE AT THE TIME OF INSTALLATION, AS NEEDED (I.E. MCCAIN/SWARCO, ITERIS, POLARA, ETC.) 12. CONTRACTOR TO COORDINATE INTERIM TRAFFIC SIGNAL DETECTION STRATEGY WITH CALTRANS PRIOR TO INITIATING WORK THAT WILL DAMAGE EXISTING IN-ROAD SIGNAL DETECTION EQUIPMENT. SEE HIGUERA COMPLETE STREET PROJECT PLANS FOR DETAILS REGARDING EXISTING AND PROPOSED PERMANENT TRAFFIC SIGNAL LOOP DETECTORS. TRAFFIC SIGNAL CONSTRUCTION NOT ADJUST PLACEMENT OF EXISTING VIDEO DETECTION ZONES AS SHOWN.1 PROTECT IN PLACE (E) MAGNETOMETER DETECTION.2 INSTALL TEMPORARY VIDEO DETECTION SENSOR ON LUMINAIRE ARM PER CALTRANS STANDARD PLAN SHEET ES-7R DETAIL B BEFORE DECOMISSIONING EXISTING LOOP DETECTORS. REMOVE VIDEO DETECTION SENSOR AFTER NEW LOOP DETECTORS ARE INSTALLED. 3 PROGRAM NEW VIDEO DETECTION ZONES AS SHOWN.4 INSTALL TEMPORARY VIDEO DETECTION PROCESSORS AND REQUIRED APPURTENANCES (CABLING, ETC.) IN EXISTING SIGNAL CONTROLLER CABINET. REMOVE PROCESSORS WHEN TEMPORARY VIDEO DETECTION SENSORS ARE REMOVED. 5 LEGEND PEDESTRIAN SIGNAL FACE TRAFFIC SIGNAL POLE VEHICLE SIGNAL FACE (WITH BACKPLATE, 3-SECTION: RED, YELLOW, AND GREEN) CONTROLLER ASSEMBLY EMERGENCY VEHICLE PRE-EMPTION (EVP) AND TSP OPTICAL DETECTION MOUNTED ON MAST ARMS PULL BOX CONDUIT SERVICE EQUIPMENT ENCLOSURE TS STANDARD WITH LUMINARE PEDESTRIAN PUSH BUTTON VEHICLE SIGNAL FACE (WITH BACKPLATE. 3-SECTION, RED, YELLOW, GREEN LEFT ARROW) MAGNOMETER TYPE D LOOP DETECTOR, OUTLINE OF SAW CUT SHOWN TYPE C LOOP DETECTOR, OUTLINE OF SAWCUT SHOWN TYPE A LOOP DETECTOR, OUTLINE OF SAW CUT SHOWN MICROWAVE OR VIDEO DETECTION ZONE VIDEO CAMERA NEW EXISTING 2 5 4 LS 4 4 LU K E J . S C HW A R T Z No. C 79837 S T A TE OF C A L I F O R NIA R E G ISTER E D P R O F E SSION A L E N G I N EER C I V I L 4 NO R T H MADONNA RD US 1 0 1 S B O N / O F F R A M P MA D O N N A I N N D / W 7' 11 ' 11 ' 11 ' 3' 6' 5' 10 ' 10 ' 4' 11 ' 10 ' 10 ' 10 ' CITY R/W CALTRANS R/W CI T Y R / W CA L T R A N S R / W ADVANCED DETECTION TO MATCH (E) LOOP PLACEMENT 185' FROM LIMIT LINE 11 ' 12 ' 12 ' 6' 11 ' 2' CITY SPECIFICATION NO. DATE: PR O J E C T T I T L E : SH E E T T I T L E : of SHEET NO. DESIGNED BY: DRAWN BY: CHECKED BY: APPROVED BY: SCALE: PLAN FILE NO. / LOCATION 2 R Know what's below. Call before you dig.SCALE PLAN SCALE FEET 020 2010 40 2001057 HI G U E R A C O R R I D O R CO M P L E T E S T R E E T S DE DE HN December 25 1" = 20' 2 2 TR A F F I C S I G N A L T E M P O R A R Y D E T E C T I O N P L A N MA D O N N A R D & U S 1 0 1 SB R A M P S 6 GENERAL NOTES: 1. THIS PLAN IS ACCURATE FOR SIGNAL WORK ONLY. 2. THE LOCATION OF ALL EXISTING UNDERGROUND UTILITIES IS APPROXIMATE ONLY. THE CONTRACTOR SHALL BE RESPONSIBLE FOR VERIFYING THE EXACT LOCATION AND DEPTH OF ALL UTILITIES INCLUDING THOSE NOT SHOWN ON THE PLAN PRIOR TO START OF WORK. CONTACT UNDERGROUND SERVICE ALERT AT 811 AT LEAST 48 HOURS IN ADVANCE. IF DAMAGED, THE CONTRACTOR SHALL RESTORE ANY UTILITY PER CITY ENGINEER'S REQUIREMENT. 3. INSTALLATION AND MATERIALS SHALL CONFORM WITH THE LATEST EDITIONS OF THE CITY STANDARD SPECIFICATIONS AND ENGINEERING STANDARDS, CALTRANS STANDARD PLANS AND STANDARD SPECIFICATIONS, THE CALIFORNIA MUTCD, AND THE PROJECT SPECIAL PROVISIONS. 4. PULL BOX AND POLE LOCATIONS SHOWN HEREIN ARE APPROXIMATE. FOR NEW INSTALLATIONS, PRECISE LOCATIONS SHALL BE ESTABLISHED IN THE FIELD AND VERIFIED BY THE ENGINEER PRIOR TO INSTALLATION. 5. ALL MATERIALS AND EQUIPMENT SHALL BE FURNISHED AND INSTALLED BY THE CONTRACTOR, UNLESS OTHERWISE NOTED HEREIN. 6. ALL TRAFFIC SIGNAL EQUIPMENT SUBMITTALS SHALL BE APPROVED BY THE CITY PRIOR TO PROCUREMENT. 7. ALL SIGNAL EQUIPMENT SHALL BE WIRED IN ACCORDANCE WITH THE PHASE DIAGRAM. 8. ALL NEW CONDUCTORS/CABLES SHALL BE LABELED IN THE CONTROLLER CABINET AND EACH PULL BOX TO IDENTIFY PHASE OPERATION. 9. TEMPORARY VIDEO DETECTION SYSTEM SHALL BE FURNISHED AND INSTALLED BY THE CONTRACTOR PER THESE PLANS. SALVAGE AND DELIVER TEMPORARY VIDEO DETECTION EQUIPMENT TO CITY SIGNAL SHOP AT 25 PRADO ROAD AFTER REMOVAL. DELIVERY OF SALVAGED EQUIPMENT TO BE COORDINATED AND APPROVED BY THE CITY'S SIGNAL TECHNICIAN (805) 781-7032. ALL EQUIPMENT THE CITY CHOOSES NOT TO RETAIN SHALL BE DISPOSED OF BY THE CONTRACTOR. 10. CONTRACTOR SHALL PROVIDE 10 WORKING DAYS NOTICE TO THE CITY PRIOR TO IMPLEMENTING ANY SIGNAL PHASING MODIFICATIONS TO ALLOW FOR ADVANCE PLANNING AND TIME FOR CITY TO PREPARE CONTROLLER PROGRAMMING, AS NEEDED. 11. CONTRACTOR SHALL ARRANGE AND PAY TO HAVE THE MANUFACTURER'S REPRESENTATIVE AVAILABLE AT THE TIME OF INSTALLATION, AS NEEDED (I.E. MCCAIN/SWARCO, ITERIS, POLARA, ETC.) 12. CONTRACTOR TO COORDINATE INTERIM TRAFFIC SIGNAL DETECTION STRATEGY WITH CALTRANS PRIOR TO INITIATING WORK THAT WILL DAMAGE EXISTING IN-ROAD SIGNAL DETECTION EQUIPMENT. SEE HIGUERA COMPLETE STREET PROJECT PLANS FOR DETAILS REGARDING EXISTING AND PROPOSED PERMANENT TRAFFIC SIGNAL LOOP DETECTORS. TRAFFIC CONSTRUCTION NOTES: INSTALL TEMPORARY VIDEO DETECTION SENSOR ON LUMINAIRE ARM PER CALTRANS STANDARD PLAN SHEET ES-7R DETAIL B BEFORE DECOMISSIONING EXISTING LOOP DETECTORS. REMOVE VIDEO DETECTION SENSOR AFTER NEW LOOP DETECTORS ARE INSTALLED. 3 PROGRAM NEW VIDEO DETECTION ZONES AS SHOWN.4 INSTALL TEMPORARY VIDEO DETECTION PROCESSORS AND REQUIRED APPURTENANCES (CABLING, ETC.) IN EXISTING SIGNAL CONTROLLER CABINET. REMOVE PROCESSORS WHEN TEMPORARY VIDEO DETECTION SENSORS ARE REMOVED. 5 PROTECT IN PLACE (E) ADVANCE LOOPS.6 LEGEND PEDESTRIAN SIGNAL FACE TRAFFIC SIGNAL POLE VEHICLE SIGNAL FACE (WITH BACKPLATE, 3-SECTION: RED, YELLOW, AND GREEN) CONTROLLER ASSEMBLY EMERGENCY VEHICLE PRE-EMPTION (EVP) AND TSP OPTICAL DETECTION MOUNTED ON MAST ARMS PULL BOX CONDUIT SERVICE EQUIPMENT ENCLOSURE TS STANDARD WITH LUMINARE PEDESTRIAN PUSH BUTTON VEHICLE SIGNAL FACE (WITH BACKPLATE, SEE DETAILS) VEHICLE SIGNAL FACE (WITH BACKPLATE. 3-SECTION, RED, YELLOW, GREEN LEFT ARROW) VIDEO CAMERA 6 LU K E J . S C HW A R T Z No. C 79837 S T A TE OF C A L I F O R NIA R E G ISTER E D P R O F E SSION A L E N G I N EER C I V I L TYPE D LOOP DETECTOR, OUTLINE OF SAW CUT SHOWN TYPE C LOOP DETECTOR, OUTLINE OF SAWCUT SHOWN TYPE A LOOP DETECTOR, OUTLINE OF SAW CUT SHOWN MICROWAVE OR VIDEO DETECTION ZONE NEW EXISTING 5 3 3 3 3 4 4 4 LS APPENDIX APPENDIX 5 APPENDIX C – SEALMASTER SAFE RIDE DATA SHEET APPENDIX APPENDIX 6 APPENDIX D – CALTRANS ENCROACHMENT PERMIT STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT DOT TR-0120 (REV 05/2023) FM 91 1436 05-25-N-MC-0530 Permit No. Americans with Disabilities Act (ADA) Notice: This document is available in alternative accessible formats. For more information, please contact the Forms Management Unit at (279) 234-2284, TTY 711, in writing at Forms Management Unit, 1120 N Street, MS-89, Sacramento, CA 95814, or by email at Forms.Management.Unit@dot.ca.gov. July 29, 2025In compliance with your application of Reference Documents: Utility Notice No. Agreement No. R/W Contract No. Project code (ID): Applicant's Reference/ Utility Work Order No. of of of CFC #: Higuera corridor Com 05/SLO/101/PM 27.49 Dist/Co/Rte/PM December 18, 2025 Permit Approval Date $0 Performance Bond Amount (1) $0 Payment Bond Amount (2) $ N/A Bond Company $ N/A Bond Number (1) $ N/A Bond Number (2) City of San Luis Obispo C/O: Hai Nguyen Senior Engineer 919 Palm Street San Luis Obispo, CA 93401 Email: hnguyen@slocity.org Phone: (805)781-7108 TO: , PERMITTEE The scope of work within the Caltrans Right of Way includes pavement maintenance activities, which involve milling the existing roadway to a depth of 3 inches, followed by replacement with 3 inches of new asphalt and paving grid. Areas exhibiting base failures will be repaired by milling to a depth of 10 inches and replacing with 10 inches of asphalt. The concrete bridge deck surface will be sealed with Methacrylate following the removal of existing striping, using methods that will preserve the integrity of the concrete. All curb ramps within the Caltrans paving limits have been verified to comply with current ADA standards. The plans propose to replace the detectable warnings at four locations within the Caltrans Right of Way to enhance visibility and improve pedestrian safety. Additionally, the roadway striping configuration will be adjusted to enhance safety for cyclists, with green paint applied to bike lanes. Further improvements include signal modifications at the intersection of Madonna Road and the US 101 ramps. As shown on the attached plans and as directed by the permit provisions in US Highway 101 right of way at postmile 27.49 in the City and County of San Luis Obispo. and subject to the following, PERMISSION IS HEREBY GRANTED to: THIS PERMIT IS NOT A PROPERTY RIGHT AND DOES NOT TRANSFER WITH THE PROPERTY TO A NEW OWNER. The following attachments are also included as part of this permit (check applicable): YES NO General Provisions YES NO Utility Maintenance Provisions YES NO Storm Water Special Provisions YES NO Special Provisions YES NO A Cal-OSHA Permit, if required: Permit No. YES NO As-Built Plans Submittal Route Slip for Locally Advertised Projects YES NO Storm Water Pollution Protection Plan In addition to fee, the permittee will be billed actual costs for: YES NO Review YES NO Inspection YES Field Work (if any Caltrans effort expended) As-built Plans are Required YES NO YES NO The information in the environmental documentation has been reviewed and considered prior to approval of this permit. This permit is to be strictly construed and no other work other than specifically mentioned is hereby authorized. No project work shall be commenced until all other necessary permits and environmental clearances have been obtained. December 31This permit is void unless the work is completed before 2026, CC: #1: ROMANO J VERLENGIA #2: JOSHUA J MILTON #3: #4: Alan Kwong Scott Eades, District Director APPROVED: BY {{Sig1_es_:signer1:signature }}VALERIE BEARD, District Permit EngineerValerie Beard (Dec 18, 2025 07:52:35 PST) Valerie Beard “Improving lives and communities through transportation.” CALIFORNIA STATE TRANSPORTATION AGENCY GAVIN NEWSOM, Governor Encroachment Permits Office 50 HIGUERA STREET | SAN LUIS OBISPO, CA 93401-5415 (805) 549-3111 | TTY 711 www.dot.ca.gov 12/18/2025 05/SLO/101/pm 27.49 05-25-N-MC 0530 Permittee Reference Number Higuera Corridor Complete Streets Project City of San Luis Obispo Attn: Hai Nguyen 919 Palm Street San Luis Obispo, CA 93401 Dear Hai Nguyen: Attached is your approved encroachment permit. DO NOT BEGIN WORK UNTIL YOU HAVE FIRST READ THE ENTIRE PERMIT CAREFULLY AND COMPLETELY AND CONTACTED THE STATE INSPECTOR LISTED ON YOUR PERMIT. This permit is a legal and binding contract once work on it has begun. You are subject to the provisions contained in the permit and in the attached Encroachment Permit General Provisions. If there is any question regarding interpretation of any detail in the permit or the General Provisions, you may contact the inspector listed on your permit or our office at (805) 549-3152. Thank you in advance for your cooperation. Pursuant to the Executive Department, State of California, Proclamation of a State of Emergency, signed on October 27, 2019, and under the direction of the Office of Emergency Services and the State Emergency Plan, work authorized by this permit will be suspended when a planned Public Safety Power Shutoff (PSPS) notification is in effect. Unless Permittee has obtained special approval from the Director of Caltrans or his assigns to work during a PSPS event, Permittee must stop work and make all traveled ways and roadsides safe for public travel and emergency services if notified by the Director of Caltrans or his assigns. Sincerely, for VALERIE BEARD, PE District Permit Engineer for VALERIE BEARD PE Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 1 of 27 Work authorized under this permit: The scope of work within the Caltrans Right of Way includes pavement maintenance activities, which involve milling the existing roadway to a depth of 3 inches, followed by replacement with 3 inches of new asphalt and paving grid. Areas exhibiting base failures will be repaired by milling to a depth of 10 inches and replacing with 10 inches of asphalt. The concrete bridge deck surface will be sealed with Methacrylate following the removal of existing striping, using methods that will preserve the integrity of the concrete. All curb ramps within the Caltrans paving limits have been verified to comply with current ADA standards. The plans propose to replace the detectable warnings at four locations within the Caltrans Right of Way to enhance visibility and improve pedestrian safety. Additionally, the roadway striping configuration will be adjusted to enhance safety for cyclists, with green paint applied to bike lanes. Further improvements include signal modifications at the intersection of Madonna Road and the US 101 ramps. As shown on the attached plans and as directed by the permit provisions in US Highway 101 right of way at postmile 27.49 in the City and County of San Luis Obispo. Permit Distribution List: Permit File Romano Verlengia - Inspector Joshua Milton STATE PERMIT INSPECTOR Unless approved otherwise by the State Permit Inspector, Permittee must contact the State Permit Inspector listed below, at the following times, before starting work in the State right of way: x A minimum of two weeks prior to commencing work for a pre-job meeting to discuss permit provisions, notification requirements, and scheduling. x A minimum of two working days prior to commencing work. State Permit Inspector: Romano Verlengia Phone: (805) 458-3353 Email: romano.verlengia@dot.ca.gov Fax: (805) 549-3062 Notification requirements that will impact your work schedule: Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 2 of 27 1.Changes to horizontal or vertical clearances; minimum of 25-day advance notification. 2.Lane closures: completed “Weekly Traffic Update” form must be submitted by noon the Monday prior to date of proposed lane closure. 3.Public Affairs: completed “Public Affairs – Permitted Activity Notification” form must be submitted as early as possible (One Week Ahead is Best) prior to beginning of permitted activity. 4. When work has been interrupted for more than five working days, the Permittee must notify the Caltrans Permit Inspector a minimum of two working days prior to restarting work. This issued encroachment permit is void unless the permitted activity or construction is completed by the void date shown on page 1 of the encroachment permit form DOT TR-0120. The Permittee is solely responsible for keeping track of the permit void date. All requests to extend this void date must be received by the District 5 Encroachment Permits Office while the encroachment permit is valid. Request for an extension received after the permit void date cannot be processed. Pursuant to the Executive Department, State of California, Proclamation of a State of Emergency, signed on October 27, 2019, and under the direction of the Office of Emergency Services and the State Emergency Plan, work authorized by this permit will be suspended when a planned Public Safety Power Shutoff (PSPS) notification is in effect. Unless Permittee has obtained special approval from the Director of Caltrans or his assigns to work during a PSPS event, Permittee must stop work and make all traveled ways and roadsides safe for public travel and emergency services if notified by the Director of Caltrans or his assigns. ADDITIONAL PERMIT ATTACHMENTS x PUBLIC AFFAIRS PROJECT NOTIFICATION x WEEKLY TRAFFIC UPDATE x HOLIDAY AND SPECIAL DAY LANE CLOSURE RESTRICTION CALENDAR x DISTRICT 5 NON-STANDARD SPECIAL PROVISION 12-4.02C(3)(f) x CALTRANS STANDARD PLANS T9-7T14, T30-T34 x FORM CEM-3101 x PEDESTRIAN SAFETY (MCP) x STEEL PLATE BRIDGING UTILITY x STORMWATER SPECIAL PROVISIONS FOR MINIMAL OR NO IMPACT (SWSP) (TR-0400) x SURVEYS (SV) x TRAFFIC STRIPING, MARKERS, AND SIGNS x UTILITY UNDERGROUND PROVISIONS (UG) x Other: o Typical Temporary Sign Support Details o Typical Portable Changeable Message Sign Placement o Certification of Compliance with Americans with Disabilities Act (ADA) (TR-0405) o Encroachment Permit Applicant: Contractor(s) Authorization Form (DOT TR-0429) o Notice of Completion TR-0128 o Completed Standard Encroachment Permit Application (DOT TR-0100) Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 3 of 27 o TR-0129 Progress Billing/Permit Closure o TR-0130 Encroachment Permit Report o Approved Plans PLANS AND SPECIFICATIONS If conflicts arise between Special Provisions, Plans, Caltrans Standard Plans, Standard Specifications, or other Caltrans standards, the Caltrans Inspector shall make the final determination regarding selection or interpretation of standards and/or specifications. State Standards and Specifications must apply to all work within the State right of way unless directed otherwise by the State Inspector. Reference to the Engineer in the State Standard Specifications must include the State Representative (Caltrans Permit Inspector or District 05 Permit Engineer). Attention is directed to Section 5 of the current State Standard Specifications and the Encroachment Permit General Provisions (TR-0045) regarding control of work and permit work plan revisions. Additionally, the State Permit Inspector may require reasonable additions, modifications, or revisions to the scope of work at no cost to the State if the change is in the best interest of the State facility where the encroachment permit is being granted and Caltrans policy, Standard Specifications, or Permit Provisions are unclear. WORK HOURS Work authorized by this permit that does not restrict or close any traffic lane or shoulder may be performed on weekdays between the hours of 9:00 AM and 3:00 PM. Traffic lane and shoulder restrictions of closures shall be determined after review of contractor supplied traffic control and construction staging plans have been reviewed and approved. Work and lane closure restrictions will apply prior to and after a holiday or holiday weekend: 1. As shown on the attached Holiday and Special Day Lane Closure Restrictions calendar. 2. Work schedules beyond the calendar dates shall comply with the attached District 5 Non-Standard Special Provision 12-4.02C(3)(f). 3. When a designated legal holiday falls on a Sunday, the following Monday Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 4 of 27 shall be a designated legal holiday. 4. When November 11th falls on a Saturday, Friday November 10th shall be a designated legal holiday. The State Inspector must approve deviations from these hours in advance. All work that will impact the normal operations of Caltrans traffic signal facilities must be performed under traffic control and during the hours approved by the Caltrans Inspector and Caltrans District 5 Traffic Management Center. Caltrans Lane Closure System (LCS) Compliance Contacts Work authorized by this permit will require compliance and proper notification in LCS. If not identified elsewhere in this permit, Permittee or Permittee’s contractor must provide the contact information for two personnel, who will be ensuring LCS compliance during the pre-job meeting with the Caltrans Permit Inspector. Contact information shall include personnel’s full names, phone numbers and email addresses. If the above LCS contacts have changed, Permittee or Permittee’s contractor must provide updated contact information for replacement personnel, who will be ensuring LCS compliance to the Caltrans Permit Inspector. Contact information shall include personnel’s full names, phone numbers and email addresses. CONDITIONS OF APPROVAL 1. Work authorized by this permit requires electronic Adobe file format (.pdf) “As- Built” plans. As-built files should be received within 30 days of the completion of the permitted work unless otherwise arranged with the Caltrans Permit Inspector. Failure to provide as-built files may result in the suspension of Permittee’s encroachment permit activities within Caltrans District 5. 2. Failure to meet with the Caltrans Permit Inspector for a pre-job meeting prior to starting work within the State right of way may result in the immediate termination of work at the site. The State right of way shall be restored to a safe condition and all personnel and equipment must be removed from the State right of way as soon as possible as directed by the Caltrans Representative. Work may resume once the meeting with the Caltrans Permit Inspector has taken place and the Caltrans Permit Department has determined that the work is in compliance with the provisions of this permit. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 5 of 27 3. Failure to comply with the permit provisions may result in the revocation of this permit (See Encroachment Permit General Provision number 2.) and will also result in more stringent permit requirements for future encroachment permits. 4. Prior to starting work on or may impact the State Highway System: 4.1. Permittee must finalize an updated Freeway Maintenance Agreement between Caltrans and the City of San Luis Obispo (City). 4.2. Permittee must provide 100% construction plans compliant with Caltrans Highway Design Manual and/or Design Standard Decision Document for review and approval. A Caltrans permit rider will be issued to document and attach the Caltrans fully approve plans to this permit. 5. Permittee shall maintain the proposed improvements based on the finalized Freeway Maintenance Agreement. 6. Permittee shall provide a qualified California Licensed Civil Engineer to perform permit inspection duties under the guidance of the State Permit Inspector. 7. Propose material and application of delineation and markings on methyl methacrylate treated bridge deck shall be approved by the State Permit Inspector prior to its use. 8. Caltrans does not participate in underground service alerts. Permittee may coordinate with Caltrans to locate existing Caltrans underground facilities. 9. All work on the overpass and ramp closures should be performed during nighttime work hours. 10. Nighttime highway construction work lighting must be provided within the work zone to illuminate the task(s), minimum illumination of 10 foot-candles, in a manner that will minimize glare to work crews and not interfere with the vision of oncoming motorists (e.g. providing screens, mounting lamps below the top edge of the barrier wall, varying the beam angle, etc.) 11. Permittee shall coordinate with the Caltrans Permit Inspector and Caltrans Electrical Operations to check the function of traffic signal systems within the work zones permitted prior to beginning work and after work has been completed. 12. If the proposed work will damage or impair the normal operation of State traffic Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 6 of 27 signal facilities that cannot be permanently restored within 24 hours, Permittee must provide and maintain temporary traffic signal facilities to ensure normal traffic signal operations until the permanent traffic signal facilities have been restored at no cost to the State. 13. If the proposed work damages or impairs the normal function of State traffic signal detector loops that cannot be permanently restored within 24 hours, Permittee must provide and maintain alternative optical or video traffic detection to ensure normal traffic signal operations until the permanent traffic detector loops have been restored at no cost to the State. 14. Work that may impact State traffic signal-controlled intersections may not begin until Permittee or Permittee’s contractor has coordinated with the Caltrans Permit Inspector to formulate an action plan to ensure disruption to normal traffic signal operations will not exceed a 24-hour period. 15. Permittee shall be responsible for identifying the location of Caltrans traffic signal conduits and detector loops prior to performing excavation operations. Permittee must take all necessary precautions to protect Caltrans traffic signal facilities in place. Permittee shall be solely responsible for replacing damaged traffic signal facilities as directed by the Caltrans representative. 16. Permittee must coordinate with the Caltrans Permit Inspector and Caltrans Electrical Operations to change the operation of traffic signal facilities. Only Caltrans Electrical Operations staff are allowed to access and modify the operation of the traffic signal controller. 17. When a traffic lane approaching a signalized intersection must be closed to traffic, do not place metallic traffic control devices or park vehicles above existing traffic signal detector loops. 18. Permittee shall be solely responsible for providing additional traffic control devices or contract with the California Highway Patrol to protect the work site and traveling public as directed by the Caltrans Permit Inspector to meet field conditions at no cost to the State. REQUIREMENT FOR CITY INSPECTOR The City of San Luis Obispo (City) must be responsible for inspection of all phases of this project in accordance with this permit and as directed by the State Permit Inspector. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 7 of 27 The State reserves the right to review and oversee all operations. The City must also be responsible and must fully cooperate with the State Permit Inspector in assuring compliance of the City's Contractor with State as well as City specifications and regulations. The City must provide qualified construction inspectors and staff using City and/or consultant forces to administer the construction contract regulations, policies, procedures, manuals, standard plans and specifications, and other standards including compliance with any Federal Highway Administration (FHWA) requirements. Said inspector is to be subject to ongoing review and approval by Caltrans. City inspections may include construction surveys, soils and foundation tests, measurement and computation of quantities, testing of construction materials, checking shop drawings, preparation of estimates and reports, preparation of "as- built" drawings, and other inspection and staff services necessary to ensure that the construction is being performed in accordance with the plans and specifications. The City must use the attached ENCROACHMENT PERMIT REPORT, form TR-0130 (5/94), and PROGRESS BILLING/PERMIT CLOSURE, form TR-0129 (7/2013), to report on the work progress. Similar forms may be used in lieu of the Caltrans forms if approved by the Caltrans Permit Inspector. These forms must be submitted to the Caltrans Permit Inspector along with the Completion Card, form FM 92 1546 M, any inspection tags, geotechnical test records, or Certificates of Compliance, at the end of the project. PERMITTEE AND PERMITTEE’S PRIME CONTRACTOR(S) Notwithstanding Encroachment Permit General Provision #4, the Permittee and Permittee’s prime contractor(s) are required to complete, sign, and submit the attached Encroachment Permit Applicant: Contractor(s) Authorization Form DOT TR- 0429, prior to the pre-construction meeting, to the Caltrans Permit Inspector. 1. The form must reference permit number 05-25-N-MC 0530. 2. A California licensed contractor, individual, or company under contract directly with the Permittee is considered a prime contractor for this encroachment permit. 3. Each prime contractor must provide a certificate of liability insurance and an additional insured endorsement to cover the State’s potential liability for the permitted work and the issuance of the permit rider. The certificate and endorsement must name “the State of California, California Department of Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 8 of 27 Transportation, the directors, officers, employees, and/or agents of the State of California and/or the California Department of Transportation” as additional insured for the following minimum liability insurance limits: $2,000,000.00 General Liability Aggregate $1,000,000.00 General Liability per Occurrence $100,000.00 Non-Owned Vehicle Property Damage The Certificate must contain “Permit Number 05-25-N-MC 0530” in the description of the Certificate. 4. If prime contractor(s) are replaced or added after the initial submission of Form DOT TR-0429, Permittee and Permittee’s new prime contractor(s) must complete, sign, and submit another form with signatures to the Caltrans District 5 Encroachment Permits Office. 5. Work within the State right of way may not begin until the receipt and approval of Form DOT TR-0429 by the Caltrans Permit Inspector and the required information listed below from the prime contractor(s) has been approved with a permit rider by the Caltrans District 5 Encroachment Permits Office. The Permittee or Permittee’s prime contractor is also responsible for providing the following information as a permit rider application package for this permit. Permit rider applications also use the Standard Encroachment Permit Application DOT TR-0100. The permit rider applicant must be the Permittee of this permit and must reference this permit number, 05-25-N-MC 0530, in the description of work. The Permittee or Permittee’s prime contractor may submit the permit rider application package. If the prime contractor will be acting as an agent on the Permittee’s behalf for the permit rider, a letter of authorization from the Permittee to the Permittee’s prime contractor to apply and obtain the permit rider must be provided. A. The prime contractor responsible for the permit project traffic control must provide the project specific traffic control plans prepared, stamped, and signed, with the license expiration date, by a California Civil Engineer. The application and information for the permit rider application package may be mailed or delivered to the following address, or sent by email to D5.Permits@dot.ca.gov Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 9 of 27 CALTRANS Encroachment Permits Office Attention: VALERIE BEARD, PE 50 Higuera Street San Luis Obispo, CA 93401 Any questions concerning the permit rider application package should be directed to ALAN KWONG at (805) 534-3860 or sent by email to alan.kwong@dot.ca.gov. NOTIFICATIONS Notice of Materials Used Permittee’s attention is directed to Caltrans Standard Specification Section 6, Control of Materials. The Permittee must bear all costs for source material inspection. Please note that these materials may require source inspection and approval at the manufacturer’s plant. Permittee shall be solely responsible to furnish a list of materials to be used on the permitted project by completing the attached Form CEM-3101 "Notice of Materials Used" for traffic signal standards, lighting (electrolier) standards, metal poles, mast arms, foundation bolts, overhead sign trusses, guard rail components, column casings, epoxy coated rebar, reinforced concrete pipe, steel girders, sign panels, and other items as specified by the State representative. Form must be submitted to the Caltrans Permit Inspector and METS Material Administrator. The METS Material administrator must determine which materials will require source inspection and which will require onsite inspection in coordination with the Caltrans Permit Inspector. Additional form submissions may be required to address additional items that require source inspection. Please allow a minimum of six weeks for source inspection, testing, and approval of materials to be used. Reference attached form CEM-3101 for email address, fax number, and mailing address for submission to the METS Material Administrator. TRAFFIC CONTROL AND PUBLIC SAFETY All traffic control must be performed under the direction of qualified and competent Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 10 of 27 traffic control personnel. If it becomes apparent to the Caltrans Permit Inspector that the Permittee's contractor does not have adequately trained and competent staff to perform traffic control, the Permittee or Permittee's contractor must hire a suitable contractor to provide traffic control. A traffic control technician must be assigned to each closure. Traffic control technician(s) must be trained, certified, and comply with Caltrans Standard Specifications 12-4.02C(11) Traffic Control Technician. All traffic control personnel performing flagging operations must comply with Caltrans Standard Specifications 12-4.02C(9) Flagging. Flagger certification(s), for each flagger, must be provided to the State Permit Inspector. Traffic control and construction zone signing must be performed per an approved traffic control plan. In the absence of a project specific traffic control plan: All traffic control must be performed in compliance with the applicable Caltrans Standard Plans for traffic control, California Manual on Uniform Traffic Control Devices, or as approved by and as directed by the Caltrans Permit Inspector, or If requested by the Caltrans Permit Inspector, Permittee or Permittee's contractor must provide a traffic control plan prepared by a duly licensed individual for review and approval. Plans must bear the licensed individual's signature and identifying licensing information. All traffic control devices must comply with the Caltrans Standard Specifications 12- 3 Temporary Traffic Control Devices and the current California Manual of Uniform Traffic Control Devices. The Permittee must provide all traffic control devices and personnel. All expenses incurred from traffic control operations must be borne by the Permittee. Work must not interfere with traffic and no equipment must be parked on or operated from the traveled way unless approved by the Caltrans representative. Notwithstanding lane closures noted in the traffic control plans or elsewhere in this permit, the full width of the traveled way must be open for use by public traffic on Saturdays, Sundays, designated legal holidays, the day preceding designated legal Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 11 of 27 holidays, after 3:00 PM on Fridays, and when construction operations are not actively in progress. On multilane roadways, a minimum of one-paved traffic lane, not less than 10 feet wide, must be open for use by public traffic in each direction of travel. On 2-lane, two-way roadways a minimum of one-paved traffic lane not less than 10 feet wide must be open for use by public traffic. When construction operations are not actively in progress, not less than 2 of these lanes must be open to public traffic. If approved by the State Inspector, one lane may be closed during construction and public traffic stopped for periods not to exceed 5 minutes. After each closure, all accumulated traffic must be allowed to pass through the work before another closure is made. Lane closures must not exceed 0.5 miles in length. Minor deviations from the requirements of this section concerning hours of work may be permitted upon the written request of the Permittee if, in the opinion of the Inspector, public traffic will be better served, and the work expedited. The Permittee must not adopt these deviations until the Inspector has approved them in writing. “NO PARKING” zones must be posted a minimum of 48 hours in advance of proposed parking lane closure. Standard Specification12-4.02C(4) Buffer Lanes Where two or more lanes are adjacent to a work area, including work on shoulders, you must close the lane adjacent to the work area in accordance with the lane closure requirements as follows: 1. Work is on the traveled way within 6 feet of the adjacent traffic lane. 2. Work is off the traveled way but within 6 feet of the edge of the traveled way, and the posted speed is 45 mph or greater. 3. Work is off the traveled way but within 3 feet of the edge of the traveled way, and the posted speed is less than 45 mph. Closure of the adjacent traffic lane is not required for: 1. Workers protected by a permanent or temporary barrier 2. Installation, maintenance, or removal of traffic control devices except for temporary barrier system Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 12 of 27 For time periods at the beginning or end of work when the lane requirement charts do not allow the closure of the adjacent traffic lane, the following construction activities are allowed without a buffer lane: 1. Paving 2. Parking, positioning, loading, unloading vehicles, or storing equipment or materials necessary for the work being performed 3. Placing, removing, or maintaining traffic stripes, pavement marking, or pavement markers 4. Operations not performed by workers on foot such as grinding, grooving, planing, sweeping, applying a tack coat, or operating a crane 5. Operations where workers on foot are protected, at each work location, within the same closure by an impact attenuator vehicle in the lane adjacent to live traffic Do not perform work activities or store equipment, vehicles, or materials within the buffer lane. Suspended Loads Suspended loads or equipment must not be moved nor positioned over public traffic or pedestrians. 12-3.36 PORTABLE TRANSVERSE RUMBLE STRIPS-Standard Special Provisions 12-3.36A General 12-3.36A(1) Summary Section 12-3.36 includes specifications for providing portable transverse rumble strips. 12-3.36A(2) Definitions Not Used 12-3.36A(3) Submittals Submit a copy of the manufacturer's instructions as an informational submittal before using portable transverse rumble strips. 12-3.36A(4) Quality Assurance Not Used Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 13 of 27 12-3.36B Materials Portable transverse rumble strips must: 1. Be on the Authorized Material List for signing and delineation materials 2. Be rated for ambient temperatures from 0 to 150 degrees F 3. Have a minimum weight of 75 pounds and withstand vehicles up to 80,000 pounds with minimal movement 4. Not degrade due to weather or traffic conditions 5. Have a non-slip textured surface 6. Have a drainage design that efficiently removes liquid without displacing the unit 7. Be black or orange in color 12-3.36C Construction Install portable transverse rumble strips under the manufacturer's installation instructions. Before installation of portable transverse rumble strips, the roadway must be cleaned and free of dust, sand, and other materials that may cause slippage. Place each portable transverse rumble strip on a uniform paved surface free of defects, including potholes, excessive rutting, separated transverse joints, and utility structures. Portable transverse rumble strips, whether comprised of one segment or interlocking segments, must extend to the full lane width, and be configured in accordance with the manufacturer’s recommendations. Use 2 arrays where each array consists of 3 rumble strips. Portable transverse rumble strips must not be placed at any of the following locations: 1. On sharp horizontal curves 2. On vertical curves 3. Through pedestrian crossings Portable transverse rumble strips are not required if: 1. Duration of work in a work zone is 4 hours or less 2. Posted speed limit is below 45 mph 3. Work is of emergency nature 4. Work zone is in snow or icy weather conditions Portable transverse rumble strips must be installed without adhesive or bolts. When a portable transverse rumble strip consists of multiple sections, connect sections under the manufacturer's instructions before placing them in the traffic lane. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 14 of 27 If a portable transverse rumble strip is displaced out of alignment or skewed by more than 6 inches, as measured from one end to the other, immediately readjust position to original location. Portable transverse rumble strips that no longer provide audible or vibratory alerts must be replaced immediately. GENERAL REQUIREMENTS Project/Work Site All disturbed areas must be restored to original or better condition. Any change in the existing drainage pattern, whether occasioned by increase or diversion, and the cost of damage, repair, or restoration of the State highway right of way must be the responsibility of the Permittee. No earth or construction materials are to be dragged or scraped across the highway pavement. No excavated earth shall be placed or allowed to remain at a location where it can be tracked on the highway traveled way, public, or private approach by the Permittee’s construction equipment or by traffic entering or leaving the highway traveled way. The Permittee must immediately remove excavated earth or mud so tracked onto the highway pavement or public or private approach. No excavation, maintenance hole, pull box, or vault shall be left open overnight or unattended during work hours without written permission from the Caltrans representative and adequate protection for traffic and pedestrians is provided. All newly placed concrete must be cured in accordance with Caltrans Standard Specifications Section 90-1.03B, Curing Concrete. Personnel Protective/Safety Equipment All personnel working within the State right of way must wear the appropriate personnel safety/protective equipment as specified by the personnel's employer's "Injury and Illness Prevention Program" required by the California Code of Regulations 3203. If requested by the Caltrans Permit Inspector, personnel's employer must provide a copy of said "Injury and Illness Prevention Program" and identify the locations within the document that addresses, but not limited to, personal protective equipment, head protection, and warning garments. In the absence of an "Injury and Illness Prevention Program," all other personnel within the project work zone must conform to the personnel protective/safety Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 15 of 27 equipment requirements in the latest edition of the Caltrans Safety Manual. Aerially Deposited Lead (ADL) for Minimal Disturbance Permittee must reuse the soil within the work limits in the immediate area from which it was excavated. If any excess soil is generated, it becomes the property of the Permittee. Permittee must transport all excess soil outside of Caltrans' right-of-way and dispose of it in accordance with all applicable environmental laws and regulations. Construction Debris and Waste Materials The Permittee solely owns all construction debris and waste materials, including hazardous waste, generated by this permitted project. Said materials must be removed from the State right of way, stored, and disposed of in accordance with applicable local, regional, State, and Federal specifications or regulations. Construction debris and waste materials must be disposed of: at designated off-site commercial facilities approved to accept said materials, at non-commercial permitted sites approved to accept said materials (Permittee must provide copies of all necessary local and State agency permits prior to disposal.), or at sites outside of the State of California approved to accept said materials (Permittee to provide copies of permits issued by the local and State agency with jurisdiction over the site prior to disposal.). If requested by the State Permit inspector, Permittee must provide a copy of documentation as proof of the proper disposal of said materials. Survey Monumentation Permittee’s attention is directed to Caltrans Standard Specifications Section 5-1.36D, Property and Facility Preservation and “Professional Land Surveyors’ Act,” Section 8771 of the State of California Business and Professions Code. Permittee must physically inspect the work site and locate survey monuments prior to work commencement. Monuments that might be disturbed must be referenced or reset in accordance with the standards mentioned above. If feasible, monuments should not be set within the traveled way. All monuments that must be set or perpetuated in paved surfaces must be constructed in accordance with Caltrans Standard Specifications Section 78-2, Survey Monuments, and Caltrans Standard Plan A74, Type D, or equal with prior approval of the District Surveys Engineer. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 16 of 27 Copies of Corner Record files or Record of Surveys recorded in compliance with the Business and Professions Code must be forwarded to the Caltrans District 5 Surveys Engineer at the following address: Material Testing Material testing and quality control must conform to the State Construction Manual and to the State Material Testing Manual. Testing must be performed by a certified material-testing consultant acceptable to the State and paid for by the Permittee. Material testing and quality control tests must be performed as required by the State’s Inspector and the results thereof must be made immediately available. All required construction compliance tests must be performed with the California Test Methods and must be in accordance with the latest edition of Caltrans Independent Assurance Program Manual. A Caltrans certified laboratory must also perform all tests, and all laboratory reports must be furnished to the Department’s representative at no cost to the State. Backfill Requirements All backfilling and compaction must conform to the applicable sections of the Caltrans Standard Specifications Section 19-5, Compaction. Backfilling using ponding or jetting methods are prohibited. Caltrans Standard Specification 2-sack slurry cement should be used for backfilling under all paved surfaces to expedite roadway repairs. All backfill material must comply with and must be constructed per Caltrans Standard Specifications. Backfill material must be approved by the Caltrans Permit Inspector prior to beginning excavation. Relative Compaction (90 Percent) Caltrans District 5 Survey Section Attn: David Karp 50 Higuera Street San Luis Obispo, CA 93401 Email: david.karp@dot.ca.gov Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 17 of 27 Embankment compaction beyond the roadbed or outside of structure backfill must not be less than 90 percent relative compaction unless stated otherwise in the Caltrans Standard Specifications or Caltrans Highway Design Manual. Relative Compaction (95 Percent) Relative compaction of not less than 95 percent must be obtained for a minimum depth of 0.5-foot below the grading plane for the width between the outer shoulders, whether in excavation or embankment. In addition, relative compaction of not less than 95 percent must be obtained for a minimum depth of 2.5 feet below the finished grade for the width of the traveled way plus 3 feet on each side thereof, whether in excavation or embankment. For limits of 95 percent compaction of embankment adjacent to abutments and for retaining walls without pile foundations reference Caltrans Standard Specifications Section 19-5.03B. Existing Trees and Vegetation Unless stated elsewhere in this permit or shown on the approved permit plans, this permit does not authorize the removal, severing of roots or trimming of vegetation. If work of this nature is required, a written request and approval, by the Caltrans Permit Inspector, is required in advance of performing the work. Replacement planting may be required as a mitigation measure. Excavations should be done outside of drip line to reduce tree damage and integrity of trees. If excavations must be made within the drip line of trees (or extending tree roots) along the right of way, the trenches must be hand dug, and the utility routed beneath or around root structure. Major tree roots must not be cut or damaged. Additionally, the exposed roots must be wrapped and kept moist until the excavation is back filled with the native material. Requests for exceptions must be accompanied by an Arborist’s recommendation. Archaeological/Cultural and Paleontological Requirements If potential archaeological resource, human remains, or paleontological resources are discovered during construction, do not disturb the remains or resources and immediately halt work within 150 feet of the find until a qualified professional archaeologist or paleontologist can evaluate it. Permittee must notify Caltrans District Archaeologist Krisstin Hadick, (805) 458-1238, about the discovery immediately. If the find is determined to be significant, appropriate mitigation measures must be formulated and implemented. People disturbing a site after discovery is a misdemeanor, punishable by a fine, imprisonment, or both, per California Public Resource Code 5097.5. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 18 of 27 Signs Installation of roadside signs must comply with all applicable portions of the current Caltrans Standard Plans, California Manual on Uniform Traffic Control Devices, and Caltrans policies. If exact locations of roadside and construction area signs are not shown on the project plans, post holes must be dug by hand, except where potential conflicts can be eliminated. Potential conflicts are considered eliminated when an appropriate regional notification center has performed field mark-out and no subsurface utilities are within 4 feet of the proposed post hole, or the post hole can be moved 4 feet away from subsurface utilities as located by the utility owner. Temporary and permanent signs placed within the State right of way must comply with minimum retro-reflectivity requirements of the most current of the following: Federal Highway Administration Manual on Uniform Traffic Control Devices - Section 2A.08, Caltrans Standard Specifications Section 82-2.02C, Retroreflective Sheeting. Roadside signs mounted on post(s) must be placed at locations shown on the permit plans and must be installed in compliance with the latest edition of Caltrans Standard Plan RS1 through RS4. Temporary signs mounted on barricades and barricade/sign combinations must be crashworthy. The bottom of a temporary sign mounted on a barricade, or other portable support, must be at least 1 foot above the traveled way or the existing surface at the location of placement. Proposed sign placement must not interfere with the visibility of any existing warning, regulatory, information or guide signs along the State Highway. Signs to be owned and maintained by the Permittee shall be appropriately marked on the back of the sign. A safe pedestrian passageway width of 4 feet must be maintained at any sign installation in areas normally traversed by pedestrians. The minimum passageway adjacent to a drop off, such as a curb face or gutter must be at least 5 feet. Portable Changeable Message Sign Permittee must furnish portable changeable message signs (PCMS) conforming to State Standard Specifications Section 12-3.32, “Portable Changeable Message Signs” and the California Manual on Uniform Traffic Control Devices. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 19 of 27 If edge of PCMS sign panel or PCMS extends into the paved shoulder, provide a standard shoulder closure per Caltrans Revised Standard Plan RSP T10. When PCMS message is no longer needed to inform the traveling public of construction activities, the PCMS must be removed from the State highway right of way, or the PCMS display board must be rotated away from view of the traffic lanes and shut off. Traffic Signal and Street Lighting Facilities The installation and construction of traffic signal and street lighting facilities must conform to Caltrans Standard Plans, Caltrans Standard Specifications, Traffic Manual and the Signal and Lighting Design Guide unless local standards exceed that of the State’s. All emergency vehicle preemption equipment on State owned traffic signal facilities must comply with the California Manual on Uniform Traffic Control Devices, Section 4D.27. Electrical contractor must verify in writing to the State inspector that the conduit capacity with additional conductors will be in compliance with the maximum 35% fill per the Caltrans Traffic Manual. Permittee shall be responsible to increase conduit size as necessary to meet State Standard Specifications at no cost to the State. This permit for the installation within or on Caltrans Electrical Facilities may be revoked or changed as deemed advisable or necessary by Caltrans. Only authorized Caltrans Electrical Staff must be allowed to access and operate Caltrans owned traffic signal cabinet and controller. Permittee must coordinate with the Caltrans Permit Inspector to arrange for a Caltrans Electrical staff to be present to access the traffic signal controller or to modify the operation of the controller. All traffic signal detector loops must comply with Caltrans Standard Specifications Section 86-1.02, Materials and installed per Section 87-1.03, Construction. If asphalt concrete surfacing is to be placed, the loop conductors must be installed prior to placing the uppermost layer of asphalt concrete. The conductors must be installed, as shown on the plans, in the compacted layer of asphalt concrete immediately below the uppermost layer and sealed per Caltrans Standard Specifications. If asphalt concrete surfacing is not to be placed, the loop conductor slots must be filled per Caltrans Standard Specification 86-1.02W(4) Hot-Melt Rubberized Asphalt Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 20 of 27 Sealant. Damaged traffic signal detector loop or wires must be replaced as directed by the Caltrans Permit Inspector and the attached Typical Detector Loop Array Detail. Placement of traffic signal detector loop by saw cutting asphalt or placement below the final layer of asphalt concrete must be performed to match the existing traffic signal detector loop installation conditions under the direction of the Caltrans Permit Inspector. Paving - Type A Hot Mix Asphalt (Type A HMA) The structural section of the new pavement should have been determined in accordance with pre-project R-value tests of the soil and the Traffic Index value for that portion of roadway as shown on the approved plans and must be no less than the adjacent pavement. If any question should arise concerning the R-values and Traffic Index values, the Caltrans Permit Inspector shall make the final determination regarding which values will be used. If basement soils differ from the anticipated site conditions, the Caltrans Permit Inspector may request R-value verification tests at spot locations at no cost to the State. Once excavation has been initiated to place a structural section for pavement replacement, complete excavation, placement of structural base courses, and paving must be performed in succession and continuously, without delay, until completed. Newly placed asphalt concrete roadway pavement or shoulder paving must have a minimum width of 3 feet or as directed by the State’s inspector to allow a roller compactor to compact the roadway section without contact over existing surfaces. Pavement or shoulder sawcutting to acquire the 3 feet minimum width must be done radial to or perpendicular to the lip of curb, curb face, edge of pavement, centerline or as directed by the State Inspector. Asphalt concrete must be Type A HMA, ½, ¾, or 1-inch aggregate gradation, and must conform to the specifications in Section 39, "Asphalt Concrete", of the Caltrans Standard Specifications. Where the pavement thickness shown is 0.30 foot or greater, you may place Type A HMA in multiple lifts not less than 0.15 foot each. If placing Type A HMA in multiple lifts, Aggregate gradation must comply with the requirement in the following table: Aggregate Gradation Requirements Type A HMA lift thickness Gradation Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 21 of 27 0.15 to less than 0.20 foot ½” 0.20 foot to less than 0.25 foot ¾” 0.25 foot or greater ¾ or 1” The placement and use of asphalt concrete products, which includes but not limited to, asphalt, aggregate, pavement reinforcing fabric, storage, drying, proportioning, mixing, subgrade preparation, prime coat, paint binder (tack coat), spreading and compacting must comply with Caltrans Standard Specifications – Section 39, "Asphalt Concrete”. The area to which paint binder has been applied must be closed to public traffic. Care must be taken to avoid tracking binder material onto existing pavement surfaces beyond the limits of construction. A drop-off of more than 0.15 feet will not be allowed at any time between adjacent lanes open to public traffic. At the end of each working day if a difference exists between the elevation of the existing pavement and the elevation of any excavation within 15 feet of the traveled way, material must be bladed up and compacted against the vertical cuts adjacent to the traveled way. During excavation operations, native material may be used for this purpose; however, once the placing of the structural section commences, structural material must be used. The material must be placed to the level of the top of existing pavement and tapered at a slope of 4:1 (horizontal: vertical) or flatter to the bottom of the excavation. Saw Cutting Existing Pavement Where proposed pavement matches existing roadway pavement, saw cutting of existing pavement must produce a clean, competent pavement edge to join proposed and existing pavement. Pavement edge at the saw cut line must be free of defects including cracks, separated aggregate, or failed structural roadway sections. Saw cut locations may need to be extended further into the limits of the existing pavement as necessary to obtain a competent pavement edge. The resulting, conform joint must not occur within a wheel track and may require a pavement grind and overlay to conceal the joint. The Caltrans Permit Inspector must be consulted to determine if a saw cut location is acceptable. All conform locations in open cuts or where proposed paving meets existing paving must be saw cut to a neat line the full depth of the pavement with a power-driven Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 22 of 27 saw or rock cutting excavator before removing any surfacing. The surfacing to remain in place must not be disturbed or displaced by cutting or removal methods employed. Access Holes, Pull Boxes and Valve Boxes Access holes, valve boxes and pull boxes should not be located where there is a break in grade between the pavement, gutter, curb ramps or in major traffic lanes of a cross street. All access holes, valve boxes and pull boxes must have traffic-rated covers and must be constructed flush with the adjacent surface. All access hole, valve box and pull box covers must fit into their frames without rocking. Pavement Delineation and Markings Traffic stripes and pavement markings to be removed must be removed at the locations shown on the plans and at the locations designated by the Engineer. Traffic stripes and pavement markings must be removed by any method that does not materially damage the existing pavement. Pavement marking images must be removed in such a manner that the old message cannot be identified. Where grinding is used, the pavement marking image must be removed by grinding a rectangular area. The minimum dimensions of the rectangle must be the height and width of the pavement marking. A minimum of a Caltrans Micro-surfacing may be required to correct any imperfections to the pavement as directed by the Caltrans Inspector. Residue resulting from removal operations must be removed from pavement surfaces by sweeping or vacuuming before the residue is blown by the action of traffic or wind, migrates across lanes or shoulders, or enters drainage facilities. The removal of yellow pavement delineation may contain lead. Permittee shall be responsible for having the waste material tested for the concentration of lead. The Permittee, for work performed under an encroachment permit project, shall be the generator of the hazardous material and is solely responsible to properly process and dispose of the lead laden waste material at no cost to the State. All striping and pavement markings, unless otherwise noted on the approved plans or permit, must be applied in thermoplastic material in conformance with Caltrans Standard Specifications Section 84, MARKINGS. Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 23 of 27 Surveys Traffic control and traffic control signage for each survey site must be determined by and approved by the State Inspector prior to starting work. All survey operations must be conducted off the traveled way except where necessary to cross pavements and medians. When survey operations are being conducted, the permittee must furnish, place, and maintain signs and safety equipment in accordance with the latest edition of the Caltrans Survey Manual, Caltrans Manual of Traffic Controls for Construction and Maintenance Work Zones, and California Manual on Uniform Traffic Control Devices. All personnel must wear hard hats and warning garments in the appropriate color (fluorescent/reflective versions). Work must be done during daylight hours only. Unless specifically authorized in this permit, markings within the right-of-way must be temporary. Any painted markings must be made with water-soluble paint, and other markings must be removed upon completion of the survey. Electromagnetic and radioactive equipment must be operated by certified personnel and must not interfere with radio communications or be directed toward the traveling public. Permission is also granted to park survey vehicles temporarily within the right of way, outside the shoulders, while survey work is in progress. Auxiliary support and employee vehicles must remain outside of the right of way. Survey information and assistance may be obtained upon request to: If feasible, monuments should not be set within the traveled way. All monuments that must be set or perpetuated in paved surfaces must be constructed in accordance with Caltrans Standard Specifications, Section 78-2, "Survey Monuments," and Standard Plan A74, Type D, or equal with prior approval of the District Surveys Engineer. Department of Transportation Survey Section Attn: David Karp 50 Higuera Street San Luis Obispo, CA 93401 Email: david.karp@dot.ca.gov Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 24 of 27 Any survey data requested by or furnished to Caltrans must be provided without charge. Copies of Corner Records or Records of Surveys, recorded in compliance with the Business and Professions Code, must be forwarded to the District Surveys Engineer. Measurements across traffic lanes must be made with electronic distance measuring devices utilizing non-visible light or other optical means. Permittee must provide for the safe passage of pedestrians and bicyclists. This permit does not authorize removal, cutting, trimming or damage to any tree, shrub, or plant within the highway right of way. Unless specifically authorized elsewhere in this permit, excavation of holes in paved surfaces is prohibited. Any permitted excavations must be backfilled in accordance with State standards and as directed by the State’s representative. When on the State Highway system, use W21-6 “Survey Crew” sign prior to survey area per the Caltrans Standard Plan T9 advance warning sign spacing or under the guidance of the Caltrans Permit Inspector. EXISTING FACILITIES Existing improvements must be protected or relocated as required by the work authorized by this permit. If existing improvements, including pavement markings and delineation, are damaged or their operation impaired by this work, they must be replaced or restored to the satisfaction of the Caltrans representative. Such work must be done immediately if requested by the Caltrans representative. IT SHALL BE THE PERMITTEE'S RESPONSIBILITY TO FULLY INVESTIGATE THE PROPOSED WORK AREA FOR POSSIBLE CONFLICTS WITH EXISTING UTILITIES AND FACILITIES, INCLUDING BUT NOT LIMITED TO SEWERS, ELECTRICAL CONDUCTORS, GAS LINES, WATER PIPES AND TRAFFIC SIGNAL FACILITIES. THE PERMITTEE AGREES TO ACCEPT ALL LIABILITY FOR DAMAGES DONE TO EXISTING FACILITIES CAUSED BY THE WORK AUTHORIZED UNDER THIS PERMIT. Caltrans Traffic Signals, Lighting, and Electrical Facilities Caltrans does not subscribe to underground utility locating services. It is the Permittee’s sole responsibility to investigate, locate, and mark existing Caltrans Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 25 of 27 traffic signal equipment, loops, conduits, and street lighting facilities prior to work in or between signalized intersections and street lighting facilities. If it is apparent that impacting traffic signal conduits during construction will be unavoidable Permittee must install temporary overhead wiring for the signal at Permittee’s own expense. Permittee must always have on hand all necessary equipment and personnel needed to provide traffic control at an intersection should the traffic signal malfunction. If a signal detector loop, including the portion leading to the adjacent pull box is damaged by Permittee’s operations, the entire detector loop must be replaced, in kind, within 24 hours of the occurrence. If an adjacent loop is damaged during the replacement, that loop must also be replaced. The Caltrans Inspector must be notified immediately when damage occurs. Arrangements for Caltrans Electrical operations staff must be made to have the traffic signal controller reprogrammed. Existing Utilities If existing public or private utilities conflict with the construction PROJECT, PERMITTEE will make necessary arrangements with the owners of such utilities for their protection, relocation, or removal. PERMITTEE must inspect the protection, relocation, or removal of such facilities. Total costs of such protection, relocation, or removal which STATE or PERMITTEE must legally pay, will be borne by PERMITTEE. If any protection, relocation, or removal of utilities is required, including determination of liability for cost, such work must be performed in accordance with STATE policy and procedure. PERMITTEE must require any utility company performing relocation work in the STATE's right-of-way to obtain a State Encroachment Permit before the performance of said relocation work. Any relocated utilities must be correctly located and identified on the as-built plans. WATER POLLUTION CONTROL Discharge of Storm Water and Non-Storm Water Work within State highway right-of-way must be conducted in compliance with all applicable requirements of the National Pollutant Discharge Elimination System (NPDES) permit issued to the Department of Transportation (Department), to govern the discharge of storm water and non-storm water from its properties. Work must also be in compliance with all other applicable Federal, State and Local laws and regulations, and with the Department's Encroachment Permits Manual and encroachment permit. The Department’s NPDES Permit requires the Permittee to comply and maintain, if applicable, the approved Storm Water Special Provisions for Minimal or No Impact (TR-0400). Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 26 of 27 The Contractor (permittee) must be responsible for fines assessed or levied against the Contractor or the Department as a result of the Contractor's (permittee) failure to comply with these provisions. Fines shall include civil liability fines, criminal penalties and/or damages, assessed, or levied against the Department or the Contractor, Contractor liability for failure to comply with these provisions shall also include reimbursement for payments made or costs incurred by the Department in settlement for alleged violations of the Permits, the Manuals, or applicable laws, regulations, or requirements. Costs incurred could include sums spent in lieu of fines or penalties, in mitigation or to remediate or correct violations. If an unforeseen illicit discharge is generated during construction activities and the Caltrans Permit Inspector cannot be contacted, the Permittee or Permittee's contractor must contact the Encroachment Permit Storm Water Coordinator, Jesse Cline (805) 534-3359 immediately. The Permittee or Permittee's contractor is responsible to contain and remediate the illicit discharge as directed by the Caltrans Permit Inspector or Encroachment Permit Storm Water Coordinator at no cost to the State. PROJECT COMPLETION Once work authorized by this permit has started, cancelling the permit or failure to contact the Caltrans Permit Inspector may result in the forfeiture of any remaining fee deposits. As-Built Requirement Civil Engineer in charge must also complete, stamp, and sign the attached Certification of Compliance with Americas with Disabilities Act (ADA) form TR-0405. Form must be submitted with As-Built plans or with the Notice of Completion. Upon completion of the project, the Permittee must submit “As-Built” plans to the State Inspector showing the actual location of the newly constructed facility to the nearest 0.1-foot horizontally and vertically. Plans must be stamped “As-Built”, signed, and dated by, and contain the printed name of the Permittee’s representative who was responsible for overseeing the work. Work shall be considered incomplete until the receipt of the “As-Built” plans. Permittee shall provide an electronic Adobe file format (.pdf) “As-Built” plans. If this electronic file format is not available, a hard copy of the “As-built” plans shall be provided to the Caltrans Inspector or to the Caltrans District 5 Encroachment Permits Office. Immediately following completion of the work permitted herein, the Permittee must Caltrans District 5 Permit Provisions City of San Luis Obispo 05-25-N-MC 0530 05/SLO/101/pm 27.49 Page 27 of 27 fill out and send by email the Notice of Completion attached to this permit. THANK YOU! DISTRICT 5 NOTIFICATION REQUIREMENTS The following provisions shall apply to all permit work requiring temporary lane closures or traffic detours: Temporary Lane Closures Notification of temporary lane closures or traffic detours shall be given to the State Inspector for his approval using copies of the attached form entitled, WEEKLY TRAFFIC UPDATE. Notification shall be submitted to the State Inspector by 12:00 PM (noon) Monday, prior to the week of the proposed closure or detour. Notifications submitted after the deadline cannot be approved for the upcoming week. All traffic control requiring the temporary closure of lanes or detour of traffic shall be approved in advance by the State Inspector. Ramp Closures 14 to 7 calendar days prior to an approved ramp closure, notice shall be posted at the ramp entrance using the appropriate SC6 sign. In addition, an SC8 or portable changeable message sign shall be posted for the preceding ramp the day of the closure unless otherwise approved by the Caltrans Permit Inspector. Caltrans Lane Closure System (LCS) Compliance Work authorized by this permit may require compliance and proper notification in LCS. If not identified elsewhere in this permit, you or your contractor must provide the contact information for two personnel, who will be ensuring LCS compliance during the pre-job meeting with the Caltrans Permit Inspector. Contact information shall include personnel’s full names, phone numbers and email addresses. You or your Contractor’s LCS contact will be required to properly notify the District Traffic Management Center (TMC) as described below. When a lane closure or lane shift has been identified by the Inspector with a Lane Closure ID # and Log #, you will be required to provide the TMC notification status when you are placing the lane closure, when you remove the lane closure, or when you cancel the lane closure. When providing the status of the lane closure to the TMC you will need to follow these steps, 1. Obtain the Lane Closure ID and Log # assigned for the approved scheduled lane closure event from the Caltrans Permit Inspector a minimum of one weekday prior to the closure day or duration. 2. Call the TMC/Lane Closure Phone Number (805) 549-3837 to provide the Lane Closure ID Status For a stationary closure on a traffic lane, use code: 1. 10-97 immediately before you place the 1st cone on the traffic lane 2. 10-98 immediately after you remove all of the cones from the traffic lane For a stationary closure on the shoulder, use code: 1. 10-97 immediately before you place the 1st cone after the last advance warning sign 2. 10-98 immediately after you remove the last cone before the advance warning signs For a moving closure, use code: 1. 10-97 immediately before the actual start time of the closure 2. 10-98 immediately after the actual end time of the closure For closures not needed on the authorized date, use code 10-22 within 2 hours after the authorized start time. When calling the TMC to provide the status on your lane closure you will say something to the effect of (substituting your lane closure ID number and Log number for example ID “P101CA” and Log number “1” below), x “1097”- “This is (your name, phone number) calling to provide a 1097 status to lane closure ID P101CA and log number 1. That is a 1097 for Papa 101 Charlie Alpha log number 1.” x “1098”- “This is (your name, phone number) calling to provide a 1098 status to lane closure ID P101CA, log number 1. That is a 1098 for Papa 101 Charlie Alpha log number 1.” x “1022”- “This is (your name, phone number) calling to provide a 1022 status to lane closure ID P101CA, log number 1. That is a 1022 for Papa 101 Charlie Alpha log number 1.” Failure to properly status the lane closures will result in a written warning by the Caltrans Permit Inspector on the first violation. If there is a 2nd violation, your permit may be suspended until a Contractor or new Contractor (C-31 or General Engineering A License preferred) who is experienced in traffic control and LCS notification is hired. Additional violations will result in the revocation of the permit and may impact the processing of future encroachment permit application packages. You can check your lane closure status at the following website: https://lcswebreports.dot.ca.gov/ Special Notifications If permitted activities such as road closures or traffic detours may result in significant traffic congestion, Permittee shall be responsible for coordinating advance notification to local newspapers, television and radio stations, and emergency response providers with both the State Inspector and the Caltrans Public Information Officer, telephone (805) 549-3237. Public notice may include press releases and/or traffic signing. Permittee shall complete and submit the attached form entitled PUBLIC AFFAIRS – PERMITTED ACTIVITY NOTIFICATION to the Caltrans Public Affairs Office as early as possible (One Week Ahead is Best) prior to beginning of permitted activity. Additional information or clarification may be required in the form of a written description of the activities in a format that is suitable for a press release. The form may be delivered by fax to (805) 549-3638 or emailed to the PIO contact on the form. Horizontal and Vertical Requirements for Extra-Legal Load Vehicles Permittee shall provide written notification to the Caltrans Permit Inspector or Caltrans Representative, of proposed horizontal or vertical lane restrictions which will affect extra-legal loads up to 16' wide and 18' high, or ramp closures/re-openings that may affect extra-legal loads traveling through the project area. Said notification shall be delivered to the Inspector no fewer than 25 days prior to proposed change. Permittee shall immediately notify the Caltrans Permit Inspector or Caltrans Representative as soon as the restriction is no longer present. At t e n t i o n : R o m a n o V e r l e n g i a WE E K L Y T R A F F I C U P D A T E P E R M I T S Fo r t h e W e e k o f : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Pl e a s e p r o v i d e t h i s f o r m t o y o u r d e s i g n a t e d PE R M I T I N S P E C T O R e a c h w e e k i f y o u w i l l b e pe r f o r m i n g w o r k t h a t w i l l im p a c t t r a f f i c ( l a n e c l o s u r e s , r a m p c l o s u r e s , s h o u l d e r c l o s u r e , t r a f f i c c o n t r o l , e t c . ) We e k l y T r a f f i c U p d a t e s m u s t b e r e c e i v e d b y M o n d a y 1 2 : 0 0 P M ( n o o n ) t h e w e e k p r i o r t o t h e r e q u e s t e d d a t e ( s ) o f t h e pl a n n e d t r a f f i c c o n t r o l . F a i l u r e t o m e e t t h e d e a d l i n e m a y r e s u l t i n t h e d e n i a l o f t h e r e q u e s t e d t r a f f i c c o n t r o l . Th e S t a t e Pe r m i t I n s p e c t o r m a y a l s o r e q u i r e c h a n g e s t o t h e re q u e s t e d t r a f f i c c o n t r o l p r i o r t o i t s a p p r o v a l . We a p p r e c i a t e y o u r c o o p e r a t i o n . T he s e u p d a t e s n e e d t o b e d o n e i n a t i m e l y m a n n e r t o p r o v i d e i n f o r m a t i o n t o t h e tr a v e l i n g p u b l i c w e s e r v e . T H A N K S ! ! ! ! DA T E TI M E (be g i n / e n d ) Lo c a t i o n – C r o s s S t r e e t s , C o u n t y Ro u t e , a n d P o s t M i l e ( fr o m / t o ) Im p a c t o n T r a f f i c (D e s c r i p t i o n ) Re a s o n Se n d , f a x , o r e m a i l t o : Yo u r P E R M I T I N S P E C T O R - R o m a n o V e r l e n g i a , F a x # : ( 8 0 5 ) 5 4 9 - 3 0 6 2 , E m a i l : r o m a n o . v e r l e n g i a @ d o t . c a . g o v Yo u r N a m e : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Ph o n e : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ F A X : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Co m p a n y / D e p t . : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Em a i l : _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ PE R M I T # : 05 - 2 5 - N - M C 0 5 3 0 Replace Reserved in section 12-4.02C(3)(f) with: Closure restrictions for designated holidays and special days are shown in the following table: Lane Closure Restrictions For Designated Holidays And Special Days Thu Fri Sat Sun Mon Tues Wed Thu Fri Sat Sun Mon x H xx xx xx xxx SD xx x xx H xx xx xxx SD xx xx xx H xx xx xxx SD xx x xx xx xx H xx xxx SD xx xxx xx H xx xxx SD xx xx H xx xxx SD xx x H xx xxx x xx H* xx xx xx xx xxx SD xx Legend: Refer to lane requirement charts. x The full width of the traveled way must be open for use by traffic after 1200. xx The full width of the traveled way must be open for use by traffic. xxx The full width of the traveled way must be open for use by traffic until 0800. H Designated holiday H* Thanksgiving Holiday-The full width of the traveled way must be open for use by traffic between Tuesday at 1200 until the following Monday at 0800. SD Special day PUBLIC AFFAIRS - PERMITTED ACTIVITY NOTIFICATION This Project Notification should be emailed to Public Affairs as early as possible (One Week Ahead is Best) prior to the start of any permitted activity. Please fill out this form as thoroughly as possible and use additional paper if needed. Include all information that the traveling public needs to know. TO: D5 PUBLIC AFFAIRS STAFF ATTN: Kevin Drabinski (San Luis Obispo & Santa Barbara County) kevin.drabinski@dot.ca.gov Celeste Morales (Monterey and Santa Cruz County) celeste.morales@dot.ca.gov Heidi Crawford (San Benito County) heidi.crawford@dot.ca.gov Sofia Zimkowski (Student Assistant) sofia.zimkowski@dot.ca.gov Jim Shivers (PIO Chief) jim.shivers@dot.ca.gov PIO Office Phone: (805) 549-3318 FAX: (805) 549-3326 E.A. or PERMIT NUMBER: 05-25-N-MC 0530 COUNTY, ROUTE & POSTMILE: 05-SLO-101-27.49 PERMITTED ACTIVITY LIMITS (location in miles, distance from nearest landmarks or cities, etc.): PROJECT DESCRIPTION AND PURPOSE FOR PROJECT: The scope of work within the Caltrans Right of Way includes pavement maintenance activities, which involve milling the existing roadway to a depth of 3 inches, followed by replacement with 3 inches of new asphalt and paving grid. Areas exhibiting base failures will be repaired by milling to a depth of 10 inches and replacing with 10 inches of asphalt. The concrete bridge deck surface will be sealed with Methacrylate following the removal of existing striping, using methods that will preserve the integrity of the concrete. All curb ramps within the Caltrans paving limits have been verified to comply with current ADA standards. The plans propose to replace the detectable warnings at four locations within the Caltrans Right of Way to enhance visibility and improve pedestrian safety. Additionally, the roadway striping configuration will be adjusted to enhance safety for cyclists, with green paint applied to bike lanes. Further improvements include signal modifications at the intersection of Madonna Road and the US 101 ramps. As shown on the attached plans and as directed by the permit provisions in US Highway 101 right of way at postmile 27.49 in the City and County of San Luis Obispo. PERMIT INSPECTOR: Romano Verlengia PHONE: (805) 458-3353 FAX: (805) 549-3062 CONTRACTOR: FROM (CITY) PERMIT ESTIMATE AMOUNT: ANTICIPATED DATE TO *BEGIN CONSTRUCTION: ALLOTED WORKING DAYS: ANTICIPATED *COMPLETION DATE: ANTICIPATED TRAFFIC CONTROL & HOURS OF CLOSURE: ANTICIPATED TRAFFIC DELAYS: ANY IMPACTS TO BICYCLE RIDERS/PEDESTRIANS: COMMENTS: (What else does the public need to know? Diagrams, maps also helpful.) *Please let Public Affairs know of any changes in Startup or Completion dates. STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION NOTICE OF MATERIALS TO BE USED CEM-3101 (REV 09/2015) CT#7541-3511-1 NOTICE OF MATERIALS TO BE USED INSTRUCTIONS TO PERMITTEE/CONTRACTOR Section 6 of the State Standard Specifications states that, "Before the preconstruction conference, submit material source information on a Notice of Materials to Be Used form". To avoid delay in approval of materials, the Department of Transportation must receive, in a timely manner, Form CEM-3101, "Notice of Materials to Be Used." When filing this form, please comply with the following instructions: 1. The Contract Number/Permit Number and job limits should be the same as they appear on the special provisions/encroachment permit. 2. The column headed "Contract Bid Item Number" refers to the sequential item number of the contract, if applicable. 3. The column headed "Item Code" refers to the number for which the material is to be used, if applicable. It is a six-digit number. 4. The column headed "Contract Item Description" refers to an item description of the material as described in the special provisions or an item description to be used on the permitted project. 5. The columns headed "Item Component" refer to the specific description of material to be used, not necessarily the name of the contract item. For Example: Contract Bid Item Number Item Code Contract Item Description Item Component Item Sub-Component 1 520101 Bar Reinforcing steel Coupler (service splice) Service Splice, CJP welded 6. The column headed "Manufacturer/Provider" refers to the manufacturer/fabricator of the item. List the name, address, and email of the Manufacturer/Fabricator. Also, list the name and address of the location where inspection will occur, if different from the Manufacturer/Fabricator. 7. Form CEM-3101, "Notice of Materials to Be Used," must be submitted to the resident engineer (RE). The RE will email Form CEM-3101 to the materials administrator to: MaterialsAdministratorMETS@dot.ca.gov or fax to (916) 227-7084, Attn: Materials Administrator or postal mail to: Materials Engineering and Testing Services, 5900 Folsom Blvd., Sacramento, CA 95819, MS-5. If the sources of materials are not known at the beginning of a contract, submit a Form CEM-3101, "Notice of Materials to Be Used," for a given bid item as soon as a provider is known. Multiple submissions may be necessary. Submit a Form CEM-3101, "Notice of Materials to Be Used," for all changes or revisions. When placing orders for materials that require inspection prior to shipment, be sure to indicate on your request form that state inspection is required before shipment. Re s i d e n t E n g i n e e r : Ca l t r a n s P e r m i t I n s p e c t o r - R o m a n o V e r l e n g i a D a t e : Ma t e r i a l s r e q u i r e d f o r u s e u n d e r C o n t r a c t N u m b e r (1 ) En c r o a c h m e n t P e r m i t N u m b e r - 0 5 - 2 5 - N - M C 0 5 3 0 Di s t r i c t : 05 C o u n t y : SL O R o u t e : 10 1 P o s t M i l e : 27 . 4 9 wi l l b e o b t a i n e d f r o m t h e f o l l o w i n g s o u r c e s : Co n t r a c t Bi d I t e m Nu m b e r (2 ) It e m Co d e (3 ) Co n t r a c t It e m De s c r i p t i o n (4 ) It e m Co m p o n e n t (5 ) Ma n u f a c t u r e r / P r o v i d e r Na m e a n d A d d r e s s (5 ) Ma n u f a c t u r e r / P r o v i d e r Em a i l A d d r e s s (6 ) It i s r e q u e s t e d t h a t y o u a r r a n g e f o r s a m p l i n g , t e s t i n g a n d i n s p e c t i o n o f m a t e r i a l s p r i o r t o d e l i v e r y i n a c c o r d a n c e w i t h S e c t i o n 6 o f t h e St a n d a r d S p e c i f i c a t i o n s . I t i s u n d e r s t o o d t h a t so u r c e i n s p e c t i o n d o e s n o t r e l i e v e t h e p r i m e c o n t r a c t o r o f t h e f u l l r e s p o n s i b i l i t y f o r i n c o r p o r a t i n g i n t o t h e w o r k , m a t e r i a l s t ha t c o m p l y i n a l l r e s p e c t s w i t h t h e c o n t r a c t p l a n s a n d sp e c i f i c a t i o n s , n o r d o e s i t p r e c l u d e t h e s u b s e q u e n t r e j e c t i o n o f m a t e r i a l s f o u n d t o b e u n s u i t a b l e . Co n t r a c t o r Ad d r e s s Bu s i n e s s P h o n e B u s i n e s s F a x E - M a i l A d d r e s s ST A T E O F C A L I F O R N I A • D E P A R T M E N T O F T R A N S P O R T A T I O N NO T I C E O F M A T E R I A L S T O B E U S E D CE M - 3 1 0 1 ( R E V 0 9 / 2 0 1 5 ) AD A N o t i c e Fo r i n d i v i d u a l s w i t h s e n s o r y d i s a b i l i t i e s , t h i s d o c u m e n t i s a v a i l a b l e i n a l t e r n a t e f o r m a t s . F o r a l t e r n a t e fo r m a t i n f o r m a t i o n , c o n t a c t t h e F o r m s M a n a g e m e n t U n i t a t ( 9 1 6 ) 4 4 5 - 1 2 3 3 , T T Y 7 1 1 , o r w r i t e t o Re c o r d s a n d F o r m s M a n a g e m e n t , 1 1 2 0 N S t r e e t , M S - 8 9 , S a c r a m e n t o , C A 9 5 8 1 4 . (7 ) C o p i e s : M a t e r i a l s A d m i n i s t r a t o r , M a i l S t a t i o n # 5 M a t e r i a l s E n g i n e e r i n g & T e s t i n g S e r v i c e s 5 9 0 0 F o l s o m B l v d , S a c r a m e n t o , C A 9 5 8 1 9 Ma t e r i a l s A d m i n i s t r a t o r M E T S @ d o t . c a . g o v F a x : ( 9 1 6 ) 2 2 7 - 7 0 8 4 TYPICAL PORTABLE CHANGEABLE MESSAGE SIGN PLACEMENT PORTABLE CHANGEABLE MESSAGE SIGN TRAFFIC LANE EDGE OF TRAVELED WAY 9 TRAFFIC CHANNELIZERS SPACED AT 25 FEET EDGE OF PAVEMENT SHOULDER PLAN VIEW (Not to Scale) 3 LINE MESSAGE 2 PANELS FRONT VIEW (Not to scale) TRAFFIC LANE SHOULDER EDGE OF TRAVELED WAY TRAVEL WAY 10’ MINIMUM 14.5’ MAXIMUM 7.0’ MINIMUM 200.0’ /.$ 4-0QN Pa g e 1 of 2 ST A T E O F C A L I F O R N I A • D E P A R T M E N T O F T R A N S P O R T A T I O N EN C R O A C H M E N T P E R M I T A P P L I C A N T : C O N T R A C T O R ( S ) A U T H O R I Z A T I O N F O R M DO T T R - 0 4 2 9 ( N E W 1 2 / 2 0 2 2 ) Th e P e r m i t t e e w a r r a n t s a n d r e p r e s e n t s t h e P e r m i t t e e h a s h i r e d t he f o l l o w i n g p r i m e c o n t r a c t o r ( s ) t o p e r f o r m t h e a p p r o v e d e n c r o a ch m e n t a c t i v i t i e s u n d e r En c r o a c h m e n t P e r m i t # on t h e P e r m i t t e e ’ s b e h a l f a s a g e n t s i n a c c o r d a n c e w i t h E n c r o a c h me n t P e r m i t G e n e r a l P r o v i s i o n # 4 o r A d o p t - A- H i g h w a y S p e c i a l P r o v i s i o n # 3 , w h i c h e v e r i s p a r t o f t h e E n c r o ac h m e n t P e r m i t . T h e P e r m i t t e e w a r r a n t s a n d r e p r e s e n t s t h e P e r m i tt e e h a s p r o v i d e d a c o p y o f th e E n c r o a c h m e n t P e r m i t t o t h e p r i m e c o n t r a c t o r ( s ) l i s t e d b e l o w , a n d f u r t h e r w a r r a n t s a n d r e p r e s e n t s t h a t t h e a c t i v i t i e s r e l a t ed t o t h e E n c r o a c h m e n t P e r m i t , wh e t h e r p e r f o r m e d b y t h e P e r m i t t e e o r b y t h e p r i m e c o n t r a c t o r ( s ) b e l o w o r b y a n y p e r s o n o r e n t i t y a c t i n g f o r o r o n b e h a l f o f t he P e r m i t t e e , w i l l b e p e r f o r m e d i n co m p l i a n c e w i t h a l l t e r m s , c o n d i t i o n s , s p e c i f i c a t i o n s , s t a n d a r d s, p r o v i s i o n s , a n d o t h e r r e q u i r e m e n t s o f t h e s u b j e c t E n c r o a c h m e nt P e r m i t . T h e p e r s o n s i g n i n g be l o w w a r r a n t s a n d r e p r e s e n t s su c h p e r s o n ha s a u t h o r i t y o n b e h a l f o f t h e P e r m i t t e e t o m a k e t h e w a r r a n t i e s a n d r e p r e s e n t a t i o n s c o n t a i n e d h e r e i n , a n d t o ag r e e t o a n d s o b i n d t h e P e r m i t t e e t o t h i s p a g e . Li s t o f a u t h o r i z e d p r i m e c o n t r a c t o r s f o r t h e e n c r o a c h m e n t p e r m i t: Co n t r a c t o r N a m e S c o p e o f w o r k ( T r a f f i c C o n t r o l / c i v i l wo r k e t c . ) Co n t a c t P e r s o n C o n t a c t P e r s o n ’ s I n f o r m a t i o n (P h o n e # a n d E - m a i l ) I d e c l a r e u n d e r p e n a l t y o f p e r j u r y u n d e r t h e l a w s o f t h e S t a t e of C a l i f o r n i a t h a t t h e f o r e g o i n g i s t r u e a n d c o r r e c t . Na m e o f P e r m i t t e e N a m e a n d T i t l e o f P e r s o n Si g n i n g f o r P e r m i t t e e ( P r i n t ) Si g n a t u r e D a t e 05 - 2 5 - N - M C - 0 5 3 0 Pa g e 2 of 2 ST A T E O F C A L I F O R N I A • D E P A R T M E N T O F T R A N S P O R T A T I O N EN C R O A C H M E N T P E R M I T A P P L I C A N T : C O N T R A C T O R ( S ) A U T H O R I Z A T I O N F O R M DO T T R - 0 4 2 9 ( N E W 1 2 / 2 0 2 2 ) By s i g n i n g b e l o w , e a c h p r i m e c o n t r a c t o r a c k n o w l e d g e s t h a t s u c h pr i m e c o n t r a c t o r h a s r e c e i v e d a c o p y o f E n c r o a c h m e n t P e r m i t # an d ag r e e s s u c h p r i m e c o n t r a c t o r , a n d s u c h p r i m e c o n t r a c t o r ’ s e m p l o ye e s , m a n a g e r s , o f f i c e r s , d i r e c t o r s , a g e n t s , s u b c o n t r a c t o r s , a n d s u p p l i e r s , w i l l c o m p l y w i t h , an d w i l l p e r f o r m a l l a c t i v i t i e s i n a c c o r d a n c e w i t h , a l l t e r m s , co n d i t i o n s , s p e c i f i c a t i o n s , s t a n d a r d s , p r o v i s i o n s , a n d o t h e r r e qu i r e m e n t s o f t h e En c r o a c h m e n t P e r m i t , i n c l u d i n g b u t n o t l i m i t e d t o n o t i f y i n g t h e p e r m i t i n s p e c t o r a s r e q u i r e d i n t h e E n c r o a c h m e n t P e r m i t a n d r e po r t i n g t h e l a n e cl o s u r e n o t i f i c a t i o n s p e r t h e E n c r o a c h m e n t P e r m i t G e n e r a l P r o v i si o n s ( T R - 0 0 4 5 ) . E a c h p e r s o n s i g n i n g o n b e h a l f o f e a c h p r i m e c o nt r a c t o r w a r r a n t s a n d re p r e s e n t s s u c h p e r s o n h a s t h e a u t h o r i t y t o m a k e t h e a c k n o w l e d g em e n t s , w a r r a n t i e s , a n d r e p r e s e n t a t i o n s c o n t a i n e d h e r e i n o n b e h al f o f t h e n a m e d p r i m e co n t r a c t o r , a n d h a s t h e a u t h o r i t y t o a g r e e t o a n d s o b i n d t h e n am e d p r i m e c o n t r a c t o r t o t h i s p a g e . I d e c l a r e u n d e r p e n a l t y o f p e r j u r y u n d e r t h e l a w s o f t h e S t a t e of C a l i f o r n i a t h a t t h e f o r e g o i n g i s t r u e a n d c o r r e c t . Na m e o f P r i m e C o n t r a c t o r N a m e a n d T i t l e o f P e r s o n Si g n i n g f o r C o n t r a c t o r ( P r i n t ) Si g n a t u r e D a t e Na m e o f P r i m e C o n t r a c t o r N a m e a n d T i t l e o f P e r s o n Si g n i n g f o r C o n t r a c t o r ( P r i n t ) Si g n a t u r e D a t e Na m e o f P r i m e C o n t r a c t o r N a m e a n d T i t l e o f P e r s o n Si g n i n g f o r C o n t r a c t o r ( P r i n t ) Si g n a t u r e D a t e Na m e o f P r i m e C o n t r a c t o r N a m e a n d T i t l e o f P e r s o n Si g n i n g f o r C o n t r a c t o r ( P r i n t ) Si g n a t u r e D a t e 05 - 2 5 - N - M C - 0 5 3 0 At the completion of the permitted work, please complete the form below and submit an electronic copy of this page sent by email to alan.kwong@dot.ca.gov. STATE OF CALIFORNIA x DEPARTMENT OF TRANSPORTATION NOTICE OF COMPLETION TR-0128 (REV. 6/2001) CT #7541-5529-1 PERMIT # 05-25-N-MC 0530 Permit Inspector: Romano Verlengia Dear Sir or Madam: All work authorized by the above numbered permit was completed on: DATE: SIGNATURE OF PERMITTEE: City of San Luis Obispo FM 92 1546 M ADA Notice For individuals with sensory disabilities, this document is available in alternate formats. For alternate format information, contact the Forms Management Unit at (916) 445-1233, TTY 711, or write to Records and Forms Management, 1120 N Street, MS-89, Sacramento, CA 95814 &RS\ULJKW&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ$OOULJKWVUHVHUYHG $'$1RWLFH )RULQGLYLGXDOVZLWKVHQVRU\GLVDELOLWLHVWKLVGRFXPHQWLVDYDLODEOHLQDOWHUQDWHIRUPDWV)RUDOWHUQDWHIRUPDWLQIRUPDWLRQFRQWDFWWKH)RUPV 0DQDJHPHQW8QLWDW77<RUZULWHWR5HFRUGVDQG)RUPV0DQDJHPHQW16WUHHW066DFUDPHQWR&$ &2817< 6DQ/XLV2ELVSR 5287( 32670,/( 6/2 $''5(6625675((71$0( +LJKZD\DQG0DGRQQD5RDG &,7< 6DQ/XLV2ELVSR &5266675((7'LVWDQFHDQGGLUHFWLRQIURPSURMHFWVLWH 0DGRQQD5RDG :25.72%(3(5)250('%< $33/,&$17 &2175$&725 ,67+,6$33/,&$7,21)257+(&2175$&725 6'28%/(3(50,7" 12 <(6,I<(6SURYLGHWKH3DUHQW3HUPLW1XPEHU (67,0$7(67$57'$7( (67,0$7('&203/(7,21'$7( (67,0$7('180%(52):25.,1*'$<6:,7+,167$7(+,*+:$<5,*+72):$< (67,0$7('&216758&7,21&2676:,7+,167$7(+,*+:$<5,*+72):$< +$67+(352-(&7%((15(9,(:('%<$127+(5&$/75$16%5$1&+" 12 <(6 ,I<(6ZKLFKEUDQFK" )81',1*6285&(6 )('(5$/67$7(/2&$/35,9$7(6%52$'5(3$,5$1'$&&2817$%,/,7<$&72) &$/75$16352-(&7&2'(,' $33/,&$17 65()(5(1&(87,/,7<:25.25'(5180%(5 67$7(2)&$/,)251,$'(3$570(172)75$163257$7,21 67$1'$5'(1&52$&+0(173(50,7$33/,&$7,21 755(9 Complete ALL fields, write "N/A" if not applicable. Type or print clearly. 7KLVDSSOLFDWLRQLVQRWFRPSOHWHXQWLODOOUHTXLUHPHQWVKDYHEHHQDSSURYHG 3HUPLVVLRQLVUHTXHVWHGWRHQFURDFKRQWKH6WDWH+LJKZD\ULJKWRIZD\DVIROORZV )25&$/75$1686( 75$&.,1*12 ',67&257(30 6,03/(;67$03 '$7(2)6,03/(;67$03 3DJHRI '(6&5,%(:25.72%('21(:,7+,167$7(+,*+:$<5,*+72):$<LQOLQHVRUOHVV $WWDFKFRPSOHWHVHWVRISODQVIROGHGWR[DQGDQ\DSSOLFDEOHVSHFLILFDWLRQVFDOFXODWLRQVPDSVWUDIILFFRQWUROSODQVHWF 7KHVFRSHRIZRUNZLWKLQWKH&DOWUDQV5LJKWRI:D\LQFOXGHVSDYHPHQWPDLQWHQDQFHDFWLYLWLHVZKLFKLQYROYHPLOOLQJWKHH[LVWLQJURDGZD\WR DGHSWKRILQFKHVIROORZHGE\UHSODFHPHQWZLWKLQFKHVRIQHZDVSKDOWDQGSDYLQJJULG$UHDVH[KLELWLQJEDVHIDLOXUHVZLOOEHUHSDLUHGE\ PLOOLQJWRDGHSWKRILQFKHVDQGUHSODFLQJZLWKLQFKHVRIDVSKDOW7KHFRQFUHWHEULGJHGHFNVXUIDFHZLOOEHVHDOHGZLWK0HWKDFU\ODWH IROORZLQJWKHUHPRYDORIH[LVWLQJVWULSLQJXVLQJPHWKRGVWKDWZLOOSUHVHUYHWKHLQWHJULW\RIWKHFRQFUHWH$OOFXUEUDPSVZLWKLQWKH&DOWUDQV SDYLQJOLPLWVKDYHEHHQYHULILHGWRFRPSO\ZLWKFXUUHQW$'$VWDQGDUGV7KHSODQVSURSRVHWRUHSODFHWKHGHWHFWDEOHZDUQLQJVDWIRXUORFDWLRQV ZLWKLQWKH&DOWUDQV5LJKWRI:D\WRHQKDQFHYLVLELOLW\DQGLPSURYHSHGHVWULDQVDIHW\$GGLWLRQDOO\WKHURDGZD\VWULSLQJFRQILJXUDWLRQZLOOEH DGMXVWHGWRHQKDQFHVDIHW\IRUF\FOLVWVZLWKJUHHQSDLQWDSSOLHGWRELNHODQHV)XUWKHULPSURYHPHQWVLQFOXGHVLJQDOPRGLILFDWLRQVDWWKH LQWHUVHFWLRQRI0DGRQQD5RDGDQGWKH86UDPSV D3257,212)67$7(+,*+:$<5,*+72):$<:+(5(:25.,6%(,1*352326('FKHFNDOOWKDWDSSO\ 7UDIILFODQH 6KRXOGHU 6LGHZDON 0HGLDQ $WRUQHDUDQLQWHUVHFWLRQ 0RELOHZRUN 2XWVLGHRIWKHVKRXOGHU IHHWIURPHGJHRISDYHPHQW 2WKHU E352326('75$)),&&21752/3/$16$1'0(7+2' 1RWUDIILFFRQWUROQHHGHG 6WDWH6WDQGDUG3ODQV 76KHHWV 3URMHFWVSHFLILF7UDIILF&RQWURO3ODQVLQFOXGHG 7REHVXEPLWWHGE\FRQWUDFWRU 10& 6/2SP 67$7(2)&$/,)251,$'(3$570(172)75$163257$7,21 67$1'$5'(1&52$&+0(173(50,7$33/,&$7,21 755(9 75$&.,1*12 3DJHRI $'$1RWLFH )RULQGLYLGXDOVZLWKVHQVRU\GLVDELOLWLHVWKLVGRFXPHQWLVDYDLODEOHLQDOWHUQDWHIRUPDWV)RUDOWHUQDWHIRUPDWLQIRUPDWLRQFRQWDFWWKH)RUPV 0DQDJHPHQW8QLWDW77<RUZULWHWR5HFRUGVDQG)RUPV0DQDJHPHQW16WUHHW066DFUDPHQWR&$ (;&$9$7,21 0$;'(37+LQ 0,1'(37+LQ $9*:,'7+LQ /(1*7+IW 685)$&(7<3(HJ$VSKDOWFRQFUHWHVRLOHWF $VSKDOW 3,3(6 352'8&7%(,1*75$163257(' 1$ &$55,(53,3( ',$0(7(5 0$7(5,$/LQ &$6,1*3,3( ',$0(7(5 0$7(5,$/LQ 352326(',167$//$7,210(7+2'HJ+''%RUH -DFN2SHQ&XWHWF 1$ 92/7$*(36,* ,6$&,7<&2817<2527+(538%/,&$*(1&<,192/9(',17+($33529$/2)7+,6352-(&7" '2(67+(352326('352-(&7,192/9(7+(5(3/$&(0(17$1'25$%$1'210(172)$1(;,67,1*)$&,/,7<" 12 <(6 ,I<(6SURYLGHDGHVFULSWLRQ 1$ <(6LI<(6FKHFNWKHW\SHRISURMHFW$1'DWWDFKWKHHQYLURQPHQWDOGRFXPHQWDWLRQDQGFRQGLWLRQVRIDSSURYDO 12LI12FKHFNWKHFDWHJRU\EHORZZKLFKEHVWGHVFULEHVWKHSURMHFW$1'DQVZHUTXHVWLRQV$. &200(5&,$/'(9(/230(17 %8,/',1**5$',1*27+(5 &$7(*25,&$//<(;(037 1(*$7,9('(&/$5$7,21 (19,5210(17$/,03$&75(3257 27+(5 '5,9(:$<2552$'$3352$&+5(&216758&7,21 0$,17(1$1&(255(685)$&,1* )(1&((526,21&21752/ 38%/,&87,/,7<02',),&$7,21(;7(16,216+22.836 0$,/%2;/$1'6&$3,1* )/$*66,*16%$11(56'(&25$7,2163$5$'(6$1'&(/(%5$7,216 27+(5 7KHIROORZLQJTXHVWLRQVPXVWEHDQVZHUHGZKHQD&LW\&RXQW\RURWKHUSXEOLFDJHQF\,6127LQYROYHGLQWKHDSSURYDORIWKLVSURMHFW <RXUDQVZHUVWRWKHVHTXHVWLRQVZLOODVVLVW&DOWUDQVVWDIILQLGHQWLI\LQJDQ\SK\VLFDOELRORJLFDOVRFLDORUHFRQRPLFUHVRXUFHVWKDWPD\EHDIIHFWHG E\\RXUSURSRVHGSURMHFWZLWKLQ6WDWH+LJKZD\ULJKWRIZD\DQGWRGHWHUPLQHZKLFKW\SHRIHQYLURQPHQWDOVWXGLHVPD\EHUHTXLUHGWRDSSURYH \RXUDSSOLFDWLRQIRUDQHQFURDFKPHQWSHUPLW,WLVWKHDSSOLFDQW VUHVSRQVLELOLW\IRUWKHSURGXFWLRQRIDOOUHTXLUHGHQYLURQPHQWDOGRFXPHQWDWLRQDQG VXSSRUWLQJVWXGLHVDQGLQVRPHFDVHVWKLVPD\EHFRVWO\DQGWLPHFRQVXPLQJ,ISRVVLEOHDWWDFKSKRWRJUDSKVRIWKHORFDWLRQRIWKHSURSRVHG SURMHFW$QVZHUWKHVHTXHVWLRQVWRWKHEHVWRI\RXUDELOLW\3URYLGHDGHVFULSWLRQRIDQ\<(6DQVZHUVW\SHQDPHQXPEHUHWF $ :LOODQ\H[LVWLQJYHJHWDWLRQDQGRUODQGVFDSLQJZLWKLQ6WDWH+LJKZD\ULJKWRIZD\EHGLVWXUEHG" %$UHWKHUHZDWHUZD\VHJULYHUFUHHNSRQGQDWXUDOSRRORUGU\VWUHDPEHGDGMDFHQWWRRUZLWKLQWKHOLPLWVRIWKHSURSRVHGSURMHFW" & ,VWKHSURSRVHGSURMHFWORFDWHGZLWKLQILYHPLOHVRIWKHFRDVWOLQH" ' :LOOWKHSURSRVHGSURMHFWJHQHUDWHFRQVWUXFWLRQQRLVHOHYHOVJUHDWHUWKDQGHFLEHOVG%$HJ-DFNKDPPHULQJSLOHGULYLQJ" ( :LOOWKHSURSRVHGSURMHFWLQFRUSRUDWHODQGIURPDSXEOLFSDUNUHFUHDWLRQDUHDRUZLOGOLIHUHIXJHRSHQWRWKHSXEOLF" ) $UHWKHUHDQ\UHFUHDWLRQDOWUDLOVRUSDWKVZLWKLQWKHOLPLWVRIWKHSURSRVHGSURMHFW" * :LOOWKHSURSRVHGSURMHFWLPSDFWDQ\VWUXFWXUHVEXLOGLQJVUDLOOLQHVRUEULGJHVZLWKLQ6WDWH+LJKZD\ULJKWRIZD\" + :LOOWKHSURSRVHGSURMHFWLPSDFWDFFHVVWRDQ\EXVLQHVVHVRUUHVLGHQFHV" , :LOOWKHSURSRVHGSURMHFWLPSDFWDQ\H[LVWLQJSXEOLFXWLOLWLHVRUSXEOLFVHUYLFHV" - :LOOWKHSURSRVHGSURMHFWLPSDFWDQ\H[LVWLQJSHGHVWULDQIDFLOLWLHVVXFKDVVLGHZDONVFURVVZDONVRURYHUFURVVLQJV" . :LOOQHZOLJKWLQJEHFRQVWUXFWHGZLWKLQRUDGMDFHQWWR6WDWH+LJKZD\ULJKWRIZD\" 10& 67$7(2)&$/,)251,$'(3$570(172)75$163257$7,21 67$1'$5'(1&52$&+0(173(50,7$33/,&$7,21 755(9 75$&.,1*12 3DJHRI $'$1RWLFH )RULQGLYLGXDOVZLWKVHQVRU\GLVDELOLWLHVWKLVGRFXPHQWLVDYDLODEOHLQDOWHUQDWHIRUPDWV)RUDOWHUQDWHIRUPDWLQIRUPDWLRQFRQWDFWWKH)RUPV 0DQDJHPHQW8QLWDW77<RUZULWHWR5HFRUGVDQG)RUPV0DQDJHPHQW16WUHHW066DFUDPHQWR&$ :LOOWKHSURSRVHGSURMHFWFDXVHDVXEVWDQWLDOFKDQJHLQWKHVLJQLILFDQFHRIDKLVWRULFDOUHVRXUFH\HDUVRUROGHU RUFXOWXUDOUHVRXUFH"<(6 12 LI<(6SURYLGHDGHVFULSWLRQ :LOOWKHSURSRVHGSURMHFWEHRQDQH[LVWLQJ6WDWH+LJKZD\RUVWUHHWZKHUHWKHDFWLYLW\LQYROYHVUHPRYDORIDVFHQLFUHVRXUFH"HJ$ VLJQLILFDQWWUHHRUVWDQGRIWUHHVDURFNRXWFURSSLQJRUDKLVWRULFEXLOGLQJ<(6 12 LI<(6SURYLGHDGHVFULSWLRQ ,VZRUNEHLQJGRQHRQWKHDSSOLFDQW VSURSHUW\LQDGGLWLRQWR6WDWH+LJKZD\ULJKWRIZD\"<(6 12 ,I<(6DWWDFKFRPSOHWHVHWVRIVLWHDQGJUDGLQJSODQV :LOOWKHSURSRVHGSURMHFWUHTXLUHWKHGLVWXUEDQFHRIVRLO"<(6 12 ,I<(6HVWLPDWHWKHDUHDRIGLVWXUEHGVRLOZLWKLQ6WDWH+LJKZD\ULJKWRIZD\LQDFUHV DQGHVWLPDWHWKHDUHDRIGLVWXUEHGVRLORXWVLGH6WDWH+LJKZD\ULJKWRIZD\LQDFUHV :LOOWKHSURSRVHGSURMHFWUHTXLUHGHZDWHULQJ"<(6 12 ,I<(6HVWLPDWH7RWDOJDOORQV$1'JDOORQVPRQWK7RWDOJDOORQV$1'JDOORQVPRQWK 6285&( 67250:$7(5 12167250:$7(5 6HH&DOWUDQV6:03IRUGHILQLWLRQRIQRQVWRUPZDWHUGLVFKDUJHKWWSZZZGRWFDJRYHQYVWRUPZDWHU +RZZLOODQ\VWRUPZDWHURUJURXQGZDWHUEHGLVSRVHG" 6WRUP'UDLQ6\VWHP &RPELQHG6HZHU6WRUPZDWHU6\VWHP 6WRUPZDWHU5HWHQWLRQ%DVLQ 1$ 2WKHUH[SODLQ 10& 67$7(2)&$/,)251,$'(3$570(172)75$163257$7,21 67$1'$5'(1&52$&+0(173(50,7$33/,&$7,21 755(9 75$&.,1*12 3DJHRI $'$1RWLFH )RULQGLYLGXDOVZLWKVHQVRU\GLVDELOLWLHVWKLVGRFXPHQWLVDYDLODEOHLQDOWHUQDWHIRUPDWV)RUDOWHUQDWHIRUPDWLQIRUPDWLRQFRQWDFWWKH)RUPV 0DQDJHPHQW8QLWDW77<RUZULWHWR5HFRUGVDQG)RUPV0DQDJHPHQW16WUHHW066DFUDPHQWR&$ 5($'7+()2//2:,1*&/$86(635,25726,*1,1*7+,6(1&52$&+0(173(50,7$33/,&$7,21 7KHDSSOLFDQW¶VVXEPLVVLRQRIWKLVDSSOLFDWLRQWRWKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQFRQVWLWXWHVWKHDSSOLFDQW¶VDJUHHPHQWDQG UHSUHVHQWDWLRQWKDWWKHZRUNRURWKHUDFWLYLW\FRQWHPSODWHGE\WKHHQFURDFKPHQWSHUPLWDSSOLFDWLRQVKDOOFRPSO\ZLWKDOODSSOLFDEOHVWDQGDUGV VSHFLILFDWLRQVSROLFLHVUHTXLUHPHQWVFRQGLWLRQVDQGUHJXODWLRQVRIWKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQDQGWKHDSSOLFDQWXQGHUVWDQGV WKHDSSOLFDWLRQPD\EHGHQLHGLIWKHUHLVQRQFRPSOLDQFHZLWKDQ\RIWKHDERYH$QH[FHSWLRQSURFHVVH[LVWVDQGPD\UHVXOWLQDSSURYDORID QRQFRPSOLDQWHQFURDFKPHQWLQWKHGLVFUHWLRQRIWKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQEXWWKHH[FHSWLRQSURFHVVPD\UHTXLUHDGGLWLRQDO WLPHWRFRPSOHWH7KHDSSOLFDQWXQGHUVWDQGVDQGDJUHHVDOOZRUNRURWKHUDFWLYLW\FRQWHPSODWHGE\WKHHQFURDFKPHQWSHUPLWDSSOLFDWLRQLV VXEMHFWWRLQVSHFWLRQDQGRYHUVLJKWE\WKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ7KHDSSOLFDQWXQGHUVWDQGVDQGDJUHHVHQFURDFKPHQWSHUPLW IHHVPXVWVWLOOEHSDLGLIDQDSSOLFDWLRQLVZLWKGUDZQRUGHQLHG7KHDSSOLFDQWXQGHUVWDQGVDGHQLDOPD\EHDSSHDOHGLQDFFRUGDQFHZLWK &DOLIRUQLD6WUHHWVDQG+LJKZD\V&RGH6HFWLRQDQGWKHUHODWHGUHJXODWLRQVIRXQGLQ&DOLIRUQLD&RGHRI5HJXODWLRQV7LWOH'LYLVLRQ &KDSWHU$UWLFOH 7KHDSSOLFDQWXQGHUVWDQGVDQGDJUHHVWKDWLPPHGLDWHO\XSRQLVVXDQFHRIWKHHQFURDFKPHQWSHUPLWWKHDSSOLFDQWLVERXQGE\VXEMHFWWRDQG PXVWFRPSO\ZLWKWKH(QFURDFKPHQW3HUPLW*HQHUDO3URYLVLRQV756WRUPZDWHU6SHFLDO3URYLVLRQV75DQGDQ\RWKHU DSSOLFDEOH6SHFLDO3URYLVLRQVDQG&RQGLWLRQVRIWKHHQFURDFKPHQWSHUPLW7KH(QFURDFKPHQW3HUPLW*HQHUDO3URYLVLRQV75DQGWKH 6WRUPZDWHU6SHFLDO3URYLVLRQV75DUHDYDLODEOHDWKWWSZZZGRWFDJRYWUDIILFRSVHSGRFV$SSHQGL[B.B:(%SGI,IDSDSHUFRS\LV QHHGHGRIWKH(QFURDFKPHQW3HUPLW*HQHUDO3URYLVLRQV75DQGRU6WRUPZDWHU6SHFLDO3URYLVLRQV75SOHDVHFRQWDFWWKH 'LVWULFW2IILFHRI(QFURDFKPHQW3HUPLWV7KHLUFRQWDFWLQIRUPDWLRQLVDYDLODEOHDWKWWSZZZGRWFDJRYWUDIILFRSVHSGRFV $SSHQGL[B*B:(%SGI7KH(QFURDFKPHQW3HUPLW*HQHUDO3URYLVLRQV75DQGDQ\RWKHUDSSOLFDEOH6SHFLDO3URYLVLRQVDQG &RQGLWLRQVZLOOEHSURYLGHGDVSDUWRIWKHHQFURDFKPHQWSHUPLW,QIRUPDWLRQDERXW6WRUPZDWHUUHTXLUHPHQWVLVDYDLODEOHDWWKH,QWHUQHWDGGUHVV KWWSZZZGRWFDJRYKTFRQVWUXFVWRUPZDWHU. 7KHDSSOLFDQWXQGHUVWDQGVDQHQFURDFKPHQWSHUPLWPD\EHGHQLHGUHYRNHGDQGRUDERQGPD\EHUHTXLUHGIRUQRQSD\PHQWRISULRURU SUHVHQWHQFURDFKPHQWSHUPLWIHHV$QHQFURDFKPHQWSHUPLWLVQRWDSURSHUW\ULJKWDQGGRHVQRWWUDQVIHUZLWKWKHSURSHUW\WRDQHZRZQHU (DFKRIWKHSHUVRQVSXUSRUWLQJWRH[HFXWHWKLVDSSOLFDWLRQRQEHKDOIRIWKHDSSOLFDQWDQGRURQEHKDOIRIWKHDSSOLFDQW¶VDXWKRUL]HGDJHQWRU HQJLQHHUUHSUHVHQWVDQGZDUUDQWVVXFKSHUVRQKDVIXOODQGFRPSOHWHOHJDODXWKRULW\WRGRVRDQGWRWKHUHE\ELQGDSSOLFDQWWRWKHWHUPVDQG FRQGLWLRQVKHUHLQDQGWRWKHWHUPVDQGRUFRQGLWLRQVRIWKHHQFURDFKPHQWSHUPLW$SSOLFDQWXQGHUVWDQGVDQGDJUHHVWKLVDSSOLFDWLRQPD\EH H[HFXWHGLQRQHRUPRUHFRXQWHUSDUWVHDFKRIZKLFKVKDOOEHGHHPHGDQRULJLQDOEXWDOORIZKLFKWRJHWKHUVKDOOFRQVWLWXWHRQHDQGWKHVDPH LQVWUXPHQW([HFXWHGFRSLHVRIWKLVDSSOLFDWLRQDQGRULWVFRXQWHUSDUWVPD\EHUHSURGXFHGDQGRUH[FKDQJHGE\FRS\PDFKLQHPDLOLQJ IDFVLPLOHRUHOHFWURQLFPHDQVVXFKDVHPDLODQGVXFKFRSLHVVKDOOEHGHHPHGWREHHIIHFWLYHDVRULJLQDOV 1$0(2)$33/,&$173URMHFWRU3URSHUW\2ZQHURU2UJDQL]DWLRQ +$,1*8<(1(1*,1((5&,7<2)6$1/8,62%,632 $''5(662)$33/,&$17,QFOXGH&LW\6WDWHDQG=LS&RGH 3$/0675((76$1/8,62%,632&$ (0$,/$''5(66 +1*8<(1#6/2&,7<25* 3+21(180%(5 )$;180%(5 1$0(2)$87+25,=('$*(17(1*,1((5 $/HWWHURI$XWKRUL]DWLRQLVUHTXLUHGLIGLIIHUHQWIURP ,6$/(77(52) $87+25,=$7,21$77$&+('" <(6 12 $''5(662)$87+25,=('$*(17(1*,1((5,QFOXGH&LW\6WDWHDQG=LS&RGH (0$,/$''5(66 3+21(180%(5 )$;180%(5 1$0(2)%,//,1*&217$&7 6DPHDV6DPHDV %,//,1*$''5(66:+(5(,192,&(6,6$5(72%(0$,/(',QFOXGH&LW\6WDWHDQG=LS&RGH (0$,/$''5(66 3+21(180%(5 )$;180%(5 ,KHUHE\FHUWLI\XQGHUSHQDOW\RISHUMXU\XQGHUWKHODZVRIWKH6WDWHRI&DOLIRUQLDWKDWWKHLQIRUPDWLRQLQWKLVDSSOLFDWLRQDQGDQ\GRFXPHQW VXEPLWWHGZLWKRULQVXSSRUWRIWKLVDSSOLFDWLRQDUHWUXHDQGFRUUHFWWRWKHEHVWRIP\NQRZOHGJHDQGEHOLHIDQGWKDWFRSLHVRIDQ\GRFXPHQWV VXEPLWWHGZLWKRULQVXSSRUWRIWKLVDSSOLFDWLRQDUHWUXHDQGFRUUHFWFRSLHVRIXQDOWHUHGRULJLQDOGRFXPHQWV,IXUWKHUXQGHUVWDQGWKDWLI,KDYH SURYLGHGLQIRUPDWLRQWKDWLVIDOVHLQWHQWLRQDOO\LQFRPSOHWHRUPLVOHDGLQJ,PD\EHFKDUJHGZLWKDFULPHDQGVXEMHFWHGWRILQHRULPSULVRQPHQW RUERWKILQHDQGLPSULVRQPHQW3HQDO&RGH6HFWLRQ 6,*1$785(2)$33/,&$1725$87+25,=('$*(17 35,17257<3(1$0( +$,1*8<(1 7,7/( 6HQLRU(QJLQHHU '$7( 7,7/( 10& 67$7(2)&$/,)251,$'(3$570(172)75$163257$7,21 67$1'$5'(1&52$&+0(173(50,7$33/,&$7,21 755(9 $'$1RWLFH )RULQGLYLGXDOVZLWKVHQVRU\GLVDELOLWLHVWKLVGRFXPHQWLVDYDLODEOHLQDOWHUQDWHIRUPDWV)RUDOWHUQDWHIRUPDWLQIRUPDWLRQFRQWDFWWKH)RUPV 0DQDJHPHQW8QLWDW77<RUZULWHWR5HFRUGVDQG)RUPV0DQDJHPHQW16WUHHW066DFUDPHQWR&$ ,16758&7,216 &RPSOHWH$//ILHOGVZULWH1$LIQRWDSSOLFDEOH7\SHRUSULQWFOHDUO\$OOGLPHQVLRQVPXVWEHLQ86&XVWRPDU\(QJOLVKXQLWV 3ULQW\RXUDSSOLFDWLRQVLQJOHVLGHGDQGVXEPLWDOORIWKHUHTXLUHGDWWDFKPHQWV6HH6HFWLRQ9,,$ %RIWKH(QFURDFKPHQW3HUPLW$SSOLFDWLRQ *XLGH%RRNOHWIRXQGDWKWWSZZZGRWFDJRYWUDIILFRSVHSGRFV(3B$SSOLFDWLRQB*XLGHB%RRNOHWSGI &RXQW\HJ)UHVQR6DQ)UDQFLVFR/RV$QJHOHVHWF 6WDWH+LJKZD\5RXWH1XPEHUHJ,65HWF +LJKZD\3RVWPLOHORFDWLRQRIZRUNVHHKWWSVSRVWPLOHGRWFDJRY ,IXQDEOHWRGHWHUPLQHFRQWDFWWKHDSSURSULDWH'LVWULFW(QFURDFKPHQW 3HUPLWV2IILFHIRUDVVLVWDQFHDWKWWSZZZGRWFDJRYWUDIILFRSVHS GRFV$SSHQGL[B*B:(%SGI $GGUHVVRISURMHFWVLWHLIWKHSURSHUW\KDVDSK\VLFDODGGUHVVZLWKD 1XPEHUDQG6WUHHW5RDG1DPH &LW\HJ6DFUDPHQWR5HGGLQJ,UYLQHHWF 'LVWDQFHDQGWKHGLUHFWLRQIURPWKHQHDUHVWFURVVVWUHHWWRWKHSURMHFW VLWHHJIWQRUWKRI&6WUHHW ,QGLFDWHZKHWKHUWKHZRUNZLOOEHSHUIRUPHGE\WKHDSSOLFDQW\RXURZQ IRUFHVRUE\DFRQWUDFWRU ,QGLFDWHLI\RXDUHDSSO\LQJIRUD&RQWUDFWRU V'RXEOH3HUPLWDQG SURYLGHWKH³3DUHQW3HUPLW1XPEHU´ (VWLPDWHGVWDUWGDWHIRUWKHSURSRVHGZRUN$OORZDPLQLPXPRI FDOHQGDUGD\VIURPWKHVXEPLWWDOGDWHRI\RXUDSSOLFDWLRQIRUSURFHVVLQJ (VWLPDWHGFRPSOHWLRQGDWHIRUWKHSURSRVHGZRUN (VWLPDWHGQXPEHURIZRUNLQJGD\VZLWKLQ6WDWH+LJKZD\ULJKWRIZD\ (VWLPDWHGFRQVWUXFWLRQFRVWVIRUDOOZRUNWREHGRQHZLWKLQ6WDWH +LJKZD\ULJKWRIZD\ +DVDQRWKHU&DOWUDQV EUDQFKVHHQRUUHYLHZHG\RXUSURMHFW":KLFK EUDQFK"HJ'HVLJQ3URMHFW0DQDJHPHQW5LJKWRI:D\ (QYLURQPHQWDOHWF ,GHQWLI\IXQGLQJVRXUFHVIRUWKHSURSRVHGZRUN &DOWUDQV¶3URMHFW&RGH,'LIWKLVLVD6WDWHSURMHFWFDSLWDOSURMHFWRU MRLQWYHQWXUHSURMHFW <RXUFRPSDQ\¶VUHIHUHQFHQXPEHURUXWLOLW\ZRUNRUGHUQXPEHUIRUWKLV SURMHFW 'HVFULEHWKHSURSRVHGZRUNWREHGRQHHQWLUHO\,IDSSOLFDEOHDWWDFK VL[FRPSOHWHVHWVRI)2/'('SODQVIROGHGò´;´DQGDQ\ DSSOLFDEOHVSHFLILFDWLRQVFDOFXODWLRQVPDSVHWF D,GHQWLI\SRUWLRQVRI6WDWHULJKWRIZD\ZKHUHZRUNZLOORFFXUDQG ESURSRVHGWUDIILFFRQWUROSODQVWREHXVHGLIDQ\ 0D[LPXPDQGPLQLPXPGHSWKDYHUDJHZLGWKDQGOHQJWKRIWKH H[FDYDWLRQDUHD([LVWLQJVXUIDFHW\SHHJ$VSKDOWFRQFUHWHVRLOHWF 3URGXFWEHLQJWUDQVSRUWHGHJZDWHUQDWXUDOJDVHWF &DUULHUSLSHGLDPHWHULQFKHVDQGPDWHULDOHJ6WHHO+'3(HWF &DVLQJSLSHLIDQ\GLDPHWHUDQGPDWHULDO3URSRVHGLQVWDOODWLRQ PHWKRG9ROWDJHRIHOHFWULFDOFXUUHQWRUSUHVVXUHRIOLTXLGRUJDV 5HSODFHPHQWDQGRUDEDQGRQPHQWRIDQH[LVWLQJIDFLOLW\HJ$EDQGRQLQJ SLSHDQGILOOLQJLWZLWKWZRVDFNVOXUU\FHPHQW &KHFN³<(6´LI\RXDUHJHWWLQJDSHUPLWRUDSSURYDOIURPDQRWKHUDJHQF\ &LW\&RXQW\HWFDQGDQHQYLURQPHQWDOGHWHUPLQDWLRQKDVEHHQPDGH 7KHQFKHFNWKH&DWHJRULFDOO\([HPSW1HJDWLYH'HFODUDWLRQ (QYLURQPHQWDO,PSDFW5HSRUWER[RU2WKHULIRQHKDVEHHQSUHSDUHG $WWDFKDFRS\RIWKHDSSURYHGGRFXPHQWDQGDFRS\RIWKH1RWLFHRI 'HWHUPLQDWLRQ6NLSTXHVWLRQV$. ,I\RXFKHFNHG³12´FKHFNWKHER[RIWKHDSSURSULDWHW\SHRIZRUNWREH GRQHRUFKHFN³RWKHU´DQGILOOLQWKHW\SHRIZRUNWREHGRQH$OVRDQVZHU TXHVWLRQV$. $+LVWRULFDO5HVRXUFHLQFOXGHVEXWLVQRWOLPLWHGWRDQ\REMHFWEXLOGLQJ VWUXFWXUHVLWHDUHDSODFHUHFRUGRUPDQXVFULSWWKDWKDVKLVWRULFDORU DUFKDHRORJLFDOVLJQLILFDQFHRUVLJQLILFDQFHLQWKHDUFKLWHFWXUDOHQJLQHHULQJ VFLHQWLILFHFRQRPLFDJULFXOWXUDOHGXFDWLRQDOVRFLDOSROLWLFDOPLOLWDU\RU FXOWXUDODQQDOVRI&DOLIRUQLD ,QWKLVFRQWH[WD6FHQLF5HVRXUFHLQFOXGHVEXWLVQRWOLPLWHGWRWUHHV WKDWGLVSOD\RXWVWDQGLQJIHDWXUHVRIIRUPRUDJHXQLTXHPDVVLYHURFN IRUPDWLRQVKLVWRULFEXLOGLQJVWKDWDUHUDUHH[DPSOHVRIWKHLUSHULRGVW\OH GHVLJQRUZKLFKKDYHVSHFLDODUFKLWHFWXUDOIHDWXUHVDQGGHWDLOVRI LPSRUWDQFH ,VWKHUHDQ\ZRUNEHLQJGRQHRQWKHDSSOLFDQW¶VSURSHUW\" ,QGLFDWHLIWKHSURSRVHGSURMHFWZLOOUHTXLUHWKHGLVWXUEDQFHRIVRLO,I³<(6´ HVWLPDWHWKHDUHDZLWKLQ$1'RXWVLGHRI6WDWH+LJKZD\ULJKWRIZD\LQ DFUHV ,QGLFDWHLIWKHSURSRVHGSURMHFWZLOOUHTXLUHGHZDWHULQJ,I³<(6´ HVWLPDWHYROXPHLQWRWDOJDOORQV$1'JDOORQVSHUPRQWK$OVRLQGLFDWH WKHVRXUFH6WRUPZDWHURU1RQ6WRUPZDWHUVHH&DOWUDQV6WRUPZDWHU 0DQDJHPHQW3ODQIRUGHILQLWLRQVRIQRQVWRUPZDWHUGLVFKDUJHDW KWWSZZZGRWFDJRYKTHQYVWRUPZDWHU ,QGLFDWHKRZDQ\VWRUPZDWHURUJURXQGZDWHUZLOOEHGLVSRVHGRIIURP RUQHDUWKHOLPLWVRIWKHSURSRVHGSURMHFW 1DPHRIWKHDSSOLFDQWRURUJDQL]DWLRQDSSO\LQJIRUWKHSHUPLW/LVWWKH PDLOLQJDGGUHVVHPDLODGGUHVVSKRQHDQGID[QXPEHUV 1DPHRIWKHDXWKRUL]HGDJHQWRUHQJLQHHUDFWLQJRQEHKDOIRIWKH DSSOLFDQWRURUJDQL]DWLRQ$WWDFKDOHWWHURIDXWKRUL]DWLRQVLJQHGE\WKH DSSOLFDQWRURUJDQL]DWLRQ/LVWWKHPDLOLQJDGGUHVVHPDLODGGUHVV SKRQHDQGID[QXPEHUV 1DPHRIWKHELOOLQJFRQWDFW/LVWWKHPDLOLQJDGGUHVVZKHUHLQYRLFHV DUHWREHPDLOHGHPDLODGGUHVVSKRQHDQGID[QXPEHUV 6LJQDWXUHRIWKHDSSOLFDQWRUDSSOLFDQW VDXWKRUL]HGDJHQW 1DPHRIWKHDSSOLFDQWRUDSSOLFDQW VDXWKRUL]HGDJHQW 7LWOHRZQHUSUHVLGHQWHWFRIWKHDSSOLFDQWRUDSSOLFDQW VDXWKRUL]HG DJHQW 'DWHRIWKHVLJQDWXUH STATE OF CALIFORNIA x DEPARTMENT OF TRANSPORTATION PROGRESS BILLING/PERMIT CLOSURE UNIT NUMBER PERMIT NUMBER TR-0129 (REV. 07/2013) 1245 05-25-N-MC 0530 DIST/CO/RTE/PM 05/SLO/101/pm 27.49 WORK ORDER/REFERENCE NUMBER RELATED PERMITS Higuera Corridor Complete Streets Project PERMITEE NAME City of San Luis Obispo DESCRIPTION OF WORK The scope of work within the Caltrans Right of Way includes pavement maintenance activities, which involve milling the existing roadway to a depth of 3 inches, followed by replacement with 3 inches of new asphalt and paving grid. Areas exhibiting base failures will be repaired by milling to a depth of 10 inches and replacing with 10 inches of asphalt. The concrete bridge deck surface will be sealed with Methacrylate following the removal of existing striping, using methods that will preserve the integrity of the concrete. All curb ramps within the Caltrans paving limits have been verified to comply with current ADA standards. The plans propose to replace the detectable warnings at four locations within the Caltrans Right of Way to enhance visibility and improve pedestrian safety. Additionally, the roadway striping configuration will be adjusted to enhance safety for cyclists, with green paint applied to bike lanes. Further improvements include signal modifications at the intersection of Madonna Road and the US 101 ramps. As shown on the attached plans and as directed by the permit provisions in US Highway 101 right of way at postmile 27.49 in the City and County of San Luis Obispo. INSPECTOR’S COMMENTS ACTUAL INSPECTION HOURS BY PERMIT INSPECTOR CONSTRUCTION R.E. OTHER CALTRANS UNITS Completion Notice. To the best of my knowledge all work has been completed on (date) _________________________ in compliance with this permit. Y N N/A Required final project completion records for structures. Y N N/A Structure As-Built plans Y N N/A Required final project completion records for roadway. Y N N/A Roadway As-Built plans Progress Bill Quarter No.: __________ Emailed (District 5 Asset Manager) with Number of New or Reconstructed Curb Ramp(s) Permit Cancelled Work is not complete (explain) ____________________________________________________________________________________ INSPECTOR’S SIGNATURE DATE FOR PERMIT OFFICE USE FINAL BILL RELEASE CASH DEPOSIT PERFORMANCE BOND ATTACHED PROGRESS BILL OTHER Issue Date 12/15/2025 AK ACTUAL HOURS BILLING / REFUND INFORMATION (NOT FOR BILLING) FEE TYPE: ܆ SF ܆ AX Review Hours Review Hours @ hourly rate = $ Inspection Hours Inspection Hours @ hourly rate = $ Field Work Hours Field work Hours @ hourly rate = $ COMMENTS: Equipment / Materials = $ TOTAL FEES = $ FEE DEPOSIT PAID ON (Date) $ տ Cash տ Credit Card ܆ Check (Check No.) FEE DEPOSIT PAID ON (Date) $ տ Cash տ Credit Card ܆ Check (Check No.) TOTAL DEPOSITS = $ տ Final Bill տ BALANCE DUE $ COPIES TO: տ Progress Bill տ REFUND ܆ Accounts Receivable REFUND OF CASH DEPOSIT IN LIEU OF BOND $ տ Local Agency (Agreement Work) CASH DEPOSIT PAID ON (Date) տ Maintenance ܆ Cash ܆ Credit Card ܆ Check (Check No.) NAME AND ADDRESS TO BE USED FOR BILLING/REFUND City of San Luis Obispo, Attn: Hai Nguyen 919 Palm Street, San Luis Obispo, CA 93401 PERMIT ENGINEER PHONE NUMBER DATE for VALERIE BEARD, PE (805) 549-3206 FM 94 2033 M STATE OF CALIFORNIA x DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT REPORT TR-0130 (Rev 5/94) Page of _______ Permit No. YR - MO - DA 05-25-N-MC 0530 Dist/Co/Rte/PM Total Hours in This Report 05/SLO/101/pm 27.49 SIGNATURE OF STATE REPRESENTATIVE DATE ADA Notice For individuals with sensory disabilities, this document is available in alternate formats. For information call (916) 654-6410 or TDD (916) 654-3880 or write Records and Forms Management, 1120 N Street, MS-89, Sacramento, CA 95814. FM 91 1410 M ORIGINAL TO PERMIT OFFICE STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 1 of 6 © 2018 California Department of Transportation. All rights reserved. ENCROACHMENT PERMIT GENERAL PROVISIONS TR-0045 (REV. 12/2022) 1. AUTHORITY: The California Department of Transportation (“Department”) has authority to issue encroachment permits under Division 1, Chapter 3, Article 1, Sections 660 through 734 of the Streets and Highways Code. 2. REVOCATION: Encroachment permits are revocable on five (5) business days’ notice unless otherwise stated on the permit or otherwise provided by law, and except as provided by law for public corporations, franchise holders, and utilities. Notwithstanding the foregoing, in an emergency situation as determined by the Department, an encroachment permit may be revoked immediately. These General Provisions and any applicable Special Provisions are subject to modification or abrogation by the Department at any time. Permittees’ joint use agreements, franchise rights, reserved rights or any other agreements for operating purposes in State of California (“State”) highway right-of-way may be exceptions to this revocation. 3. DENIAL FOR NONPAYMENT OF FEES: Failure to pay encroachment permit fees when due may result in rejection of future applications, denial of encroachment permits, and revocation of the encroachment permit if already issued. 4. PERMITTEE AUTHORIZATION FOR OTHERS TO PERFORM WORK: This encroachment permit allows only the Permittee and/or Permittee’s authorized contractor or agent to work within or encroach upon the State highway right-of-way, and the Permittee may not assign or transfer this encroachment permit. Any attempt to assign or transfer this encroachment permit shall be null and void. Permittee shall provide to the Department a list of Permittee’s authorized contractors/agents, in the form and at the time specified by the Department but if no time is specified then no later than the pre-construction meeting. Permittee shall keep the list current and shall provide updates to the Department immediately upon any change to the list of authorized contractors/agents, including but not limited the addition, removal, or substitution of an authorized contractor/agent, or a new address or contact information for an existing authorized contractor/agent. Permittee is responsible for the acts and/or omissions of any person or entity acting on behalf of the Permittee, even if such person or entity is not included on Permittee’s list of authorized contractors and/or agents. 5. ACCEPTANCE OF PROVISIONS: Permittee, and the Permittee’s authorized contractors and/or agents, understand and agree to accept and comply with these General Provisions, the Special Provisions, any and all terms and/or conditions contained in or incorporated into the encroachment permit, and all attachments to the encroachment permit (collectively “the Permit Conditions”), for any encroachment, work, and/or activity to be performed under this encroachment permit and/or under color of authority of this encroachment permit. Permittee understands and agrees the Permit Conditions are applicable to and enforceable against Permittee as long as the encroachment remains in, under, or over any part of the State highway right-of-way. The Permittee’s authorized contractors and/or agents, are also bound by the Permit Conditions. Non-compliance with the Permit Conditions by the Permittee’s authorized contractor and/or agent will be deemed non-compliance by the Permittee. 6. BEGINNING OF WORK: When traffic is not impacted (see General Provision Number 35), the Permittee must notify the Department’s representative two (2) business days before starting permitted work. Permittee must notify the Department’s representative if the work is to be interrupted for a period of five (5) business days or more, unless otherwise agreed upon. All work must be performed on weekdays during regular work hours, excluding holidays, unless otherwise specified in this encroachment permit. 7. STANDARDS OF CONSTRUCTION: All work performed within State highway right-of-way must conform to all applicable Departmental construction standards including but not limited to: Standard Specifications, Standard Plans, Project Development Procedures Manual, Highway Design Manual and Special Provisions. Other than as expressly provided by these General Provisions, the Special Provisions, the Standard Specifications, Standard Plans, and other applicable Departmental standards, nothing in these General Provisions is intended to give any third party any legal or equitable right, remedy, or claim with respect to the encroachment permit and/or to these General Provisions or any provision herein. These General Provisions are for the sole and exclusive benefit of the Permittee and the Department. Where reference is made in such standards to “Contractor” and “Engineer,” these are amended to be read as “Permittee” and “Department’s representative,” respectively, for purposes of this encroachment permit. 8. PLAN CHANGES: Deviations from plans, specifications, and/or the Permit Conditions as defined in General Provision Number 5 are not allowed without prior approval from the Department’s representative and the Federal Highway Administration (“FHWA”) representative if applicable. 9. RIGHT OF ENTRY, INSPECTION AND APPROVAL: All work is subject to monitoring and inspection. The United States, the State, the Department, and the Directors, officers, employees, agents, and/or contractors of the State and/or of the Department, and other state, and federal agencies, and the FHWA, through their agents or representatives, must have full access to highway STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 2 of 6 © 2018 California Department of Transportation. All rights reserved. facilities/encroachment area, at any and all times for the purpose of inspection, maintenance, activities needed for construction/reconstruction, and operation of the State highway right-of-way. Upon completion of work, Permittee must request a final inspection for acceptance and approval by the Department. The local public agency Permittee must not give final construction approval to its contractor until final acceptance and approval by the Department is obtained. 10. PERMIT AT WORKSITE: Permittee and Permittee’s authorized contractors/agents must keep the permit package and current list of authorized contractors/agents, or copies thereof, at the work site at all times and must show such documents upon request to any Department representative or law enforcement officer. If the permit package or current list of authorized contractors/agents, or copies thereof, are not kept and made available at the work site at all times, then all work must be suspended. 11. CONFLICTING ENCROACHMENTS: Permittee must yield start of work to ongoing, prior authorized work adjacent to or within the limits of the Permittee’s project site. When existing encroachments conflict with Permittee’s work, the Permittee must bear all cost for rearrangements (e.g., relocation, alteration, removal, etc.). 12. PERMITS, APPROVALS, AND CONCURRENCES FROM OTHER AGENCIES AND/OR ENTITIES: This encroachment permit is invalidated if the Permittee has not obtained all permits, approvals, and concurrences necessary and required by law, including but not limited to those from the California Public Utilities Commission (“CPUC”), California Occupational Safety and Health Administration (“Cal-OSHA”), local and state and federal environmental agencies, the California Coastal Commission, and any other public agency and/or entity having jurisdiction. Permittee is responsible for providing notice of the encroachment to, and obtaining concurrence from, any person or entity (whether public or private) affected by the scope of work described in the encroachment permit, regardless of whether such notice or concurrence is required by law; the Department is not responsible to provide such notice or obtain such concurrence. Permittee warrants all such permits, approvals, and concurrences have been obtained before beginning work under this encroachment permit. The Department may, at the Department’s discretion, require the Permittee to demonstrate that Permittee has obtained all such permits, approvals, and concurrences, and Permittee shall demonstrate this at the time and in the manner specified by the Department. 13. PEDESTRIAN AND BICYCLIST SAFETY: A safe continuous passageway must be maintained through the work area at existing pedestrian or bicycle facilities. At no time must pedestrians be diverted onto a portion of the street used for vehicular traffic. At locations where safe alternate passageways cannot be provided, appropriate signs and barricades must be installed at the limits of construction and in advance of the limits of construction at the nearest crosswalk or intersection to detour pedestrians to facilities across the street. Attention is directed to Section 7-1.04 “Public Safety,” and to Section 12-4.04 “Temporary Pedestrian Access Routes,” and to Section 16-2.02 “Temporary Pedestrian Facility,” of the Department’s Standard Specifications, and to California Vehicle Code section 21760, subdivision (c). 14. PUBLIC TRAFFIC CONTROL: The Permittee must provide traffic control protection, warning signs, lights, safety devices, etc., and take all other measures necessary for the traveling public’s safety as required by law and/or the Department. While providing traffic control, the needs of all road users, including but not limited to motorists, bicyclists and pedestrians, including persons with disabilities in accordance with the Americans with Disabilities Act, must be an essential part of the work activity. Lane, Bike Lane, Sidewalk, Crosswalk, and/or shoulder closures must comply with the Department’s Standard Specifications and Standard Plans for Temporary Traffic Control Systems & Temporary Pedestrian Access Routes, and with the applicable Special Provisions. Where issues are not addressed in the Standard Specifications, Standard Plans, and/or Special Provisions, the California Manual on Uniform Traffic Control Devices (Part 6, Temporary Traffic Control) must be followed. 15. MINIMUM INTERFERENCE WITH TRAFFIC: Permittee must plan and conduct work so as to create the least possible inconvenience to the traveling public (motorized vehicles, unmotorized vehicles such as bicycles, pedestrians, person(s) with disabilities, etc.), such that traffic is not unreasonably delayed. 16. STORAGE OF EQUIPMENT AND MATERIALS: The storage of equipment or materials is not allowed within State highway right-of-way, unless specified within the Special Provisions of this encroachment permit. If encroachment permit Special Provisions allow for the storage of equipment or materials within the State highway right-of-way, the equipment and material storage must also comply with Section 7-1.04, Public Safety, of the Department’s Standard Specifications. 17. CARE OF DRAINAGE: Permittee must provide alternate drainage for any work interfering with an existing drainage facility in compliance with the Department’s Standard Specifications, Standard Plans, and/or as directed by the Department’s representative. 18. RESTORATION AND REPAIRS IN STATE HIGHWAY RIGHT-OF-WAY: Permittee is responsible for restoration and repair of State highway right-of-way resulting from permitted work (Streets and Highways Code, section 670 et seq.). 19. STATE HIGHWAY RIGHT-OF-WAY CLEAN UP: Upon completion of work, Permittee must remove and dispose of all scraps, refuse, brush, timber, materials, etc. off the State highway right-of-way. The aesthetics of the highway must be as it was before work started or better. 20. COST OF WORK: Unless stated otherwise in the encroachment permit or a separate written agreement with the Department, the Permittee must bear all costs STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 3 of 6 © 2018 California Department of Transportation. All rights reserved. incurred for work within the State highway right-of-way and waives all claims for indemnification or contribution from the United States, the State, the Department, and from the Directors, officers, and employees of the State and/or the Department. Removal of Permittee’s personal property and improvements shall be at no cost to the United States, the State, and the Department. 21. ACTUAL COST BILLING: When specified in the permit, the Department will bill the Permittee actual costs at the currently set Standard Hourly Rate for encroachment permits. 22. AS-BUILT PLANS: When required, Permittee must submit one (1) set of folded as-built plans within thirty (30) calendar days after completion and acceptance of work in compliance with requirements listed as follows: a) Upon completion of the work provided herein, the Permittee must submit a paper set of As-Built plans to the Department’s representative. b) All changes in the work will be shown on the plans, as issued with the permit, including changes approved by Encroachment Permit Rider. c) The plans are to be prominently stamped or otherwise noted “AS-BUILT” by the Permittee’s representative who was responsible for overseeing the work. Any original plan that was approved with a Department stamp, or by signature of the Department’s representative, must be used for producing the As- Built plans. d) If construction plans include signing or striping, the dates of signing or striping removal, relocation, or installation must be shown on the As-Built plans when required as a condition of the encroachment permit. When the construction plans show signing and striping for staged construction on separate sheets, the sheet for each stage must show the removal, relocation, and installation dates of the appropriate staged striping and signing. e) As-Built plans must contain the Encroachment Permit Number, County, Route, and Post Mile on each sheet. f) The As-Built Plans must not include a disclaimer statement of any kind that differs from the obligations and protections provided by sections 6735 through 6735.6 of the California Business and Professions Code. Such statements constitute non-compliance with Encroachment Permit requirements and may result in the Department retaining Performance Bonds or deposits until proper plans are submitted. Failure to comply may also result in denial of future encroachment permits or a provision requiring a public agency to supply additional bonding. 23. PERMITS FOR RECORD PURPOSES ONLY: When work in the State highway right-of-way is within an area under a Joint Use Agreement (JUA) or a Consent to Common Use Agreement (CCUA), a fee exempt encroachment permit is issued to the Permittee for the purpose of providing a notice and record of work. The Permittee’s prior rights must be preserved without the intention of creating new or different rights or obligations. “Notice and Record Purposes Only” must be stamped across the face of the encroachment permit. 24. BONDING: The Permittee must file bond(s), in advance, in the amount(s) set by the Department and using forms acceptable to the Department. The bonds must name the Department as obligee. Failure to maintain bond(s) in full force and effect will result in the Department stopping all work under this encroachment permit and possibly revoking other encroachment permit(s). Bonds are not required of public corporations or privately-owned utilities unless Permittee failed to comply with the provisions and/or conditions of a prior encroachment permit. The surety company is responsible for any latent defects as provided in California Code of Civil Procedure section 337.15. A local public agency Permittee also must comply with the following requirements: a) In recognition that project construction work done on State property will not be directly funded and paid by State, for the purpose of protecting stop notice claimants and the interests of State relative to successful project completion, the local public agency Permittee agrees to require the construction contractor to furnish both a payment and performance bond in the local public agency’s name with both bonds complying with the requirements set forth in Section 3-1.05 Contract Bonds of the Department’s Standard Specifications before performing any project construction work. b) The local public agency Permittee must defend, indemnify, and hold harmless the United States, the State and the Department, and the Directors, officers, and employees of the State and/or Department, from all project construction related claims by contractors, subcontractors, and suppliers, and from all stop notice and/or mechanic’s lien claimants. The local public agency also agrees to remedy, in a timely manner and to the Department’s satisfaction, any latent defects occurring as a result of the project construction work. 25. FUTURE MOVING OF INSTALLATIONS: Permittee understands and agrees to relocate a permitted installation upon notice by the Department. Unless under prior property right or agreement, the Permittee must comply with said notice at the Permittee’s sole expense. 26. ENVIRONMENTAL: a) ARCHAEOLOGICAL/HISTORICAL: If any archaeological or historical resources are identified or encountered in the work vicinity, the Permittee must immediately stop work, notify the Department’s representative, retain a qualified archaeologist who must evaluate the site at Permittee’s sole expense, and make recommendations to the Department’s representative regarding the continuance of work. b) HAZARDOUS MATERIALS: If any hazardous waste or materials (such as underground storage tanks, asbestos pipes, contaminated soil, etc.) are identified or encountered in the work vicinity, the Permittee must immediately stop work, notify the Department’s representative, retain a qualified hazardous STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 4 of 6 © 2018 California Department of Transportation. All rights reserved. waste/material specialist who must evaluate the site at the Permittee’s sole expense, and make recommendations to the Department’s representative regarding the continuance of work. Attention is directed to potential aerially deposited lead (ADL) presence in unpaved areas along highways. It is the Permittee’s responsibility to take all appropriate measures to protect workers in conformance with California Code of Regulations Title 8, Section 1532.1, “Lead,” and with Cal-OSHA Construction Safety Orders, and to ensure roadway soil management is in compliance with Department of Toxic Substances Control (DTSC) requirements. c) BIOLOGICAL: If any regional, state, or federally listed biological resource is identified or encountered in the work vicinity, the Permittee must immediately stop work, notify the Department’s representative, retain a qualified biologist who must evaluate the site at Permittee’s sole expense, and make recommendations to the Department’s representative regarding the continuance of work. 27. PREVAILING WAGES: Work performed by or under an encroachment permit may require Permittee’s contractors and subcontractors to pay appropriate prevailing wages as set by the California Department of Industrial Relations. Inquiries or requests for interpretations relative to enforcement of prevailing wage requirements must be directed to the California Department of Industrial Relations. 28. LIABILITY, DEFENSE, AND INDEMNITY: The Permittee agrees to indemnify and save harmless the United States, the State, the Department, and the Directors, officers, employees, agents and/or contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors, from any and all claims, demands, damages, costs, liability, suits, or actions of every name, kind, and description, including but not limited to those brought for or on account of property damage, invasion of privacy, violation or deprivation of a right under a state or federal law, environmental damage or penalty, or injury to or death of any person including but not limited to members of the public, the Permittee, persons employed by the Permittee, and/or persons acting on behalf of the Permittee, arising out of or in connection with: (a) the issuance and/or use of this encroachment permit; and/or (b) the encroachment, work, and/or activity conducted pursuant to this encroachment permit, or under color of authority of this encroachment permit but not in full compliance with the Permit Conditions as defined in General Provision Number 5 (“Unauthorized Work or Activity”); and/or (c) the installation, placement, design, existence, operation, and/or maintenance of the encroachment, work, and/or activity; and/or (d) the failure by the Permittee, or by anyone acting for or on behalf of the Permittee, to perform the Permittee’s obligations under any part of the Permit Conditions as defined in General Provision Number 5, in respect to maintenance or any other obligation; and/or (e) any change to the Department’s property or adjacent property, including but not limited to the features or conditions of either of them, made by the Permittee or anyone acting on behalf of the Permittee; and/or (f) a defect or obstruction related to or caused by the encroachment, work, and/or activity whether conducted in compliance with the Permit Conditions as defined in General Provision Number 5 or constituting Unauthorized Work or Activity, or from any cause whatsoever. The duty of the Permittee to indemnify and save harmless includes the duties to defend as set forth in Section 2778 of the Civil Code. It is the intent of the Department and the Permittee that except as prohibited by law, the Permittee will defend, indemnify, and hold harmless as set forth in this General Provision Number 28 regardless of the existence or degree of fault or negligence, whether active or passive, primary or secondary, on the part of: the United States, the State; the Department; the Directors, officers, employees, agents and/or contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors; the Permittee; persons employed by the Permittee; and/or persons acting on behalf of the Permittee. The Permittee waives any and all rights to any type of expressed or implied indemnity from or against the United States, the State, the Department, and the Directors, officers, employees, agents, and/or contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors. The Permittee understands and agrees to comply with the obligations of Titles II and III of the Americans with Disabilities Act in the conduct of the encroachment, work, and/or activity whether conducted pursuant to this encroachment permit or constituting Unauthorized Work or Activity, and further agrees to defend, indemnify, and save harmless the United States, the State, the Department, and the Directors, officers, employees, agents, and/or contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors, from any and all claims, demands, damages, costs, penalties, liability, suits, or actions of every name, kind, and description arising out of or by virtue of the Americans with Disabilities Act. The Permittee understands and agrees the Directors, officers, employees, agents, and/or contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors, are not personally responsible for any liability arising from or by virtue of this encroachment permit. For the purpose of this General Provision Number 28 and all paragraphs herein, “contractors of the State and/or of the Department” includes contractors, and their subcontractors, under contract to the State and/or the Department. This General Provision Number 28 and all paragraphs herein take effect immediately upon issuance of this encroachment permit, and apply before, during, and after the encroachment, work, and/or activity STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 5 of 6 © 2018 California Department of Transportation. All rights reserved. contemplated under this encroachment permit, whether such work is in compliance with the Permit Conditions as defined in General Provision Number 5 or constitutes Unauthorized Work or Activity, except as otherwise provided by California law. The Permittee’s obligations to defend, indemnify, and save harmless under this General Provision Number 28 take effect immediately upon issuance of this encroachment permit and have no expiration date, including but not limited to situations in which this encroachment permit expires or is revoked, the work or activity performed under this encroachment permit is accepted or not accepted by the Department, the encroachment, work, and/or activity is conducted in compliance with the Permit Conditions as defined in General Provision Number 5 or constitutes Unauthorized Work or Activity, and/or no work or activity is undertaken by the Permittee or by others on the Permittee’s behalf. If the United States or an agency, department, or board of the United States is the Permittee, the first two paragraphs of this General Provision Number 28 (beginning “The Permittee agrees to indemnify…” and “It is the intent of the parties…”) are replaced by the following paragraph: Claims for personal injury, death, or property damage allegedly caused by the negligent or wrongful act or omission of any employee of the United States acting within the scope of their official duties are subject to the Federal Tort Claims Act, as amended, 28 U.S.C. § 1346 and § 2671 et seq. (Chapter 171). 29. NO PRECEDENT ESTABLISHED: This encroachment permit is issued with the understanding that it does not establish a precedent. 30. FEDERAL CIVIL RIGHTS REQUIREMENTS FOR PUBLIC ACCOMMODATION: a) As part of the consideration for being issued this encroachment permit, the Permittee, on behalf of Permittee and on behalf of Permittee’s personal representatives, successors in interest, and assigns, does hereby covenant and agree that: i) No person on the grounds of race, color, or national origin may be excluded from participation in, be denied the benefits of, or be otherwise subjected to discrimination in the use of said facilities. ii) That in connection with the construction of any improvements on said lands and the furnishings of services thereon, no discrimination must be practiced in the selection and retention of first-tier subcontractors in the selection of second-tier subcontractors. iii) That such discrimination must not be practiced against the public in their access to and use of the facilities and services provided for public accommodations (such as eating, sleeping, rest, recreation), and operation on, over, or under the space of the State highway right-of-way. iv) That the Permittee must use the premises in compliance with all other requirements imposed pursuant to Title 15, Code of Federal Regulations, Commerce and Foreign Trade, Subtitle A. Office of the Secretary of Commerce, Part 8 (15 C.F.R. Part 8) and as said Regulations may be amended. b) That in the event of breach of any of the above nondiscrimination covenants, the State and the Department have the right to terminate this encroachment permit and to re-enter and repossess said land and the facilities thereon and hold the same as if said permit had never been made or issued. 31. MAINTENANCE: The Permittee is responsible at Permittee’s sole expense for the encroachment, and the inspection, maintenance, repair, and condition thereof, and is responsible to ensure the encroachment does not negatively impact State highway safety, maintenance, operations, construction, State facilities, activities related to construction/reconstruction, or other encroachments. The Permittee’s obligations in the preceding sentence take effect immediately upon issuance of this encroachment permit and continue until the encroachment is entirely and permanently removed. Additional encroachment permits or approval documents may be required authorizing work related to inspection, repair, and/or maintenance activities. Contact the Department for information. 32. SPECIAL EVENTS: In accordance with subdivision (a) of Streets and Highways Code section 682.5 and 682.7, the Department is not responsible for the conduct or operation of the permitted activity, and the applicant agrees to defend, indemnify, and hold harmless the United States, the State, the Department, and the Directors, officers, employees, agents, and contractors of the State and/or of the Department, including but not limited to the Director of Transportation and the Deputy Directors, from any and all claims, demands, damages, costs, liability, suits, or actions of every name, kind and description arising out of any activity for which this encroachment permit is issued. The Permittee is required, as a condition of this encroachment permit, for any event that awards prize compensation to competitors in gendered categories, for any participant level that receives prize compensation, to ensure the prize compensation for each gendered category is identical at each participant level. (Streets and Highways Code, section 682.7.) The Permittee understands and agrees to comply with the obligations of Titles II and III of the Americans with Disabilities Act in the conduct of the event, and further agrees to defend, indemnify, and save harmless the United State, the State and the Department, and the Directors, officers, and employees of the State and/or Department, including but not limited to the Director of the Department and the Deputy Directors, from any and all claims, demands, damages, costs, liability, suits, or actions of every name, kind and description arising out of or by virtue of the Americans with Disabilities Act. 33. PRIVATE USE OF STATE HIGHWAY RIGHT-OF-WAY: State highway right-of-way must not be used for private purposes without compensation to the State. The gifting STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT GENERAL PROVISIONS Page 6 of 6 © 2018 California Department of Transportation. All rights reserved. of public property uses and therefore public funds is prohibited under the California Constitution, Article XVI, Section 6. 34. FIELD WORK REIMBURSEMENT: Permittee must reimburse the Department for field work performed by or on behalf of the Department to correct or remedy issues created by the Permittee or by others acting on behalf of the Permittee, including but not limited to hazards or damaged facilities, or to clear refuse, debris, etc. not attended to by the Permittee or by others acting on behalf of the Permittee. 35. LANE CLOSURE REQUEST SUBMITTALS AND NOTIFICATION OF CLOSURES TO THE DEPARTMENT: Lane closure request submittals and notifications must be in accordance with Section 12-4.02, and Section 12.4-04, of the Department’s Standard Specifications or as directed by the Department’s representative. The Permittee must notify the Department’s representative and the Traffic Management Center (“TMC”) before initiating a lane closure or conducting an activity that may cause a traffic impact. In emergency situations when the corrective work or the emergency itself may affect traffic, the Department’s representative and the TMC must be notified as soon as possible. 36. SUSPENSION OF TRAFFIC CONTROL OPERATION: The Permittee, upon notification by the Department’s representative, must immediately suspend all traffic lane, bike lane, sidewalk, crosswalk, and/or shoulder closure operations and any operation that impedes the flow of traffic. All costs associated with this suspension must be borne by the Permittee. 37. UNDERGROUND SERVICE ALERT (USA) NOTIFICATION: Any excavation requires compliance with the provisions of Government Code section 4216 et seq., including but not limited to notice to a regional notification center, such as Underground Service Alert (USA). The Permittee must provide notification to the Department representative at least five (5) business days before, and the regional notification center at least forty- eight (48) hours before, performing any excavation work within the State highway right-of-way. 38. COMPLIANCE WITH THE AMERICANS WITH DISABILITIES ACT (ADA): All work within the State highway right-of-way to construct and/or maintain any public facility must be designed, maintained, and constructed strictly in accordance with all applicable Federal Access laws and regulations (including but not limited to Section 504 of the Rehabilitation Act of 1973, codified at 29 U.S.C. § 794), California Access laws and regulations relating to ADA, along with its implementing regulations, Title 28 of the Code of Federal Regulations Parts 35 and 36 (28 C.F.R., Ch. I, Part 35, § 35.101 et seq., and Part 36, § 36.101 et seq.), Title 36 of the Code of Federal Regulations Part 1191 (36 C.F.R., Ch. XI, Part 1191, § 1119.1 et seq.), Title 49 of the Code of Federal Regulations Part 37 (49 C.F.R., Ch. A, Part 37, § 37.1 et seq.), the United States Department of Justice Title II and Title III for the ADA, and California Government Code section 4450 et seq., which require public facilities be made accessible to persons with disabilities. Notwithstanding the requirements of the previous paragraph, all construction, design, and maintenance of public facilities must also comply with the Department’s Design Information Bulletin 82, “Pedestrian Accessibility Guidelines for Highway Projects” and Standard Plans & Specifications on “Temporary Pedestrian Access Routes.” 39. STORMWATER: The Permittee is responsible for full compliance with the following: a) For all projects, the Department’s Storm Water Program and the Department’s National Pollutant Discharge Elimination System (NPDES) Permit requirements under Order No. 2012-0011-DWQ, NPDES No CAS000003; and b) In addition, for projects disturbing one acre or more of soil, with the California Construction General Permit Order No. 2009-0009-DWQ, NPDES No CAS000002; and c) In addition, for projects disturbing one acre or more of soil in the Lahontan Region with Order No. R6T-2016- 0010, NPDES No CAG616002. d) For all projects, it is the Permittee’s responsibility to install, inspect, repair, and maintain all facilities and devices used for water pollution control practices (Best Management Practices/BMPs) before performing daily work activities. STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. PEDESTRIAN SAFETY (MCP) In addition to the attached Encroachment Permit General Provisions (TR-0045), the following special provisions are also applicable: 1. When the work area encroaches upon a sidewalk, walkway, or crosswalk area, special consideration must be given to pedestrian safety. Protective barricades, fencing, handrails and bridges, together with warning and guidance devices and signs must be utilized so that the passageway for pedestrians, especially blind and other physically handicapped, is safe and well defined and shown on the approved permit plan. 2. Pedestrian walkways and canopies within State Right of Way shall comply with the requirements of the applicable local agency or of the latest edition of the Uniform Building Code whichever contains the higher standards. STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. SURVEYS (SV) In addition to the attached Encroachment Permit General Provisions (TR-0045), the following special provisions are also applicable: 1. Two days before work is started under this permit, contact _________________ concerning the permittee’s operation. 2. All survey operations shall be conducted off the traveled way except where necessary to cross pavements and medians. 3. When survey operations are being conducted, the permittee shall furnish, place and maintain signs and safety equipment in accordance with the latest edition of the "California Manual on Uniform Traffic Control Devices” (Part 6, Temporary Traffic Control). 4. All personnel shall wear hard hats and orange vests, shirts or jackets as appropriate. Any painted markings shall be made with water soluble paint. 5. Permission is also granted to park survey vehicles temporarily within the right of way, outside the shoulders, while survey work is in progress. 6. SURVEY WORK IS PROHIBITED ON FREEWAYS. 7. Survey information and assistance may be obtained upon request to: Survey Section, Department of Transportation, . STATE OF CALIFORNIA - DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT STEEL PLATE BRIDGING UTILITY PROVISIONS TR -0157 (Rev. 04/2018) To accommodate excavation work, steel plate bridging may be necessary. All conditions for use of steel plate bridging should be set forth in the special provisions. Consideration of steel plate bridging should take into account the following factors: 1. Traffic speed. 2. Traffic Volume and Composition. 3. Duration and dimensions (width & daily estimated lengths) of the proposed excavation. 4. Weather conditions. When backfilling operations of an excavation in the traveled way, whether transverse or longitudinal, cannot be properly completed within a work day, steel plate bridging with a non- skid surface and shoring (see Trenching & Shoring) may be required to preserve unobstructed traffic flow. In such cases, the following conditions shall apply: 1. Steel plate bridging on freeways is not allowed. 2. Steel plates used for bridging must extend a minimum of 12" beyond the edges of the trench. 3. Steel plate bridging shall be installed to operate with minimum noise. 4. The trench shall be adequately shored, (as mentioned in Section 603.6B-2 of the Encroachment Permits Manual) to support the bridging and traffic loads. 5. Temporary paving with cold asphalt concrete shall be used to feather the edges of the plates, if plate installation by Method (2) described below, is used. 6. Bridging shall be secured against displacement by using adjustable cleats, shims, or other devices. As required by the district, steel plate bridging and shoring shall be installed using either Method (1) or (2): Method 1 For speeds of 45 MPH or greater: The pavement shall be cold planed to a depth equal to the thickness of the plate and to a width and length equal to the dimensions of the plate. Approach plate(s) and ending plate (if longitudinal placement) shall be attached to the roadway by a minimum of 2 dowels pre-drilled into the corners of the plate and drilled 2" into the pavement. Subsequent plates are to be butted and tack welded to each other. Method 2 For Speeds less than 45 mph: Approach plate(s) and ending plate (if longitudinal placement) shall be attached to the roadway by a minimum of 2 dowels pre-drilled into the corners of the plate and drilled 2" into the pavement. Subsequent plates are to be butted and tack welded to each other. Fine graded asphalt concrete shall be compacted to form ramps, maximum slope 8.5 % with a minimum 12" taper to cover all edges of the steel plates. When steel plates are removed, the dowel holes in the pavement shall be backfilled with either graded fines of asphalt concrete mix, concrete slurry, epoxy or an equivalent that is satisfactory to the Caltrans' representative. The permittee is responsible for maintenance of the steel plates, shoring, asphalt concrete ramps, and ensuring that they meet minimum specifications. Unless specifically noted or granted in the special provisions, or approved by the State representative, steel plate bridging shall not exceed 4 consecutive working days in any given week. Backfilling of excavations shall be covered with a minimum 3" temporary layer of cold asphalt concrete. The following table shows the advisory minimal thickness of steel plate bridging required for a given trench width (A-36 grade steel, designed for HS20-44 truck loading per Caltrans Bridge Design Specifications Manual). Trench Width Minimum Plate Thickness 10” ½” 1’-11” ¾” 2’-7” 7/8” 3’-5” 1” 5’-3” 1 ¾” NOTE: For spans greater than 5'-3", a structural design shall be prepared by a California registered civil engineer. All steel plates within the right of way whether used in or out of the traveled way shall be without deformation. Inspectors can determine the trueness of steel plates by using a straight edge and should reject any plate that is permanently deformed. Steel plates used in the traveled portion of the highway shall have a surface that was manufactured with a nominal Coefficient Of Friction (COF) of 0.35 as determined by California Test Method 342 (See Appendix H, Encroachment Permits Manual). If a different test method is used, the permittee may utilize standard test plates with known coefficients of friction available from each Caltrans District Materials Engineer to correlate skid resistance results to California Test Method 342. Based on the test data, the permittee shall determine what amount of surface wear is acceptable, and independently ascertain when to remove, test, or resurface an individual plate. Caltrans Inspectors should not enforce plate removal unless it is permanently deformed or delivered without the required surfacing. However, an inspector should document in a diary all contacts with the contractor. A “Rough Road” (W8-8) sign and a “Steel Plate Ahead” (W8- 24) sign with black lettering on an orange background must be used in advance of steel plate bridging along with the required construction area signs. These signs must be used along with any other construction area signs. Surfacing requirements are not necessary for steel plates used in parking strips, on shoulders not used for turning movements, or on connecting driveways, etc., not open to the public. STATE OF CALIFORNIA DEPARTMENT OF TRANSPORTATION Page 1 of 3 ENCROACHMENT PERMIT SPECIAL PROVISIONS STORMWATER SPECIAL PROVISIONS FOR MINIMAL OR NO IMPACT (SWSP) TR-0400 (Rev. 09/2024) 1. GENERAL: The purpose of these Special Provisions is to provide the Permittee with specifications for water pollution control to minimize, prevent, or control the discharge of material into the air, surface waters, groundwater, and storm sewers owned by the State or local agencies. These provisions are not intended to take the place of the Caltrans Water Pollution Control Program (WPCP) for projects where soil disturbance from work activities ranging from more than a quarter of an acre to less than one acre, or work activities of one acre or more subject to the pr eparation of the Caltrans Storm Water Pollution Prevention Plan (SWPPP). These provisions must be included with the permit for projects that require an Erosion and Sediment Control Plan (ESCP). The Permittee must comply with the following Special Provisions and the direction of the State Representative. All Stormwater Best Management Practices (BMPs) must conform to Section 13 Water Pollution Control of the Caltrans’ Standard Specifications. 2. NPDES REQUIREMENTS: The Permittee must be responsible for full compliance with the Caltrans Storm Water Program and the Caltrans National Pollutant Discharge Elimination System (NPDES) Permit requirements (Order 2022-0033-DWQ, NPDES No. CAS000003, and any amendments and/or subsequent orders). Projects in construction with active waste discharge identification number (WDID number) may continue their coverage with the California Construction General Permit CGP (Order 2009-0009- DWQ, NPDES No. CAS000002, and any amendments and/or subsequent orders) until 9/1/2025. Privately funded projects may not extend their 2009 CGP regulatory coverage and are responsible for compliance with the CGP (Order WQ 2022-0057- DWQ NPDES No. CAS000002) after 9/1/2023. It is the Permittee’s responsibility to install, inspect, and repair or maintain facilities and devices used for water pollution control practices (BMPs) before performing daily work activities. Installation, inspection and maintenance responsibilities on the job site include: 1) soil stabilization materials in work areas that are inactive or prior to storm events, 2) water pollution control devices to control sediment and erosion, 3) implementation of spill and leak prevention procedures for chemical and hazardous substances stored on the job site, 4) material storage, 5) stockpile management, 6) waste management, 7) non- stormwater management, 8) water conservation, 9) tracking controls, and 10) illicit connection, illegal discharge detection and reporting. The Permittee must report to the State Representative when discharges enter receiving waters, adjacent property, and drainage systems. The Permittee must also address any illicit discharges or illegal dumping prior to start of daily work schedule by cleaning them up. Copies of written notices or orders from the Regional Water Quality Control Board or other regulatory agency must be provided to the State Representative within forty-eight (48) hours of reported activity. For additional information on stormwater compliance, visit the State Water Resources Control Board’s Storm Water Program. 3. RESPONSIBILITY FOR DEBRIS REMOVAL: The Permittee must be responsible for preventing project related sediment, trash, debris, and other construction waste from entering the street, storm drains, drainage swales, stormwater conveyance infrastructure, local creeks, or any other bodies of water. All existing treatment BMP’s (TBMPs) must be protected in place. If an existing TBMP is damaged by the Permittee, the Permittee is responsible for complete repair to a satisfactory condition determined by the State Representative. 4. SPOILS AND RESIDUE: The Permittee must vacuum any saw-cut concrete waste material, debris, residue, etc. No spoils, debris, residue, etc. must be washed into a drainage system. The Permittee must ensure that Portland cement concrete and asphalt concrete grindings are not stockpiled or used in a manner that may result in an unauthorized stormwater discharge to waters of the state. 5. SWEEPING: Sweep paved roads at construction entrance and exit locations and surrounding paved areas daily within the job site during: 1) clearing and grubbing, 2) earthwork, 3) trenching, 4) soil disturbance, 5) pavement grinding and/or cutting, and 6) after observing tracking of material onto or off the State property. Minimize the amount of dust particles during sweeping activities, ensuring that the levels do not exceed the standards set by local air quality control districts or the EPA's National Ambient Air Quality standards. Use wet-vacuum whenever dust generation is excessive, or sediment pickup is ineffective. Roadways or work areas must not be washed down with water. Street sweeping operations m ust conform to Section 13 Water Pollution Control of the Caltrans’ Standard Specifications. 6. VEHICLES AND EQUIPMENT: The Permittee must prevent all vehicles, equipment, etc. from leakage or mud tracking onto roadways. If leaks cannot be repaired immediately, remove the vehicle or equipment from the job site. If vehicle or equipment cannot be immediately removed from job site, install secondary containment to contain spill and prevent illicit non-stormwater discharge. 7. MAINTENANCE AND FUELING OF VEHICLES AND EQUIPMENT: Maintenance and fueling of equipment must not result in any pollution at the job site. The Permittee must immediately clean up spills/leaks, and properly dispose of contaminated soil and materials. All maintenance and fueling should be conducted at an appropriate facility that is feasible. All maintenance and fueling which must occur onsite STATE OF CALIFORNIA DEPARTMENT OF TRANSPORTATION Page 2 of 3 ENCROACHMENT PERMIT SPECIAL PROVISIONS shall be conducted as far away as practical from drain inlets, water bodies, and other stormwater conveyance systems. 8. CLEANING VEHICLES AND EQUIPMENT: Limit vehicle and equipment cleaning or washing at the job site except what is necessary to control vehicle tracking or hazardous waste. All equipment must be sanitized prior to mobilization to limit the spread of invasive plant species. The Permittee must clean all equipment within a bermed area or over a drip pan large enough to prevent run-off. Notify the Engineer before cleaning vehicles and equipment at the job site with soap, solvents, or steam. Any water from this operation must be collected and disposed of at an appropriate site. Containment berms or dikes must be used for fueling, washing, maintaining and washing vehicles or equipment in outside areas. Containment must be performed at least one hundred (100) feet from concentrated flows of storm water, drainage courses, and storm drain inlets if within a flood plain, otherwise at least fifty (50) feet if outside the floodplain. Keep adequate quantities of absorbent spill cleanup material and spill kits in the fueling or maintenance area and on fueling trucks. 9. DIESEL FUELS: The use of diesel fuel from petroleum or other fossil fuel as a form-oil or solvent is not allowed. 10. WEATHER CONDITIONS AT WORKSITE: Any activity that generates fine particles or dust (e.g., Saw cutting, earthwork, sanding, etc.), which could be carried off-site by stormwater, must be conducted during dry weather conditions to avoid immediate mobilization into the drainage system. 11. WIND EROSION PROTECTION: The use of Wind Erosion BMPs must be deployed year-round in instances where dust or fine particles could be transported off site. Potential wind erosion BMPs may include wind fence, water application, gravel, and/or hydro-mulch. 12. HOT MIX ASPHALT: Runoff from washing hot mix asphalt must not enter any drainage conveyances or receiving waters. 13. PROTECTION OF DRAINAGE FACILITIES: The Permittee must protect/cover gutters, ditches, drainage courses, and inlets with gravel bags, fiber rolls, State approved fabric filters, etc., to the satisfaction of the State Representative during grading, paving, sealing, saw-cutting, grooving and grinding, or any other activity which may result in an illicit discharge. All materials must conform to Section 13- 6.02 Materials for Water Pollution Control of the Caltrans’ Standard Specifications. No such protection measures must cause an obstruction to the traveling public. The Permittee must implement spill and leak prevention procedures for chemicals and hazardous substances stored on the job site (including secondary containment requirements) in accordance with Section 13-4.03B Spill Prevention and Control and for leaks and spills from vehicles and equipment each day of use in accordance with Section 13-1.03C Inspections for Water Pollution Control and Section 14-11 Hazardous Waste and Contamination for Environmental Stewardship of the Caltrans’ Standard Specifications. 14. PAINT: Clean water-based and oil-based paint from brushes or equipment within a contained area to prevent contamination of soil, receiving waters, or storm drain systems. Handle and dispose of paints, thinners, solvents, residues, and sludges that cannot be recycled or reused as hazardous waste under section 14-11. When thoroughly dry, dispose of dry latex paint, paint cans, used brushes, rags, absorbent materials, and drop cloths as solid waste under section 14-10. 15. CONSTRUCTION MATERIALS AND MATERIAL MANAGEMENT: Materials necessary for erosion and sediment control must be stockpiled on site at convenient locations to facilitate prompt installation. Such materials must be implemented at all inactive disturbed areas, and prior to all qualifying rain events. A "Qualifying Precipitation Event" (QPE) is defined as a forecast with a 50% or greater probability of precipitation that results in 0.5 inches or more of rain within a 24-hour period. Do not allow soil, sediment, or other debris from stockpiles to enter storm drains, open drainages, or watercourses. Minimize stockpiles of all construction materials, including, but not limited to; pressure treated wood, asphalt concrete, cold mix asphalt concrete, concrete, grout, cement containing premixes, and mortar. All stockpiling of such materials must conform to Section 13-4.03C(2) Material Storage and Section 13-4.03C(3) Stockpile Management for Water Pollution Control of the Caltrans’ Standard Specifications. 16. CONCRETE EQUIPMENT: Concrete equipment must be washed in a designated washing area in a way that does not contaminate soil, receiving waters, or storm drain systems. Any concrete washout activities which result in compromised containment must be cleaned and disposed of immediately. All Designated concrete facilities, including equipment, washout areas must be contained during Qualifying Precipitation Events (QPEs) marked by clearly visible signage throughout the project area. 17. EXISTING VEGETATION: Established existing vegetation is the best form of erosion control. Minimize disturbance to existing vegetation. Fenced barriers may serve as an adequate buffer to prevent traffic across existing vegetation. Damaged or removed vegetation must be replaced as directed by the State Representative. 18. SOIL DISTURBANCE: Soil disturbing activities must be avoided during the wet weather season. If construction activities during wet weather are allowed in the permit, all necessary erosion control and soil stabilization measures must be implemented in advance of soil disturbing activity. All temporary relocation of BMPs must be completed at the end of each working day and prior to each Qualifying Precipitation Event with a 50% or greater probability of precipitation that results in 0.5 inches or more of rain within a 24-hour period. Silt and debris shall be removed from linear barriers as part of the regular inspection schedule and as deemed necessary by the State Representative. STATE OF CALIFORNIA DEPARTMENT OF TRANSPORTATION Page 3 of 3 ENCROACHMENT PERMIT SPECIAL PROVISIONS 19. SLOPE STABILIZATION AND TRACKING CONTROL: Consider a certified expert in Erosion and Sediment Control in cases where slopes are disturbed or during implementation of temporary road construction for equipment and material access to the project. The Permittee is directed to comply with Section 13.5 Temporary Soil Stabilization, Section 13.6 Temporary Sediment Control, Section 13.7 Temporary Tracking Control and Section 21 Erosion Control of the Caltrans’ Standard Specifications for construction during application of temporary soil stabilization and sediment/tracking control measures to minimize impacts to the soil surface. Temporary construction entrances/exits are required to be stabilized and may include gravel, rumble plates, and/or FODS. Erosion control blankets, temporary mulch, soil binders, tackifier, fiber, seed, straw, temporary covers, rigid plastic, gravel bag barriers, sediment filter bags, temporary check dams, drainage inlet protection, fiber rolls and/or silt fences may be required down slope and on temporary construction roads and entrances until permanent soil stabilization is established. Consult with manufacturer specifications regarding maintenance frequency of sediment controls. All controls must be maintained to ensure proper functionality. The Permittee must limit the use of plastic materials when more sustainable, environmentally friendly alternatives exist or when environmental regulations prohibit their use within the project. 20. STOCKPILES: All stockpiled materials must be stored at least one hundred (100) feet from concentrated flows of storm water, drainage courses, and storm drain inlets if within a flood plain, otherwise at least fifty (50) feet if outside the floodplain. All stockpiles must be covered and protected with a temporary perimeter sediment barrier if inactive or prior to each Qualifying Precipitation Event with a 50% or greater probability of precipitation that results in 0.5 inches or more of rain within a 24-hour period. A stockpile is considered inactive after fourteen (14) days without addition or subtraction. Additionally, cold mix stockpiles must be stored on an impermeable surface and covered with nine (9) mil plastic to prevent contact with water. Minimize stockpiling of materials on the job site. Manage stockpiles by implementing the water pollution control practices in Section 13--4.03C(3) Stockpile Management for Water Pollution Control of the Caltrans’ Standard Specifications for construction. Demolished material must not be allowed to enter storm drain systems and receiving waters. Use authorized covers and platforms to collect debris. Use attachments on equipment to catch debris during all demolition activities. Empty debris-catching devices daily and handle debris in accordance with Section 13-4.03D Waste Management for Water Pollution Control of the Caltrans’ Standard Specifications for construction. 21. DISCOVERY OF CONTAMINATION: The State Representative must be notified in case any unusual discoloration, odor, or texture of ground water, is found in excavated material. Additionally, the State Representative must be notified if abandoned, underground tanks, pipes, or buried debris are encountered. 22. SANITARY AND SEPTIC WASTE: Do not bury or discharge wastewater from a sanitary or septic system within the highway. A sanitary facility discharging into a sanitary sewer system must be properly connected and free from leaks. Place a portable sanitary facility at least 50 feet away from storm drains, receiving waters, and flow lines. The Permittee must comply with local health agency regulations if using an on-site disposal system. 23. LIQUID WASTE: Prevent job site liquid waste from entering storm drain systems and receiving waters. Drilling slurries, grease or oil-free wastewater or rinse water, dredging, and wash water or rinse water running off a surface or other non-storm water liquids not covered under separate wastewater permits must be held in structurally sound, leak-proof containers, such as portable bins or portable tanks. Store containers at least fifty (50) feet away from moving vehicles, equipment, concentrated flows of storm water, drainage courses, and storm drain inlets. Liquid waste may require testing to determine hazardous material content prior to disposal. All measures must conform to section 13--4.03D(5) Liquid Waste for Water Pollution Control of the Caltrans’ Standard Specifications for construction. 24. WATER CONTROL AND CONSERVATION: Manage water use in a way that will prevent erosion and discharge of pollutants into storm drain systems and receiving waters. Direct all runoff into areas where it can infiltrate. 25. PILE DRIVING: Keep spill kits and cleanup materials at pile driving locations. Park pile driving equipment over drip pans, absorbent pads, or plastic sheeting with absorbent material, and away from stormwater run-on when not in use. In the event of oil/grease leaks and spills from pile driving activities, immediately contain and dispose of all contaminated materials. 26. DEWATERING: Dewatering consists of discharging accumulated storm water, groundwater, or surface water from excavations or temporary containment facilities. All dewatering operations must comply with the latest Caltrans guidelines including the Field Guide for Construction Site Dewatering. Contact the State Representative for approval of dewatering discharge by infiltration or evaporation, otherwise, any effluent discharged into a permitted storm water system requires approval from the Regional Water Quality Control Board. Prior to the start of dewatering, the Permittee must provide the State Representative with a dewatering and discharge work plan that complies with Section 13-4.03G Dewatering for Water Pollution Control of the Caltrans’ Standard Specifications for construction. Work plan also references guidelines and BMPs in the CGP and the Field Manual for Construction Site Dewatering. A 24-hour email notification of dewatering discharge to the Regional Water Board, including the implemented SWPPP and BMPs, is required by Attachment J of the CGP. STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. TRAFFIC STRIPING, MARKINGS, AND SIGNS In addition to the attached Encroachment Permit General Provisions (TR-0045), the following special provisions are also applicable: 1. Traffic striping, pavement markings and signs shall be furnished and placed by the permittee and the cost shall be borne by the permittee. Where new asphalt concrete has been placed, painted striping and pavement markings shall be installed within 24-hours. Where shown on the plans, after thirty (30) days curing time, thermoplastic materials shall be applied in compliance with Section 84 of the Standard Specifications. 2. Roadside signs shall be placed at locations shown on the permit plans and shall be installed in compliance with the latest edition of Caltrans Standard Plans. 3. Permittee shall furnish to State's representative a completed Form CEM-3101 "Notice of Materials to be Used," and approval of the material used shall be obtained prior to its installation. STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. UTILITY UNDERGROUND PROVISIONS (UG) TR-0163 (Rev. 07/2023) In addition to the attached Encroachment Permit General Provisions (TR-0045), the following special provisions are also applicable: High priority utilities, pressurized facilities, pipes or ducts six (6) inches or larger in diameter, or placement of multiple pipes or ducts regardless of diameters are required to be encased on both conventional and access-controlled State highway right-of-way. An exception to this encasement policy may be allowed on a case-by-case basis with the “Uncased High-Pressure Natural Gas Pipeline” Special Provisions (TR-0158). A “High Priority Utility” is defined as: 1) natural gas pipelines greater than six (6) inches in diameter, or with normal operating pressures greater than sixty (60) psig; 2) petroleum pipelines; 3) pressurized sanitary sewer pipelines; 4) high- voltage electric supply lines, conductors, or cables that have a potential to ground of greater than or equal to sixty (60) kV; or 5) hazardous materials pipelines that are potentially harmful to workers or the public if damaged. The pavement or roadway must not be open cut unless specifically allowed. Utility installations are not allowed inside culverts or drainage structures. All installations must comply with Chapter 17 of the Caltrans Project Development Procedures Manual for utility clearance and offset requirements. For additional details regarding longitudinal utility encroachments on both conventional and access-controlled State highway right-of-way, see Section 602 of the Encroachment Permits Manual. UG 1. ENCASEMENT: Casings must have an inside diameter sufficiently larger than the outside diameter of the pipe or duct to accommodate placement and removal. When Horizontal Directional Drilling (HDD) is authorized, High-Density Polyethylene (HDPE) is acceptable as the casing. When Reinforced Concrete pipe in accordance with Section 65-2 of Caltrans Standard Specifications is installed by Bore & Jack, it must have rubber gaskets at the joints and see “D” below for grouting of voids left by jacking operations. A. Spiral welded casings may be allowed provided the casing is new and the weld is smooth. B. The ends of the casing must be plugged with ungrouted bricks or other suitable material approved by the Department’s representative. C. Minimum wall thicknesses of steel encasements for different lengths and diameters of pipes are as follows: Minimum Wall Thickness Casing Diameter Up to 150 feet in length Over 150 feet in length 6 to 28 inches 1/4 inch 1/4 inch 30 to 38 inches 3/8 inch 1/2 inch 40 to 60 inches 1/2 inch 3/4 inch 62 to 72 inches 3/4 inch 3/4 inch D. When required by the Department’s representative, the permittee must pressure grout to fill any voids caused by the permitted work at the permittee’s expense. The grout holes when placed the inside of the casing must be on eight (8) feet centers, longitudinally and offset twenty-two (22) degrees from the vertical axis of the casing and staggered to the left and right of the top longitudinal axis of the casing. Grout pressure must not exceed five (5) psig for a duration sufficient to fill all voids. E. When the placement of multiple encasements is requested, the distance between multiple encasements must be the greater of twenty-four (24) inches or twice the diameter of the larger pipe being installed. F. Casings within access-controlled highways must extend to the right-of-way lines. G. Wing cutters, if used, must be a maximum of one (1) inch larger in diameter than the outside diameter of the casing. Voids caused by the use of wing cutters must be grouted in accordance with “D” above. H. A band welded to the leading edge of the casing must be placed square to the alignment and not on the bottom edge. A flared lead section on bores over one hundred (100) feet is not allowed. I. The length of the auger strand must be equal to that of the section of encasement pipe. J. The casings within conventional highways must extend at least five (5) feet beyond the back of curb or edge of pavement, or to the right-of-way line if less. Where Portland Cement Concrete (PCC) cross- gutter exists, the casings must extend at least five (5) STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. feet beyond the back of the cross-gutter, or to the right-of-way line if less. UG 2. OPEN-CUT METHOD: When the encroachment permit authorizes installation by the open- cut method, surfacing and base materials and thickness thereof must be as specified in the encroachment permit. No more than one (1) lane of the highway pavement must be open cut at any time unless otherwise approved in writing by the Department’s representative. After the pipe is placed in the open-cut section, the trench must be backfilled in accordance with Section 19-3 of Caltrans Standard Specifications. The backfilled section must be open to traffic safely with temporary repairs to the surfacing before the next section of pavement is cut. If backfilling operations have not been properly completed at the end of a working day, steel plate bridging is required to make the entire highway facility open to traffic in accordance with the “Steel Plate Bridging Utility” Special Provisions (TR-0157). Sides of open-cut trenches in paved areas must be kept as nearly vertical as possible. Trenches must not be two (2) feet wider than the sum of the outside diameter of the pipe to be laid therein plus the necessary width to accommodate shoring. UG 3. TRENCHLESS CONSTRUCTION: The following provisions are applicable for installing conduit with the bore diameter less than thirty (30) inches using trenchless methods (e.g., Bore & Jack, HDD, Microtunneling, Pipe Bursting, Pipe Ramming, etc.). For installations with the bore diameter equal to or greater than thirty (30) inches, permittees must comply with Non- Standard Special Provision (NSSP) 19-15, Trenchless Construction. A copy of the NSSP 19-15 can be obtained from the Department’s representative or District Encroachment Permits Office. 3.1. Definitions Bore: Borehole excavated using trenchless construction for the installation of conduit. Overcut: Radial annular gap between bore and outer pipe wall. 3.2. Construction: The superintendent must be at the site at all times when work is being conducted, if the borehole diameter is greater than ten (10) inches and the depth of installation is less than eight (8) times the diameter of the borehole. Trenchless excavation and conduit installation must be performed to the line and grade shown. When excavation or installation is out of line or grade, make immediate alignment correction. Existing structures, pavement, and utilities must be protected during installation. Restore and repair immediately any damage resulting from construction. Repair or replace any damaged pipe sections. Overcut must be less than: A. One (1) inch or five (5) percent of the conduit outside radius, whichever is less, and B. Two (2) inches for trenchless construction using HDD method Notify the Department’s representative immediately if you encounter obstruction or condition that impedes construction. 3.3. Quality Assurance 3.3-1. Pre-construction Meeting: Contact the Department’s representative to schedule and have a pre- construction meeting at least seven (7) business days before the start of trenchless construction or as identified in the permit. Attendees should include: 1. The Department’s representative 2. Your project manager 3. Your project superintendent 4. The contractor for trenchless construction Provide and present: 1. Trenchless construction shop drawings, work plans, and calculations 2. Mitigation plans for both during and after construction 3. Construction timeline and critical path activities 3.3-2. Contractor Qualifications: The contractor must employ a superintendent, who has successfully completed at least five (5) of such projects, if the borehole diameter is greater than ten (10) inches and the depth of installation is less than eight (8) times the diameter of the borehole. Before pre-construction meeting, the following must be submitted to Department’s representative if requested: 1. Summary of the contractor's experience demonstrating that the contractor has successfully completed at least five (5) projects in the past five (5) years using similar trenchless construction in similar ground and groundwater conditions with similar drive lengths and diameter range. 2. Summary of the superintendent’s experience demonstrating that the superintendent has successfully completed at least five (5) projects using similar construction methods for trenchless construction in similar ground and groundwater STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. conditions with similar drive lengths and diameter range. 3.3-3. Conduit Line, Grade, and Shape: When monitoring is required: 1. Survey and record control lines at least seven (7) business days before trenchless construction. 2. Observe and adjust measurements of survey control lines weekly. Report discrepancies to the Department’s representative. Survey and record the centerline of the constructed conduit after each section is advanced or every five (5) feet of advancement, whichever is shorter. 3.3-4. Ground Surface Movement Monitoring: Ground surface movement monitoring is required if the installation meets the following criteria or if required by the Department’s representative: 1. Bore diameter is greater than ten (10) inches, and 2. Minimum vertical distance between the pavement or sidewalk surface and the top of bore is less than eight (8) times the diameter of the borehole. Mark monitoring points on critical structures and utilities at locations shown. Include these points in monitoring surveys. Perform monitoring surveys before noon and at ambient temperature below eighty-five (85) degrees Fahrenheit. Perform ground surface survey under the Caltrans Surveys Manual and supplemental guidance. Establish a minimum of four (4) control points for ground surface movement monitoring. Perform baseline ground surface survey at least fifteen (15) business days before trenchless construction. Notify the Department’s representative at least ten (10) business days before the survey. Develop baseline surface model. Use the baseline surface model to determine the movement of ground surface and embankment slope. See Encroachment Permit Survey Grid (TR-0151) in Appendix E of the Encroachment Permits Manual for survey grid spacing and other requirements. Perform ground surface movement monitoring survey: 1. Weekly during construction or as required by the Department’s representative 2. Biweekly for one (1) month after completion of each installation or as required by the Department’s representative Produce the surface model based on the monitoring survey data and calculate the movement of monitoring points using baseline surface model. Each monitoring survey may have different grid points. Each ground surface horizontal and vertical measurement must be accurate to ±0.03 feet on pavement and ±0.1 feet on unpaved surfaces at the ninety-five (95) percent confidence level. Vertical movement produced by comparing current surface model with pre-construction surface model must be accurate to ±0.01 feet on pavement and ±0.1 feet on unpaved surfaces at the ninety-five (95) percent confidence level. If ground surface movement in the pavement above the advancing pipe meets the requirements for two (2) consecutive weeks, the frequency of monitoring survey may be reduced to biweekly. Notify the Department’s representative at completion of each installation. Ground surface vertical movement requirements are: Ground Surface Vertical Movement Quality Characteristic Requirement Critical Structure Monitoring Points - Horizontal or Vertical (max, feet) 0.02 Highway surface (max, feet) 0.04 Embankment slope (max, feet) 0.2 If ground surface vertical movement requirements are not met: 1. Stop work immediately. 2. Notify the Department’s representative. 3. Submit an alternative construction method. 4. Submit a mitigation plan that includes methods to fill the voids created under the ground surface and restore the density of subsurface materials. 5. Monitor ground surface movement in the area above the advancing pipe: 5.1. Daily until no additional vertical movement is detected in the areas that exceed the movement requirements 5.2. Every two (2) working days until the vertical movement meets the requirements for two (2) consecutive weeks 3.4. Submittals 3.4-1. Monitoring Plans: Submit monitoring plans for: 1. Conduit grade and alignment control, including monitoring instruments, layout of instrumentation points, construction details, and monitoring frequency 2. Logging of excavated materials, including anticipated volume of excavation and measured volume of removed spoil 3. Critical operations of applicable trenchless construction, including excavation, boring, spoil removal, lubrication, jacking, installation, and grouting 4. Ground surface movement, including digital surface survey method, survey data processing and analysis STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. 3.4-2. Daily Construction Record: Maintain Daily Construction Record and submit to the Department’s representative upon request. Daily Construction Record must include: 1. Date and time of operation 2. Names of key personnel 3. Length of constructed conduit, including coordinates and elevation of the beginning and ending (latitude, longitude and northing, easting, elevation) of the conduit advanced during each work shift. Record must reference the project coordinate system. 4. Rate of advance 5. Jacking force 6. Problems encountered, possible causes, and mitigation performed 7. Geological log of excavated face and materials, with the logging performed by a geologist who is registered as an engineering geologist in the State 8. Records and field note of: 8.1. Any visible cracks 8.2. Conduit line and grade control 8.3. Anticipated and actual volumes of spoil removed and causes of the volume discrepancy 8.4. Groundwater table elevation if dewatering is required 3.4-3. Ground Surface Movement Monitoring Records: Submit: 1. Before construction: survey data and surface model to demonstrate compliance with the Caltrans Surveys Manual and supplemental guidance 2. During and after construction: survey data, surface model, and vertical movement based on the comparison between current and pre-construction surface model 3.4-4. Contact Grouting Record: Maintain Contact Grouting Record and submit to the Department’s representative upon request. Contact Grouting Record must include: 1. Injection locations 2. Grout quantity] 3. Grout pressure 4. Measurements and observations, including heave, casing or carrier pipe movement, grout loss quantity, communication between grout ports, ground surface, and nearby utilities and storm drains 5. Problems encountered, possible causes, and mitigation performed 3.4-5. Post-Construction Record: Maintain Post- Construction Record and submit to the Department’s representative upon request. Post-Construction Record must include: 1. Completed conduit construction inspection records, including video recording and photographs 2. As-built plans showing details and alignment of the constructed conduit, horizontal and elevation survey based on project coordinate system, any problems encountered, and mitigation actions performed 3. As-built plans showing details of pavement restoration work performed 3.5. Restore Highway Pavement: After completion of trenchless construction of conduit, restore highway pavement to conditions as it was prior to beginning of construction activities or better. Restore Asphalt Concrete (AC) pavement with mill and fill. Repair or replace AC pavement with dowels for any cracks and spalling caused by construction. UG 4. Bore and receiving pits must: 1. be located at least ten (10) feet from the edge of pavement on rural conventional highways. 2. be located at least five (5) feet beyond the concrete curb and gutter or AC dike on urban conventional highways. 3. be located at least five (5) feet beyond the toe of slope of embankments. 4. be located outside access-controlled highway right- of-way. 5. be protected by placement of six (6)-foot chain link fence or Type K railing around them. 6. be adequately shored in accordance with Cal/OSHA requirements. Shoring for jacking and receiving pits located within fifteen (15) feet of traffic lanes on a State highway must not extend more than thirty-six (36) inches above the pavement grade unless otherwise authorized by Department’s representative. Reflectors must be affixed to the shoring on the sides facing traffic. A six (6)-foot chain link fence must be installed around the perimeter of the pits during non-working hours. 7. have crushed rock and sump areas to clear groundwater and water used to clean the casing. Where groundwater is found and pumping is required, the pits must be lined with filter fabric. UG 5. LIMIT OF EXCAVATION: No excavation is allowed within ten (10) feet from the edge of pavement PHWKRGDQGGLJLWDOVXUIDFHILOHIRUWKHERUHGLDPHWHU JUHDWHUWKDQWHQLQFKHVDQGWKHYHUWLFDOGLVWDQFH EHWZHHQWKHSDYHPHQWRUVLGHZDONVXUIDFHDQGWKH WRSRIERUHOHVVWKDQHLJKWWLPHVWKHGLDPHWHURI WKHERUHKROH STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. except in curbed urban areas or as specified in the encroachment permit. Where no curb exists and excavations within ten (10) feet of the traveled way are to remain open, a temporary Type K railing must be placed at a 10:1 taper or as otherwise directed by the Department’s representative. UG 6. TUNNELING: In addition to the requirements of “UG 1” and Section 603.6 of the Encroachment Permits Manual, the following requirements are also applicable: A. For this provision, a tunnel is defined as any installation that is thirty (30) inches or greater in diameter. B. When tunneling is authorized, the permittee must provide full-time inspection of tunneling operations. The Department’s representative must monitor projects. C. Sand shields may be required as ground conditions change. D. Pressure grouting for liner plate, rib and spiling, or rib and lagging tunnels must be at every eight (8) feet section or the end of work shift before the next section is excavated. All grouting must be completed by the end of each workday. E. The headway must be secured at the end of each workday. Breast boards or plates must be installed during working hours for running sand or super- saturated soil. UG 7. FACILITIES EXEMPT FROM UTILITY POLICIES: The following utilities are exempt from the requirements for location and depiction on the project plans unless the depiction of the utility is needed for interconnectivity with the proposed work (see Chapter 17 of the Project Development Procedures Manual): x Natural gas service lines less than two (2) inches in pipe diameter that have normal operating pressures of sixty (60) psig or less x Service connections (laterals) for water, sewer, electric, and telecommunication including fiber optic and cable service All State-owned utilities must be plotted on the plans. UG 8. DETECTOR STRIP: A continuous metallic detectable strip must be provided for non-metallic main utility installations. Service connections must be installed at right angles to the centerline of the State highway. UG 9. BACKFILLING: All backfilling operations must be in accordance with Section 19-3 of Caltrans Standard Specifications. Any required compaction tests must be performed by a certified laboratory at no cost to the Department and the laboratory report must be furnished to the Department’s representative. UG 10. ROADWAY SURFACING AND BASE MATERIALS: Temporary repairs to pavements must be made and maintained upon completion of backfill until permanent repairs are made. Permanent repairs to pavements must be made within thirty (30) calendar days of completion of backfill unless otherwise authorized by the Department’s representative. Temporary pavement patches must be placed and maintained in a smooth riding plane free of humps and depressions. UG 11. DAMAGE TO TREE ROOTS: Tree roots three (3) inches or larger in diameter must not be cut within the tree drip line when trenching or other underground work is necessary adjacent to roadside trees. If such roots are encountered, they must be tunneled under, wrapped in burlap, and kept moist until the trench is backfilled. Trenching machines must not be used under trees if the trunk or limbs can be damaged by their use. Manholes must not be installed within twenty (20) feet of any trunk. If the trees involved are close together and of such sizes that it is impractical to protect all roots three (3) inches or larger in diameter, or when roots are less than four (4) inches in diameter, outside tree drip line, special arrangements may be made whereby pruning of the tree tops to balance the root loss can be done by the permittee only when approved by and under the close supervision of the District Landscape Specialist or District Tree Maintenance Supervisor. UG 12. PIPES ALONG ROADWAY: Pipes and conduits paralleling the pavement must be located as shown on the plans or as close as possible to the right-of- way line. UG 13. BORROW AND WASTE: Borrow and waste must not be allowed within the work limits unless otherwise specified in the encroachment permit. UG 14. MARKERS: All markers must not create a safety hazard for the traveling public or highway workers. UG 15. CATHODIC PROTECTION: The permittee must perform stray current interference tests on underground utilities under cathodic protection and notify the Department’s representative prior to the tests. The permittee must perform any corrective measures as necessary and authorized by the Department’s representative. UG 16. PAVEMENT REMOVAL: ASPHALT CONCRETE (AC) pavement must be saw cut to the full depth to provide a neat and straight pavement break along sides of the trench. Portland Cement Concrete (PCC) STATE OF CALIFORNIA • DEPARTMENT OF TRANSPORTATION ENCROACHMENT PERMIT SPECIAL PROVISIONS © 2018 California Department of Transportation. All Rights Reserved. Where the edge of the trench is within two (2) feet of the existing curb and gutter or pavement edge, the AC pavement between the trench and the curb or pavement edge must be removed. UG 17. EXCAVATION UNDER FACILITIES: Where it is necessary to excavate under the existing curb and gutter or underground facilities, the void must be backfilled with two (2) sack cement-sand slurry. UG 18. PERMANENT REPAIRS TO PCC PAVEMENT: Repairs must be of PCC containing at least six hundred fifty-eight (658) pounds or seven (7) sacks of cement per cubic yard. The new pavement must have the same thickness as the adjacent pavement. The PCC must be satisfactorily cured and protected from disturbance until it can be open to traffic with a compressive strength of at least 3,000 psig or for not less than forty-eight (48) hours. The new pavement may be open to traffic after six (6) hours of curing when no more than two (2) percent by weight of calcium chloride is added to the PCC mix as an accelerating chemical admixture. UG 19. REMOVAL OF PCC SIDEWALKS OR CURBS: PCC sidewalks or curbs must be saw cut to the nearest score marks and reconstructed to match the existing sidewalk or curb. UG 20. SPOILS: No earth or construction materials must be tracked onto the highway pavement and public or private approach. The permittee must remove these materials immediately if tracked from the highway pavement and public or private approach. SDYHPHQWPXVWEHVDZFXWDWWKHVODEMRLQWVDQGWRWKHIXOO VODEGHSWK APPENDIX APPENDIX 7 APPENDIX E – PG&E CONSTRUCTION DRAWING FOR HIGUERA & ELKS SIGNAL SERVICE HIGUERAST E L K S L N SL APPENDIX APPENDIX 8 APPENDIX F – PAVEMENT EVALUATION REPORT DEFLECTION ANALYSIS for CITY OF SAN LUIS OBISPO 2023 Arterial Pavement Improvement Project Various Streets Project No. 220205 2FWREHU, 2022 $QWKRQ\5DPRV(QJLQHHU,,, City of San Luis Obispo 919 Palm Street San Luis Obispo, CA 93401 Subject: Deflection Analysis for City of San Luis Obispo 2023 Arterial Pavement Improvement Project Dear $QWKRQ\: In accordance with your request, we have completed the pavement deflection analysis for the subject project and are herein providing our findings and recommendations. INTRODUCTION Our field work consisted of deflection testing using our falling weight pavement deflection testing device in general accordance with CTM 356, coring to measure the existing pavement thickness, and a visual condition survey. This work was performed by Brett Long and Ryan Burrell of PEI’s staff. Visual evaluations were performed by Joseph Ririe of PEI’s engineering staff. The traffic indexes used in this analysis were provided by the City of San Luis Obispo. We have summarized our analysis on the deflection summary sheets for the street segments following this report. Included on the summary sheets are the coring data for existing pavement thickness, visual condition survey, deflection test results analysis, and rehabilitation recommendations. ANALYSIS The rehabilitation alternatives have been designed using structural requirements from the deflection analysis contained in CTM 356, reflective cracking criteria, and the visual condition survey. Reflection cracking requirements are determined as a minimum of one-half the bonded layer section per current Caltrans recommendations for reflective cracking. Engineering judgment and experience has been used in applying these criteria to the individual street segments. The rehabilitation alternatives evaluated in this analysis include HMA and RHMA overlays, milling and replacement with HMA, and Cold In-Place Recycling (CIR). Reconstruction alternatives are also provided including Full Depth Reclamation (FDR), Full Depth HMA, and HMA over aggregate base. Z:\Shared\R Drive\Active Projects\San Luis Obispo, City of\220205\Test Results\ER01\220205_ER01.doc $QWKRQ\5DPRV 2FWREHU, 2022 Project No. 220205 Page 2 OVERLAYS The recommended overlays must meet both the structural requirement from the deflection analysis and reflective cracking requirements. The minimum recommended overlay thickness is 1-3/4 inches to ensure that the HMA can be properly compacted. For HMA overlays, typically a 1/2-inch HMA leveling course is recommended if pavement fabric is placed. The leveling course provides a uniform surface and fills cracks to ensure the fabric is bonded properly to the overlay. PEI recommends placing a 1/2-inch leveling course under RHMA overlays. The leveling course helps provide a uniform surface for placing the RHMA to ensure the thickness of the RHMA overlay. Minimum thickness for RHMA overlays is critical for compaction. MILLING AND REPLACEMENT Milling and replacement is generally recommended when overlay requirements for reflective cracking exceed 3-1/2 inches and are structurally adequate by deflection. Overlays which exceed 3-1/2 inches are not usually feasible due to geometric constraints. Mill and replacement alternatives allow for resurfacing the pavement to match the existing profile. This alternative can also reduce the lift thickness to meet reflective cracking requirements if the pavement is structurally adequate. The expected pavement life for milling and replacing is similar to an overlay. Milling and replacement is a green alternative also, because asphalt suppliers use the removed asphalt in Rap (recycled asphalt pavement) mixes. PEI does not recommend Milling and Replacement when the pavement is less than 5 inches thick. Construction traffic can cause significant failures in pavements that are milled and leave less than 3 inches. PARTIAL DEPTH RECYCLING(PDR) PDR is an option when pavements are structurally adequate or slightly structurally deficient. It can be especially useful when pavements are thick (greater than 6 inches). PDR helps reduce crack history in thicker pavement and provides a green approach by using existing materials. PDR consists of either an emulsion process or a foaming process. The cold foam process can include mixing aggregate base with the asphalt. Z:\Shared\R Drive\Active Projects\San Luis Obispo, City of\220205\Test Results\ER01\220205_ER01.doc $QWKRQ\5DPRV 2FWREHU, 2022 Project No. 220205 Page 3 RECONSTRUCTION Reconstruction can consist of various alternatives including Full Depth HMA, HMA over aggregate base, or Full Depth Reclamation (FDR). Full Depth HMA is the fastest for construction but typically has higher costs than other reconstruction alternatives. FDR HMA can be a cost-effective approach but takes much longer to construct than HMA. HMA over aggregate base has a lower cost than Full Depth HMA but has significant impact on the public due to the slower construction process. PROJECT ANALYSIS AND DESIGN OVERVIEW The streets segments that were evaluated are listed below: x La Loma Court – Los Cerros Drive to End x Higuera Street – 6RXWK6WUHHW to Los Osos Valley Road x Johnson Avenue – Buchon Street to Laurel Lane x Madonna Road – HWY 101 to Higuera Street x California Boulevard – Phillips /DQH to Monterey Street x Orcutt Road – Laurel Lane to Johnson Avenue x Orcutt Road – Johnson Avenue to Tank Farm Road x Santa Barbara Avenue – Leff Street to Broad Street x Grand Avenue - Slack Street to Monterey Street All the street segments experience higher truck traffic loading (traffic indexes of 8.5) except for La Loma Court, which was designed at a traffic index of 5.5. The structural deficiencies vary from slight to substantial. PEI evaluated multiple alternatives for rehabilitating the pavements. The estimated design life of each recommended alternative is provided in the following table: Proposed Treatment Expected Service Life HMA and RHMA Overlays 7-12 years Milling and Replacement 7-12 years Partial Depth Recycling (PDR) 7-12 years Full Depth Reclamation (FDR) 15-20 years Full Depth HMA 15-20 years HMA Over Aggregate Base 15-20 years Z:\Shared\R Drive\Active Projects\San Luis Obispo, City of\220205\Test Results\ER01\220205_ER01.doc $QWKRQ\5DPRV 2FWREHU, 2022 Project No. 220205 Page 4 Each alternative should be evaluated by the design engineer for cost, constructability, and impact on the public during construction. The Deflection Summary Sheets following this report provide the coring data, deflection data, and visual condition evaluations used in PEI’s analysis. The recommended repair strategies have been provided for rehabilitation alternatives. Following the summary sheets are the deflection data print outs, R-values, and photos. MATERIALS AND CONSTRUCTION HMA recommended for leveling courses less than 1 inch should be constructed using 3/8-inch maximum HMA or #4 mix. The leveling course should be rolled and compacted with an 8 to 12 ton pneumatic-tire roller. HMA with thicknesses of 1 to 2 inches should be constructed using 1/2-inch maximum HMA. HMA layer thicknesses greater than 2 inches can be constructed with either 1/2 or 3/4-inch maximum HMA. RHMA should be constructed with 3/8-inch maximum aggregate for overlays less than 2 inches and 1/2-inch maximum size aggregate for overlays greater than or equal to 2 inches. All HMA and RHMA work should be placed in accordance with Caltrans 2010 Section 39 using the standard process. LIMITATIONS This report has been prepared based on the indicated field testing and application of our knowledge of pavement technology. The repair strategies in this report are based upon industry standards. Our professional services were performed, findings obtained, and recommendations prepared in accordance with generally accepted engineering principles and practices. No warranty is either expressed or implied. SUMMARY We performed deflection testing for the 2023 City of San Luis Obispo Arterial Improvement Project and have provided recommendations and repair strategies for resurfacing or reconstructing the pavements of each street segment. HIGUERA STREET 6RXWK6WUHHWWR/RV2VRV9DOOH\5RDG Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo Higuera Street (North Bound) 6RXWK6WUHHW to Los Osos Valley Road NORTHBOUND CORING LOG Core No.Location HMA Layer (Inches) Fabric (Yes/No) PCC Layer (Inches) AB Layer (Inches)R-value 1 NB2 –500 ft north of Los Osos Valley Rd 12-1/2 Yes -4 13 2 NB1 –1,000 ft north of Los Osos Valley Rd 3-1/2 Yes 7 0 - 3 NB2 –1,500 ft north of Los Osos Valley Rd 5 Yes -11 13 4 NB1 –2,050 ft north of Los Osos Valley Rd 18 Yes -7+- 5 NB2 –2,560 ft north of Los Osos Valley Rd 14 Yes -3 - 6 NB1 –2,970 ft north of Los Osos Valley Rd 6-1/2 No -22+- 7 NB2 –3,450 ft north of Los Osos Valley Rd 8 Yes --12 8 NB1 –3,950 ft north of Los Osos Valley Rd 11 No --- 9 NB2 –4,500 ft north of Los Osos Valley Rd 9 Yes --11 10 NB1 –4,850 ft north of Los Osos Valley Rd 2-1/2 No 7 -- 11 NB2 –5,400 ft north of Los Osos Valley Rd 12-1/2 Yes -5 10 12 NB1 –6,140 ft north of Los Osos Valley Rd 10 Yes -9 - 13 NB2 –6,590 ft north of Los Osos Valley Rd 8 No -5.5 10 14 NB1 –7,100 ft north of Los Osos Valley Rd 11-1/2 No -10 - 15 NB2 –7,550 ft north of Los Osos Valley Rd 11 Yes -0 11 16 NB1 –8,000 ft north of Los Osos Valley Rd 9-1/2 Yes -9 - 17 NB2 –8,500 ft north of Los Osos Valley Rd 13 Yes -5 - 18 NB1 –9,000 ft north of Los Osos Valley Rd 12 Yes -5 - 19 NB1 –9,000 ft north of Los Osos Valley Rd 9 Yes -8 10 20 NB1 –9,000 ft north of Los Osos Valley Rd 14-1/2 Yes --- 21 NB1 –9,000 ft north of Los Osos Valley Rd 10-1/2 No -7 10 Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo SOUTHBOUND CORING LOG Core No.Location HMA Layer (Inches) Fabric (Yes/No) PCC Layer (Inches) ASB Layer (Inches) AB Layer (Inches)R-value 1 SB2 –490 feet south of Madonna Rd 6-1/2 Yes --6 - 2 SB1 –950 feet south of Madonna Rd 11 Yes --8 - 3 SB2 –1,465 feet south of Madonna Rd 14 Yes --12+- 4 SB1 –1,950 feet south of Madonna Rd 4 No 8 --- 5 SB2 –2,500 feet south of Madonna Rd 10-1/2 Yes ----3 10 6 SB1 –2,950 feet south of Madonna Rd 3 No 14 --- 7 SB2 –3,480 feet south of Madonna Rd 10-1/2 Yes ---- 8 SB1 –4,975 feet south of Madonna Rd 2-1/2 Yes 12 --- 9 SB2 –5,475 feet south of Madonna Rd 12 No ---- 10 SB1 –6,050 feet south of Madonna Rd 12-1/2 No -15 -- 11 SB2 –6,450 feet south of Madonna Rd 13 No ---- 12 SB1 –6,950 feet south of Madonna Rd 10 Yes -15 -- 13 SB2 –6,470 feet south of Madonna Rd 12 Yes ---- 14 SB1 –6,950 feet south of Madonna Rd 11-1/2 Yes -15 -- 15 SB2 –7,400 feet south of Madonna Rd 9-1/2 Yes ---- 16 SB1 –7,890 feet south of Madonna Rd 9-1/2 Yes -5 -- 17 SB2 –8,400 feet south of Madonna Rd 10 Yes ---- 18 SB1 –8,920 feet south of Madonna Rd 12-1/2 Yes -5 -- 19 SB2 –9,430 feet south of Madonna Rd 9 Yes --4 - 20 SB1 –9,810 feet south of Madonna Rd 3 No 9 --- Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo STRUCTURAL REQUIREMENTS (by Deflection Analysis) REFLECTIVE CRACKING REQUIREMENTS *(Required overlay by reflective cracking is half the existing AC thickness - if pavement fabric is used then these criteria can be reduced by 1-1/4 inch with at least a minimum overlay requirement of 1-3/4 inch) VISUAL CONDITIONS The pavement from South Street to the change of pavement north of Bridge Street exhibits slight raveling and block cracking. Some sections of pavement have limited cracking. The pavement from the change of pavement north of Bridge Street to Los Osos Valley Road exhibits slight raveling, block shrinkage and areas alligator cracking. Some areas of alligator cracking have progressed to base failure. ANALYSIS The existing pavement consists of 2-1/2 to 14 inches of asphalt concrete over 0 to 22 inches of aggregate base. There are several locations where PCC pavement was encountered. The PCC pavement varied from 7 to 14 inches. There is pavement fabric located approximately 2 inches below the asphalt surface. The native soil is a brown clay with R-values ranging from 10 to 13. Based on the deflection analysis, the pavement is structurally adequate. For this pavement, PEI is providing recommendations for overlaying with RHMA, milling and replacement, and reconstruction with Full Depth HMA or HMA over aggregate base. Overlaying with HMA is not recommended because of the high reflective cracking criteria. Partial depth recycling (PDR) and full depth reclamation (FDR) are not recommended because of the existing PCC layer. Direction Traffic Index (TI) Tolerable 80th Percentile HMA Overlay Requirement (Inches) NB1 8.5 15.0 12.5 0 NB2 8.5 15.0 13.6 0 SB1 8.5 15.0 10.6 0 SB2 8.5 15.0 18.2 1/2 HMA Overlay Requirement (Inches)* Pavement Fabric Required (Yes or No) 4-1/4 Yes Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo RECOMMENDATIONS Overlay Options HMA Overlaying with HMA is not recommended because of the high reflective cracking criteria. RHMA We recommend 10-inch pavement repairs of base failures, placing a 1/2-inch HMA leveling course and a 2-1/2-inch RHMA overlay. The pavement should be evaluated for the base failures present. If the amount of base failure exceeds 10%, then placing overlays may not be cost effective. Milling and Replacement Option HMA We recommend milling off 3 inches of the existing pavement, 8-inch pavement repairs of base failures, placing a 1-inch HMA leveling course, pavement fabric and a 2-inch HMA overlay. RHMA We recommend milling off 2-1/2 inches of the existing pavement, 9-inch pavement repairs of base failures, placing a 1/2-inch HMA leveling course and a 2-inch RHMA overlay. At the locations where there is PCC pavement is located under the existing asphalt concrete layer, the milling operation may encounter the top of the PCC layer. Partial Depth Recycling Option (PDR) Partial Depth Recycling (PDR) is not recommended because of the thinner existing pavement section where the PCC pavement is located. FDR Option FDR is not recommended because the areas with PCC cannot be constructed with FDR. Reconstruction Options Full Depth HMA We recommend removing to a depth of 12-1/2 inches and placing 12-1/2 inches of HMA in 5 lifts. There are a few locations where the existing asphalt concrete over PCC pavement exceeds 12- 1/2 inches. In these locations, aggregate base should be used to bring the grade up to 12-1/2 inches below finish grade after removing the pavement section. HMA over Aggregate Base We recommend removing to a depth of 20-1/2 inches, installing a SEG fabric, placing 15 inches of aggregate base and 5-1/2 inches of HMA in 2 lifts. Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo Both reconstruction alternatives could develop unstable grade from construction traffic during the construction process. Stabilization allowances should be included if one of these alternatives is chosen. As previously discussed in the report, rehabilitation alternatives may have different anticipated service lives. The design engineer should evaluate each alternative based on cost, constructability, and impact on the public. 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 50 4.33 8.65 29.57 4.57 Road Surface Thickness Traffic Index 10.00 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 12.48 14.49 0.00 0.00 HMA Overlay 0.00 07/29/22 10.00 8.50 220205 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Higuera Street Los Osos Valley Road 6RXWK6WUHHW NB1 Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 Higuera Street Los Osos Valley Road 6RXWK6WUHHW NB1 07/29/22 10.00 8.50 220205 206' from Los Osos Valley Road 371' from Los Osos Valley Road 610' from Los Osos Valley Road 773' from Los Osos Valley Road 1,004' from Los Osos Valley Road 1,205' from Los Osos Valley Road 1,406' from Los Osos Valley Road 1,604' from Los Osos Valley Road 1,779' from Los Osos Valley Road 2,067' from Los Osos Valley Road 2,217' from Los Osos Valley Road 2,405' from Los Osos Valley Road 2,616' from Los Osos Valley Road 2,807' from Los Osos Valley Road 3,005' from Los Osos Valley Road 3,223' from Los Osos Valley Road 3,409' from Los Osos Valley Road 3607' from Los Osos Valley Road 3,843' from Los Osos Valley Road 4,013' from Los Osos Valley Road 4,212' from Los Osos Valley Road 4,419' from Los Osos Valley Road 4,614' from Los Osos Valley Road 4,804' from Los Osos Valley Road 4,992' from Los Osos Valley Road 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection 09/16/22 Page 3 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: NB1 220205 City of San Luis Obispo 07/29/22 10.00 Higuera Street Los Osos Valley Road 6RXWK6WUHHW 8.50 PAVEMENT ENGINEERING INCORPORATED Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 5,241' from Los Osos Valley Road 5,402' from Los Osos Valley Road 5,622' from Los Osos Valley Road 5,853' from Los Osos Valley Road 6,121' from Los Osos Valley Road 6,218' from Los Osos Valley Road 6,402' from Los Osos Valley Road 6,600' from Los Osos Valley Road 6,803' from Los Osos Valley Road 7,013' from Los Osos Valley Road 7,250' from Los Osos Valley Road 7,407' from Los Osos Valley Road 7,604' from Los Osos Valley Road 7,811' from Los Osos Valley Road 8,014' from Los Osos Valley Road 8,202' from Los Osos Valley Road 8,413' from Los Osos Valley Road 8,628' from Los Osos Valley Road 8,803' from Los Osos Valley Road 8,997' from Los Osos Valley Road 9,203' from Los Osos Valley Road 9,404' from Los Osos Valley Road 9,622' from Los Osos Valley Road 9,782' from Los Osos Valley Road 10,004' from Los Osos Valley Road 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 5.96 5.96 2 4.40 4.40 3 8.98 8.98 4 5.81 5.81 5 4.99 4.99 6 7.20 7.20 7 14.63 14.63 8 7.59 7.59 9 6.67 6.67 10 7.08 7.08 11 7.68 7.68 12 6.54 6.54 13 6.77 6.77 14 6.37 6.37 15 9.97 9.97 16 9.78 9.78 17 9.12 9.12 18 8.61 8.61 19 7.98 7.98 20 7.86 7.86 21 7.51 7.51 22 9.88 9.88 23 5.29 5.29 24 5.39 5.39 25 17.55 17.55 26 9.43 9.43 27 6.60 6.60 28 4.33 4.33 29 10.33 10.33 30 7.08 7.08 31 9.37 9.37 32 16.06 16.06 1,004' from Los Osos Valley Road 4,419' from Los Osos Valley Road 3,005' from Los Osos Valley Road 3,223' from Los Osos Valley Road 773' from Los Osos Valley Road 1,406' from Los Osos Valley Road 2,217' from Los Osos Valley Road 2,405' from Los Osos Valley Road 2,616' from Los Osos Valley Road 2,807' from Los Osos Valley Road 1,604' from Los Osos Valley Road 206' from Los Osos Valley Road 371' from Los Osos Valley Road 610' from Los Osos Valley Road 3,409' from Los Osos Valley Road 3,607' from Los Osos Valley Road 6,402' from Los Osos Valley Road 5,402' from Los Osos Valley Road 1,205' from Los Osos Valley Road 3,843' from Los Osos Valley Road 4,013' from Los Osos Valley Road 4,212' from Los Osos Valley Road 5,622' from Los Osos Valley Road 5,853' from Los Osos Valley Road 6,121' from Los Osos Valley Road 4,614' from Los Osos Valley Road 4,804' from Los Osos Valley Road 4,992' from Los Osos Valley Road 5,241' from Los Osos Valley Road 6,218' from Los Osos Valley Road 1,779' from Los Osos Valley Road 2,067' from Los Osos Valley Road 9/16/2022 City of San Luis Obispo Higuera Street 200' PAVEMENT ENGINEERING INCORPORATED Comments Los Osos Valley Road 6RXWK6WUHHW NB1 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 7/29/22 10.00 8.50 220205 33 8.76 8.76 34 8.54 8.54 35 5.36 5.36 36 29.57 29.57 37 18.11 18.11 38 4.55 4.55 39 9.61 9.61 40 6.44 6.44 41 8.28 8.28 42 18.30 18.30 43 4.66 4.66 44 4.95 4.95 45 5.96 5.96 46 4.46 4.46 47 7.26 7.26 48 10.50 10.50 49 8.72 8.72 50 5.56 5.56 8,997' from Los Osos Valley Road 9,203' from Los Osos Valley Road 7,811' from Los Osos Valley Road 8,014' from Los Osos Valley Road 6,600' from Los Osos Valley Road 6,803' from Los Osos Valley Road 8,628' from Los Osos Valley Road 8,803' from Los Osos Valley Road 8,202' from Los Osos Valley Road 7,013' from Los Osos Valley Road 7,250' from Los Osos Valley Road 7,407' from Los Osos Valley Road 7,604' from Los Osos Valley Road 8,413' from Los Osos Valley Road 9,404' from Los Osos Valley Road 9,622' from Los Osos Valley Road 9,782' from Los Osos Valley Road 10,004' from Los Osos Valley Road 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 48 3.61 10.06 23.26 4.19 Road Surface Thickness Traffic Index 10.25 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 13.58 15.42 0.00 0.00 HMA Overlay 0.00 07/29/22 10.25 8.50 220205 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Higuera Street Los Osos Valley Road 6RXWK6WUHHW NB2 Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 Higuera Street Los Osos Valley Road 6RXWK6WUHHW NB2 07/29/22 10.25 8.50 220205 158' from Los Osos Valley Road 301' from Los Osos Valley Road 547' from Los Osos Valley Road 716' from Los Osos Valley Road 933' from Los Osos Valley Road 1,101' from Los Osos Valley Road 1,206' from Los Osos Valley Road 1,381' from Los Osos Valley Road 1,513' from Los Osos Valley Road 1,707' from Los Osos Valley Road 1,891' from Los Osos Valley Road 2,108' from Los Osos Valley Road 2,312' from Los Osos Valley Road 2,481' from Los Osos Valley Road 2,707' from Los Osos Valley Road 2,872' from Los Osos Valley Road 3,108' from Los Osos Valley Road 3,320' from Los Osos Valley Road 3,492' from Los Osos Valley Road 3,664' from Los Osos Valley Road 3,907' from Los Osos Valley Road 4,088' from Los Osos Valley Road 4,301' from Los Osos Valley Road 4,512' from Los Osos Valley Road 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection 09/16/22 Page 3 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: NB2 220205 City of San Luis Obispo 07/29/22 10.25 Higuera Street Los Osos Valley Road 6RXWK6WUHHW 8.50 PAVEMENT ENGINEERING INCORPORATED Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 4,707' from Los Osos Valley Road 4,894' from Los Osos Valley Road 5,029' from Los Osos Valley Road 5,305' from Los Osos Valley Road 5,504' from Los Osos Valley Road 5,687' from Los Osos Valley Road 5,900' from Los Osos Valley Road 6,129' from Los Osos Valley Road 6,311' from Los Osos Valley Road 7,322' from Los Osos Valley Road 7,500' from Los Osos Valley Road 7,721' from Los Osos Valley Road 7,899' from Los Osos Valley Road 8,108' from Los Osos Valley Road 8,311' from Los Osos Valley Road 8,482' from Los Osos Valley Road 8,706' from Los Osos Valley Road 8,909' from Los Osos Valley Road 9,111' from Los Osos Valley Road 9,308' from Los Osos Valley Road 9,512' from Los Osos Valley Road 9,700' from Los Osos Valley Road 9,909' from Los Osos Valley Road 10,084' from Los Osos Valley Road 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 10.28 10.28 2 14.69 14.69 3 6.77 6.77 4 7.91 7.91 5 9.84 9.84 6 5.97 5.97 7 10.46 10.46 8 17.21 17.21 9 11.66 11.66 10 9.59 9.59 11 10.23 10.23 12 18.17 18.17 13 15.56 15.56 14 10.40 10.40 15 9.94 9.94 16 12.61 12.61 17 14.55 14.55 18 12.93 12.93 19 13.17 13.17 20 11.24 11.24 21 15.53 15.53 22 7.78 7.78 23 9.34 9.34 24 5.41 5.41 25 3.61 3.61 26 5.61 5.61 27 14.49 14.49 28 23.26 23.26 29 5.72 5.72 30 8.44 8.44 31 6.78 6.78 32 5.59 5.59 933' from Los Osos Valley Road 4,088' from Los Osos Valley Road 2,707' from Los Osos Valley Road 2,872' from Los Osos Valley Road 716' from Los Osos Valley Road 1,206' from Los Osos Valley Road 1,891' from Los Osos Valley Road 2,108' from Los Osos Valley Road 2,312' from Los Osos Valley Road 2,481' from Los Osos Valley Road 1,381' from Los Osos Valley Road 158' from Los Osos Valley Road 301' from Los Osos Valley Road 547' from Los Osos Valley Road 3,108' from Los Osos Valley Road 3,320' from Los Osos Valley Road 6,129' from Los Osos Valley Road 5,029' from Los Osos Valley Road 1,101' from Los Osos Valley Road 3,492' from Los Osos Valley Road 3,664' from Los Osos Valley Road 3,907' from Los Osos Valley Road 5,305' from Los Osos Valley Road 5,504' from Los Osos Valley Road 5,687' from Los Osos Valley Road 4,301' from Los Osos Valley Road 4,512' from Los Osos Valley Road 4,707' from Los Osos Valley Road 4,894' from Los Osos Valley Road 5,900' from Los Osos Valley Road 1,513' from Los Osos Valley Road 1,707' from Los Osos Valley Road 9/16/2022 City of San Luis Obispo Higuera Street 200' PAVEMENT ENGINEERING INCORPORATED Comments Los Osos Valley Road 6RXWK6WUHHW NB2 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 7/29/22 10.25 8.50 220205 33 13.48 13.48 34 6.31 6.31 35 6.96 6.96 36 11.44 11.44 37 6.42 6.42 38 6.11 6.11 39 5.35 5.35 40 6.18 6.18 41 6.24 6.24 42 4.64 4.64 43 5.70 5.70 44 12.13 12.13 45 13.62 13.62 46 15.07 15.07 47 9.61 9.61 48 8.91 8.91 9,512' from Los Osos Valley Road 9,700' from Los Osos Valley Road 8,311' from Los Osos Valley Road 8,482' from Los Osos Valley Road 6,311' from Los Osos Valley Road 7,322' from Los Osos Valley Road 9,111' from Los Osos Valley Road 9,308' from Los Osos Valley Road 8,706' from Los Osos Valley Road 7,500' from Los Osos Valley Road 7,721' from Los Osos Valley Road 7,899' from Los Osos Valley Road 8,108' from Los Osos Valley Road 8,909' from Los Osos Valley Road 9,909' from Los Osos Valley Road 10,084' from Los Osos Valley Road 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 50 2.44 8.34 15.06 2.63 Road Surface Thickness Traffic Index 8.00 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 10.55 11.70 0.00 0.00 HMA Overlay 0.00 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 08/23/22 8.00 8.50 220205 Higuera Street 6RXWK6WUHHW Los Osos Valley Road SB1 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Higuera Street 6RXWK6WUHHW Los Osos Valley Road SB1 08/23/22 8.00 8.50 220205 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 214' from Madonna Road 399' from Madonna Road 607' from Madonna Road 804' from Madonna Road 981' from Madonna Road 1,211' from Madonna Road 1,432' from Madonna Road 1,618' from Madonna Road 1,808' from Madonna Road 2,010' from Madonna Road 2,242' from Madonna Road 2,427' from Madonna Road 2,597' from Madonna Road 2,795' from Madonna Road 2,994' from Madonna Road 3,191' from Madonna Road 3,438' from Madonna Road 3,629' from Madonna Road 3,785' from Madonna Road 3,980' from Madonna Road 4,238' from Madonna Road 4,421' from Madonna Road 4,662' from Madonna Road 4,827' from Madonna Road 4,945' from Madonna Road 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection 09/16/22 Page 3 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: SB1 220205 City of San Luis Obispo 08/23/22 8.00 Higuera Street 6RXWK6WUHHW Los Osos Valley Road 8.50 PAVEMENT ENGINEERING INCORPORATED Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 5,206' from Madonna Road 5,411' from Madonna Road 5,615' from Madonna Road 5,814' from Madonna Road 5,993' from Madonna Road 6,232' from Madonna Road 6,481' from Madonna Road 6,610' from Madonna Road 6,808' from Madonna Road 7,002' from Madonna Road 7,245' from Madonna Road 7,430' from Madonna Road 7,653' from Madonna Road 7,806' from Madonna Road 8,007' from Madonna Road 8,278' from Madonna Road 8,415' from Madonna Road 8,695' from Madonna Road 8,811' from Madonna Road 9,002' from Madonna Road 9,201' from Madonna Road 9,407' from Madonna Road 9,601' from Madonna Road 9,809' from Madonna Road 9,991' from Madonna Road 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 6.54 6.54 2 9.77 9.77 3 7.28 7.28 4 8.65 8.65 5 6.85 6.85 6 3.77 3.77 7 5.38 5.38 8 2.44 2.44 9 9.65 9.65 10 7.08 7.08 11 9.35 9.35 12 7.38 7.38 13 6.07 6.07 14 4.18 4.18 15 3.87 3.87 16 4.44 4.44 17 4.76 4.76 18 6.65 6.65 19 6.33 6.33 20 10.31 10.31 21 12.02 12.02 22 9.11 9.11 23 7.59 7.59 24 5.46 5.46 25 9.50 9.50 26 9.20 9.20 27 8.33 8.33 28 8.10 8.10 29 8.57 8.57 30 9.02 9.02 31 12.18 12.18 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/23/22 8.00 8.50 220205 PAVEMENT ENGINEERING INCORPORATED Comments Madonna Road Los Osos Valley Road SB1 9/16/2022 City of San Luis Obispo Higuera Street 200' 5,615' from Madonna Road 5,814' from Madonna Road 5,993' from Madonna Road 4,662' from Madonna Road 4,827' from Madonna Road 4,945' from Madonna Road 5,206' from Madonna Road 6,232' from Madonna Road 1,808' from Madonna Road 2,010' from Madonna Road 981' from Madonna Road 4,421' from Madonna Road 2,994' from Madonna Road 3,191' from Madonna Road 804' from Madonna Road 1,432' from Madonna Road 2,242' from Madonna Road 2,427' from Madonna Road 2,597' from Madonna Road 2,795' from Madonna Road 1,618' from Madonna Road 214' from Madonna Road 399' from Madonna Road 607' from Madonna Road 3,438' from Madonna Road 3,629' from Madonna Road 5,411' from Madonna Road 1,211' from Madonna Road 3,785' from Madonna Road 3,980' from Madonna Road 4,238' from Madonna Road 32 10.87 10.87 33 9.41 9.41 34 8.64 8.64 35 8.12 8.12 36 11.78 11.78 37 11.32 11.32 38 9.13 9.13 39 8.88 8.88 40 8.59 8.59 41 8.25 8.25 42 9.32 9.32 43 11.13 11.13 44 13.34 13.34 45 15.06 15.06 46 13.00 13.00 47 7.96 7.96 48 8.68 8.68 49 8.17 8.17 50 5.52 5.52 8,415' from Madonna Road 9,407' from Madonna Road 9,601' from Madonna Road 9,809' from Madonna Road 9,991' from Madonna Road 7,002' from Madonna Road 7,245' from Madonna Road 7,430' from Madonna Road 7,653' from Madonna Road 9,002' from Madonna Road 9,201' from Madonna Road 7,806' from Madonna Road 8,007' from Madonna Road 6,481' from Madonna Road 6,610' from Madonna Road 6,808' from Madonna Road 8,695' from Madonna Road 8,811' from Madonna Road 8,278' from Madonna Road 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 50 2.07 11.53 42.41 7.95 Road Surface Thickness Traffic Index 10.75 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 18.20 21.70 17.59 0.08 HMA Overlay 0.04 08/23/22 10.75 8.50 220205 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Higuera Street 6RXWK6WUHHW Los Osos Valley Road SB2 Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 Higuera Street Madonna Road Los Osos Valley Road SB2 08/23/22 10.75 8.50 220205 138' from Madonna Road 313' from Madonna Road 498' from Madonna Road 703' from Madonna Road 915' from Madonna Road 1,114' from Madonna Road 1,304' from Madonna Road 1,511' from Madonna Road 1,714' from Madonna Road 1,906' from Madonna Road 2,103' from Madonna Road 2,317' from Madonna Road 2,505' from Madonna Road 2,737' from Madonna Road 2,902' from Madonna Road 3,126' from Madonna Road 3,349' from Madonna Road 3,528' from Madonna Road 3,706' from Madonna Road 3,921' from Madonna Road 4,167' from Madonna Road 4,323' from Madonna Road 4,493' from Madonna Road 4,706' from Madonna Road 4,908' from Madonna Road 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection 09/16/22 Page 3 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED Concord Redding San Luis Obispo Sacram ento 220205 City of San Luis Obispo 08/23/22 10.75 Higuera Street 6RXWK6WUHHW Los Osos Valley Road SB2 8.50 5,106' from Madonna Road 5,310' from Madonna Road 5,519' from Madonna Road 5,729' from Madonna Road 5,902' from Madonna Road 6,093' from Madonna Road 6,302' from Madonna Road 6,501' from Madonna Road 6,703' from Madonna Road 6,928' from Madonna Road 7,116' from Madonna Road 7,313' from Madonna Road 7,504' from Madonna Road 7,711' from Madonna Road 7,892' from Madonna Road 8,045' from Madonna Road 8,302' from Madonna Road 8,510' from Madonna Road 8,707' from Madonna Road 8,940' from Madonna Road 9,112' from Madonna Road 9,328' from Madonna Road 9,502' from Madonna Road 9,705' from Madonna Road 9,904' from Madonna Road 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 5.82 5.82 2 5.69 5.69 3 7.50 7.50 4 9.30 9.30 5 2.07 2.07 6 13.85 13.85 7 4.61 4.61 8 20.41 20.41 9 6.66 6.66 10 6.80 6.80 11 7.89 7.89 12 7.47 7.47 13 6.68 6.68 14 13.26 13.26 15 13.85 13.85 16 8.75 8.75 17 7.96 7.96 18 6.99 6.99 19 15.50 15.50 20 10.80 10.80 21 19.26 19.26 22 8.87 8.87 23 7.03 7.03 24 6.98 6.98 25 8.75 8.75 26 6.37 6.37 27 5.32 5.32 28 6.38 6.38 29 8.15 8.15 30 11.06 11.06 31 9.37 9.37 915' from Madonna Road 4,323' from Madonna Road 2,902' from Madonna Road 3,126' from Madonna Road 703' from Madonna Road 1,304' from Madonna Road 2,103' from Madonna Road 2,317' from Madonna Road 2,505' from Madonna Road 2,737' from Madonna Road 1,511' from Madonna Road 138' from Madonna Road 313' from Madonna Road 498' from Madonna Road 3,349' from Madonna Road 3,528' from Madonna Road 5,310' from Madonna Road 1,114' from Madonna Road 3,706' from Madonna Road 3,921' from Madonna Road 4,167' from Madonna Road 5,519' from Madonna Road 5,729' from Madonna Road 5,902' from Madonna Road 4,493' from Madonna Road 4,706' from Madonna Road 4,908' from Madonna Road 5,106' from Madonna Road 6,093' from Madonna Road 1,714' from Madonna Road 1,906' from Madonna Road 9/16/2022 City of San Luis Obispo Higuera Street 200' PAVEMENT ENGINEERING INCORPORATED Comments Madonna Road Los Osos Valley Road SB2 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/23/22 10.75 8.50 220205 32 11.30 11.30 33 6.16 6.16 34 4.88 4.88 35 24.02 24.02 36 27.33 27.33 37 9.80 9.80 38 11.38 11.38 39 13.19 13.19 40 10.87 10.87 41 15.15 15.15 42 5.94 5.94 43 7.66 7.66 44 15.34 15.34 45 9.67 9.67 46 30.65 30.65 47 42.41 42.41 48 33.89 33.89 49 8.66 8.66 50 8.55 8.55 8,940' from Madonna Road 9,112' from Madonna Road 7,711' from Madonna Road 7,892' from Madonna Road 6,302' from Madonna Road 6,501' from Madonna Road 6,703' from Madonna Road 8,510' from Madonna Road 8,707' from Madonna Road 8,045' from Madonna Road 6,928' from Madonna Road 7,116' from Madonna Road 7,313' from Madonna Road 7,504' from Madonna Road 8,302' from Madonna Road 9,328' from Madonna Road 9,502' from Madonna Road 9,705' from Madonna Road 9,904' from Madonna Road Laboratory No.:L222142 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 10, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C1, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 18.6 19.6 20.2 Dry Density (PCF) 114.3 113.5 112.3 Resistance Value (R) 20 10 1 Exudation Pressure (PSI) 387 264 178 Expansion Pressure 377 268 82 18.6 RESISTANCE VALUE AT 300 P.S.I. 13 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222142 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 10, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C3, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 16.5 17.5 18.1 Dry Density (PCF) 118.2 117.3 115.5 Resistance Value (R) 22 11 2 Exudation Pressure (PSI) 409 275 189 Expansion Pressure 78 39 0 16.5 RESISTANCE VALUE AT 300 P.S.I. 13 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222761 Project No.:220205 Sample Date:August 23, 2022 Report Date:September 15, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C5, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 16.7 17.7 18.3 Dry Density (PCF) 115.3 114.0 112.8 Resistance Value (R) 19 8 0 Exudation Pressure (PSI) 411 282 198 Expansion Pressure 87 43 0 16.7 RESISTANCE VALUE AT 300 P.S.I. 10 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222161 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C7, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 16.7 17.7 18.2 Dry Density (PCF) 116.6 115.2 115.1 Resistance Value (R) 21 10 1 Exudation Pressure (PSI) 393 273 189 Expansion Pressure 82 43 0 16.7 RESISTANCE VALUE AT 300 P.S.I. 12 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222161 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C9, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 15.9 16.9 17.4 Dry Density (PCF) 118.7 116.0 115.1 Resistance Value (R) 19 9 0 Exudation Pressure (PSI) 408 278 192 Expansion Pressure 87 43 0 15.9 RESISTANCE VALUE AT 300 P.S.I. 11 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222178 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C11, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 16.2 17.2 17.7 Dry Density (PCF) 117.3 116.6 116.0 Resistance Value (R) 19 9 1 Exudation Pressure (PSI) 405 279 197 Expansion Pressure 78 39 0 16.2 RESISTANCE VALUE AT 300 P.S.I. 10 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222178 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C13, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 10.1 11.1 11.5 Dry Density (PCF) 124.8 123.2 122.6 Resistance Value (R) 20 9 1 Exudation Pressure (PSI) 420 291 205 Expansion Pressure 87 43 0 10.1 RESISTANCE VALUE AT 300 P.S.I. 10 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222161 Project No.:220205 Sample Date:July 29, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C15, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 17.1 18.1 18.7 Dry Density (PCF) 116.2 115.1 114.3 Resistance Value (R) 19 8 1 Exudation Pressure (PSI) 395 276 188 Expansion Pressure 82 39 0 17.1 RESISTANCE VALUE AT 300 P.S.I. 11 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222714 Project No.:220205 Sample Date:August 23, 2022 Report Date:September 13, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C19, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 17.6 18.7 19.2 Dry Density (PCF) 114.6 112.8 112.6 Resistance Value (R) 19 8 0 Exudation Pressure (PSI) 404 280 193 Expansion Pressure 87 48 0 17.6 RESISTANCE VALUE AT 300 P.S.I. 10 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Laboratory No.:L222714 Project No.:220205 Sample Date:August 23, 2022 Report Date:August 11, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C21, Higuera Street Specimen No. 1 2 3 Moisture Content (%) 14.8 15.9 16.4 Dry Density (PCF) 117.7 117.8 115.9 Resistance Value (R) 19 9 1 Exudation Pressure (PSI) 407 281 193 Expansion Pressure 82 43 0 14.8 RESISTANCE VALUE AT 300 P.S.I. 10 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Higuera Street Photo 1 Higuera Street Photo 2 Higuera Street Photo 3 Higuera Street Photo 4 Higuera Street Photo 5 Higuera Street Photo 6 Higuera Street Photo 7 Higuera Street Photo 8 Higuera Street Photo 9 Higuera Street Photo 10 Higuera Street Photo 11 Higuera Street Photo 12 Higuera Street Photo 13 MADONNA ROAD +:<WR+LJXHUD6WUHHW Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo Madonna Road 101 On/Off Ramp to Higuera Street CORING LOG STRUCTURAL REQUIREMENTS (by Deflection Analysis) REFLECTIVE CRACKING REQUIREMENTS *(Required overlay by reflective cracking is half the existing AC thickness - if pavement fabric is used then these criteria can be reduced by 1-1/4 inch with at least a minimum overlay requirement of 1-3/4 inch) VISUAL CONDITIONS The pavement exhibits moderate raveling, block shrinkage cracking and areas of alligator cracking. Some areas of alligator cracking have progressed to base failure in the wheel tracks. The base failures are more prominent in the #2 lanes. Core No. Location HMA Layer (Inches) Fabric (Yes/No) AB Layer (Inches) R-value 1 EB2 – 350 feet east of 101 on/off ramp 9 No 7 - 2 EB1 – 660 feet east of 101 on/off ramp 10 No 7-1/2 16 3 WB2 – 280 feet west of Higuera Street 7-1/2 No 6 - 4 WB1 – 660 feet west of Higuera Street 11 No 5 - Direction Traffic Index (TI) Tolerable 80th Percentile HMA Overlay Requirement (Inches) EB1 8.5 15.0 11.5 0 EB2 8.5 15.0 18.5 1/2 WB1 8.5 15.0 12.9 0 WB2 8.5 15.0 20.9 1-1/2 HMA Overlay Requirement (Inches)* Pavement Fabric Required (Yes or No) 3-3/4 Yes Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo ANALYSIS The existing pavement consists of 7-1/2 to 11 inches of asphalt concrete over 5 to 7-1/2 inches of aggregate base. PEI could not identify if pavement fabric was present in the asphalt concrete layer. The native soil is a brown clay with an R-value of 16. Based on the deflection analysis, the pavement is structurally deficient in the #2 lanes by up to 1-1/2 inches of HMA. For this pavement, PEI is providing recommendations for overlaying with RHMA, milling and replacement, partial depth recycling (PDR), full depth reclamation (FDR) and reconstruction with Full Depth HMA or HMA over aggregate base. Overlaying with HMA is not recommended because of the thicker overlay required to meet reflective cracking criteria. RECOMMENDATIONS Overlay Options HMA Overlaying with HMA is not recommended because of the thicker overlay required to meet reflective cracking criteria. RHMA We recommend 10-inch pavement repairs of base failures, placing a 1-inch HMA leveling course and a 2-inch RHMA overlay. The pavement should be evaluated for the base failures present. If the amount of base failure exceeds 10%, then placing overlays may not be cost effective. Milling and Replacement Option HMA We recommend milling off 3 inches of the existing pavement, 7-inch pavement repairs of base failures, placing a 1-inch HMA leveling course, pavement fabric and a 2-inch HMA overlay. RHMA We recommend milling off 3 inches of the existing pavement, 7-inch pavement repairs of base failures, placing a 1-inch HMA leveling course and a 2-inch RHMA overlay. Partial Depth Recycling Option (PDR) We recommend milling off 2-1/2 inches of the existing pavement, Partial Depth Recycling (with Emulsified Asphalt or Foamed Asphalt) to a depth of 3 inches, 7-inch pavement repairs of base failures and placing a 2-1/2-inch RHMA overlay. FDR Option We recommend uniformly pulverizing 16 inches of existing asphalt concrete, aggregate base, and native soil, removing 6-1/2 inches of pulverized material, treating the remaining pulverized material and native soil with cement to a depth of 13 inches and placing 6-1/2 inches of new Deflection and Structural Summary Project No. 220205 2023 Arterial Pavement Improvement Project Client: City of San Luis Obispo HMA in 3 lifts. This recommendation is based on an unconfined compressive strength (UCS) of 300 psi. Reconstruction Options Full Depth HMA We recommend removing to a depth of 12 inches and placing 12 inches of HMA in 4 to 5 lifts. HMA over Aggregate Base We recommend removing to a depth of 20-1/2 inches, installing a SEG, placing 15 inches of aggregate base and 5-1/2 inches of HMA in 2 lifts. Both reconstruction alternatives could develop unstable grade from construction traffic during the construction process. Stabilization allowances should be included if one of these alternatives is chosen. As previously discussed in the report, rehabilitation alternatives may have different anticipated service lives. The design engineer should evaluate each alternative based on cost, constructability, and impact on the public. 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 9 7.82 10.30 12.16 1.43 Road Surface Thickness Traffic Index 0.79 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 11.51 12.14 0.00 0.00 HMA Overlay 0.00 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Higuera Street Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 EB1 08/24/22 0.79 8.50 220205 Madonna Road 101 on/off Ramp 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Madonna Road 101 on/off Ramp Higuera Street EB1 08/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 101' from 101 Ramp 205' from 101 Ramp 303' from 101 Ramp 414' from 101 Ramp 506' from 101 Ramp 599' from 101 Ramp 710' from 101 Ramp 803' from 101 Ramp 899' from 101 Ramp 1 2 3 4 5 6 7 8 9 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 10.77 10.77 2 8.68 8.68 3 11.70 11.70 4 11.09 11.09 5 10.82 10.82 6 9.24 9.24 7 12.16 12.16 8 10.44 10.44 9 7.82 7.82 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED Comments 101 on/off Ramp Higuera Street EB1 9/16/2022 City of San Luis Obispo Madonna Road 100' 899' from 101 Ramp 506' from 101 Ramp 414' from 101 Ramp 710' from 101 Ramp 803' from 101 Ramp 101' from 101 Ramp 205' from 101 Ramp 303' from 101 Ramp 599' from 101 Ramp 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 9 5.17 13.68 25.04 5.73 Road Surface Thickness Traffic Index 0.79 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 18.50 21.02 18.91 0.10 HMA Overlay 0.05 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Higuera Street Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 EB2 08/24/22 0.79 8.50 220205 Madonna Road 101 on/off Ramp 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Madonna Road 101 on/off Ramp Higuera Street EB2 08/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 104' from 101 Ramp 207' from 101 Ramp 305' from 101 Ramp 408' from 101 Ramp 515' from 101 Ramp 608' from 101 Ramp 718' from 101 Ramp 820' from 101 Ramp 888' from 101 Ramp 1 2 3 4 5 6 7 8 9 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 19.57 19.57 2 5.17 5.17 3 14.61 14.61 4 13.27 13.27 5 25.04 25.04 6 12.50 12.50 7 12.29 12.29 8 10.59 10.59 9 10.09 10.09 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED Comments 101 on/off Ramp Higuera Street EB2 9/16/2022 City of San Luis Obispo Madonna Road 100' 888' from 101 Ramp 515' from 101 Ramp 408' from 101 Ramp 718' from 101 Ramp 820' from 101 Ramp 104' from 101 Ramp 207' from 101 Ramp 305' from 101 Ramp 608' from 101 Ramp 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 9 9.12 11.29 14.58 1.86 Road Surface Thickness Traffic Index 0.79 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 12.85 13.67 0.00 0.00 HMA Overlay 0.00 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo 101 on/off Ramp Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 WB1 08/24/22 0.79 8.50 220205 Madonna Road Higuera Street 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Madonna Road Higuera Street 101 on/off Ramp WB1 08/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 109' from Higuera St 222' from Higuera St 326' from Higuera St 404' from Higuera St 512' from Higuera St 609' from Higuera St 705' from Higuera St 800' from Higuera St 881' from Higuera St 1 2 3 4 5 6 7 8 9 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 12.26 12.26 2 13.02 13.02 3 12.54 12.54 4 10.36 10.36 5 9.80 9.80 6 9.12 9.12 7 14.58 14.58 8 9.74 9.74 9 10.16 10.16 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED Comments Higuera Street 101 on/off Ramp WB1 9/16/2022 City of San Luis Obispo Madonna Road 100' 881' from Higuera St 512' from Higuera St 404' from Higuera St 705' from Higuera St 800' from Higuera St 109' from Higuera St 222' from Higuera St 326' from Higuera St 609' from Higuera St 09/16/22 Page 1 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Deflection Data Analysis Deflection Readings (Equivalent Deflectometer Units) No. of Tests Low Mean High Std. Dev. 9 5.02 14.40 26.22 7.68 Road Surface Thickness Traffic Index 0.79 8.50 Structural Design Tolerable 80th Percentile 90th Percentile % Reduction GE Deficient 15.00 20.86 24.24 28.08 0.21 HMA Overlay 0.11 (805) 781-2265 (916) 209-8300 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo 101 on/off Ramp Concord Redding San Luis Obispo Sacramento (877) 240-0468 (530) 224-4535 WB2 08/24/22 0.79 8.50 220205 Madonna Road Higuera Street 09/16/22 Page 2 Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line: Project Number: Madonna Road Higuera Street 101 on/off Ramp WB2 08/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED City of San Luis Obispo Concord Redding San Luis Obispo Sacram ento (877) 240-0468 (530) 224-4535 (805) 781-2265 (916) 209-8300 150' from Higuera St 206' from Higuera St 302' from Higuera St 416' from Higuera St 502' from Higuera St 609' from Higuera St 705' from Higuera St 800' from Higuera St 921' from Higuera St 1 2 3 4 5 6 7 8 9 0 102030405060708090100 Te s t P o i n t Deflectometer Deflection Date: Client: Interval: Road: Survey Date: From: Thickness: To: Traffic Index: Lane/Line Project Number: Test Points DynaflectConditions Deflection Exclude 1 9.82 9.82 2 9.70 9.70 3 24.23 24.23 4 5.49 5.49 5 16.56 16.56 6 13.68 13.68 7 18.91 18.91 8 5.02 5.02 9 26.22 26.22 Concord (877) 240-0468 Redding (530) 224-4535 San Luis Obispo (805) 781-2265 Sacramento (916) 209-8300 8/24/22 0.79 8.50 220205 PAVEMENT ENGINEERING INCORPORATED Comments Higuera Street 101 on/off Ramp WB2 9/16/2022 City of San Luis Obispo Madonna Road 100' 921' from Higuera St 502' from Higuera St 416' from Higuera St 705' from Higuera St 800' from Higuera St 150' from Higuera St 206' from Higuera St 302' from Higuera St 609' from Higuera St Laboratory No.:L222761 Project No.:220205 Sample Date:August 24, 2022 Report Date:September 15, 2022 Client:City of San Luis Obispo Project Name:Pavement Evaluations for 2023 Arterial Pavement Improvement Project Sample Description:Brown Clay Sample Location:C2, Madonna Road Specimen No. 1 2 3 Moisture Content (%) 14.7 13.7 15.2 Dry Density (PCF) 119.2 120.1 118.4 Resistance Value (R) 12 27 2 Exudation Pressure (PSI) 272 388 186 Expansion Pressure 35 69 0 14.7 RESISTANCE VALUE AT 300 P.S.I. 16 Reviewed By: Materials Engineer Brandon Rodebaugh RESISTANCE (R) VALUE TEST ASTM D 2844 As Received Moisture Content (%) 0 10 20 30 40 50 60 70 80 90 100 0100200300400500600700800 Re s i s t a n c e V a l u e Exudation Pressure (P.S.I.) Resistance Value Test 300 P.S.I. Madonna Road Photo 1 Madonna Road Photo 2 Madonna Road Photo 3 Madonna Road Photo 4